Search Results

Search found 42218 results on 1689 pages for 'os version'.

Page 454/1689 | < Previous Page | 450 451 452 453 454 455 456 457 458 459 460 461  | Next Page >

• What are the major distinctions between PureDarwin and FreeBSD?

  - by ??????? ???????????

  I'm looking to install a different unix on my workstation to acquire some perspective on GNU/Linux and out of curiosity. I have narrowed my options down to these two. The reason for considering PureDarwin is because I have very little experience with Apple's products. So my question is will installing and using PureDarwin give me a closer understanding of OSX than would running FreeBSD? What I have in mind are day to day routines like adding users, installing software and configuring various aspects of the underlying OS. I know that the GUI of OSX would not be available, but that is not a concern. As a secondary, less important question, can I buy OS X in the apple store and run it in a virtual machine or does that violate their EULA?

  Read the article

• Solaris 11 installed, no updates?

  - by Paul De Niro

  I was messing around with solaris and decided to give Solaris 11 a try so I downloaded it from the Oracle website. After installing the OS, I went into the package manager and did an update. It told me that there were to available updates! I find this hard to believe considering that it's running a vulnerable version of firefox and java, its own in-house software product! Many of the other software products that came with the default install are also out of date and vulnerable. Is this normal for an Oracle install, or did I do something wrong with the upgrade process? I typed "pkg update" at the prompt, and I noticed that it did call out to pkg.oracle.com looking for updates. I find it bizarre that there are no updates available for an OS that was released a couple months ago with vulnerable software...

  Read the article

• LIbgdx and android scaling

  - by petervaz

  Following my previous question, I decided to migrate my andengine game to libdgx to have the desktop option. The game assets were planned, at first, to use a 1080x600 resolution and I raised that to 1200x800 which is native for many tablets and would look better on monitors. I followed this blog aproach regarding aspect ratio, which worked nicely on the desktop version, but running the android version (on my smaller tablet), the background would still appear on the original size being cropped by the smaller screen size. How can I force the resize of the background (or for what matter, of everything) on android to fit the screen?

  Read the article

• How to partition my hard drive, quicker?

  - by Sam

  When I install Windows 7 on my hard drive, it makes three partitions. One with the OS itself, one with bootmgr inside (that is 100 MiB), and one with the factory image (all the crapware from HP). My final goal is to have the OS on a partition of 100 GiB and keep the rest (900 GiB) for storage. I thought it would be easy using gparted, but it is taking so long. It will take hours. There must a way to partition the drive before installing Windows. Yeah, because what I think makes the shrinking/moving of the partitions take so long is because they are not empty (am I wrong?).

  Read the article

• Is it OK to create all primary partitions.?

  - by james

  I have a 320GB hard disk. I only use either ubuntu or kubuntu (12.04 for now). I don't want to use windows or any other dual boot os. And i need only 3 partitions on my hard disk. One for the OS and remaining two for data storage. I don't want to create swap also. Now can i create all primary partitions on the hard disk. Are there any disadvantages in doing so. If all the partitions are primary i think i can easily resize partitions in future. On second thought i have the idea of using seperate partition for /home. Is it good practice . If i have to do this, i will create 4 partitions all primary. In any case i don't want to create more than 4 partitions . And i know the limit will be 4. So is it safe to create all 3 or 4 primary partitions. Pls suggest me, What are the good practices . (previously i used win-xp and win-7 on dual boot with 2 primary partitions and that bugged me somehow i don't remember. Since then i felt there should be only one primary partition in a hard disk.) EDIT 1 : Now i will use four partitions in the sequence - / , /home , /for-data , /swap . I have another question. Does a partition need continuous blocks on the disk. I mean if i want to resize partitions later, can i add space from sda3 to sda1. Is it possible and is it safe to do ?

  Read the article

• Blacklist a single access point of a wireless network

  - by Zr40

  At my university, one of the wireless access points is failing. When something tries to associate to the network using that access point, it deassociates the client, claiming 802.1X authentication failure. Other access points do work normally using the same credentials. The issue has been reported, but after a month it still has still not been fixed. Now, I'm looking for a way to blacklist the access point's BSSID, so the OS prefers other access points on the same SSID. How can I blacklist specific BSSIDs in either Mac OS X Snow Leopard or Windows 7?

  Read the article

• Eclipse Juno Switch Editor in Order

  - by inspectorG4dget

  In case it matters: OS: Mac OS X Lion (10.7.4) Eclipse: Juno, Build id: 20120614-1722 I have several files open in my eclipse workspace as tabs. The default shortcuts for previous and next editors are ?F6 and ?shiftF6. I know how to change these shortcuts, that's not the issue. However, what I want to do, is switch between editors in the way in which they're ordered in the tab bar. Currently, the editors change in order of last used/viewed. So, if I had three files (A, B and C in order) open and I'm currently editing A and I edited B last, when I use the shortcut for "Previous Editor", it takes me to B instead of C (and vice versa). Is there any way for me to get this functionality out of eclipse (if so, how)? Thank you

  Read the article

• LibreOffice : la Release Candidate 2 disponible, quelles différences avez-vous trouvées entre LibreOffice et OpenOffice.org ?

  LibreOffice : la Release Candidate 2 disponible Quelles différences avez-vous trouvées entre LibreOffice et OpenOffice.org ? La deuxième Release Candidate de LibreOffice 3.3, la suite bureautique issue du fork d'OpenOffice.org est disponible. Cette version apporte quelques améliorations et corrections de bugs grâce aux contributions de 80 développeurs depuis la bêta 3. A l'occasion de cette sortie, LibreOffice dispose désormais de son propre site Web disponible aussi en Allemand et partiellement en une dizaine de langues. La version française est elle encore très incomplète. Pour l'heure, LibreOffice ne se démarque pas encore significativement du cana...

  Read the article

• Can I redirect the HTTP request towards an old folder to the homepage using .htaccess file?

  - by AndreaNobili

  I have to following situation: I had an old blog that was made using Joomla (this blog was indexed well enough by search engines). For some problems I delete it and I have create it again using WordPress. Now I have many visit (from Google) that leading to specific pages of the old site (pages that don't exist in the new version). For example I have visit to URL as: /scorejava/index.php/corso-spring-mvc/1-test that don't exist on my new site. I would know if using the .htaccess file (or other sistem) I can redirect the HTTP request directed to some subfolder (that don't exist in the new version) to the homepage of my new site. For example I have the request towards the void URL: /scorejava/index.php/corso-spring-mvc/1-test. And I would create a regular expression that say something like: all the request toward the subfolder corso-spring-mvc (and all it's content file and subfolder) have to be redirected to www.scorejava.com. Is it possible?

  Read the article

• node.js server not running

  - by CMDadabo

  I am trying to learn node.js, but I'm having trouble getting the simple server to run on localhost:8888. Here is the code for server.js: var http = require("http"); http.createServer(function(request, response) { response.writeHead(200, {"Content-Type": "text/plain"}); response.write("Hello World"); response.end(); }).listen(8888); server.js runs without errors, and trying netstat -an | grep 8888 from terminal returns tcp4 0 0 *.8888 *.* LISTEN However, when I go to localhost:8888 in a browser, it says that it cannot be found. I've looked at all the related questions, and nothing has worked so far. I've tried different ports, etc. I know that my router blocks incoming traffic on port 8888, but shouldn't that not matter if I'm trying to access it locally? I've run tomcat servers on this port before, for example. Thanks so much for your help! node.js version: v0.6.15 OS: Mac OS 10.6.8

  Read the article

• New release for the Visual Studio 2010 and .NET Framework 4 Training Kit

  - by Enrique Lima

  Among the new content in the release, is a set of ALM docs and labs. The ALM content referenced above is: o Using Code Analysis with Visual Studio 2010 to Improve Code Quality o Introduction to Exploratory Testing with Microsoft Test Manager 2010 o Introduction to Platform Testing with Microsoft Test Manager 2010 o Introduction to Quality Tracking with Visual Studio 2010 o Introduction to Test Planning with Microsoft Test Manager 2010 All ALM labs point to the latest version of the VS 2010 RTM VM. You can download the Training Kit from :  http://www.microsoft.com/download/en/details.aspx?displaylang=en&id=23507 Visit the online content: http://msdn.microsoft.com/en-us/VS2010TrainingCourse Download the most recent version of the Visual Studio: http://www.microsoft.com/download/en/details.aspx?displaylang=en&id=240

  Read the article

• Starting VM as an executable with as low overhead as possible

  - by Robert Koritnik

  Is there a solution to create a virtual machine and start it by having an executable file, that will start the machine? If possible to start as quickly as possible. Strange situation? Not at all. Read on... Real life scenario Since we can't have domain controller on a non-server OS it would be nice to have domain controller in an as thin as possible machine (possibly Samba or similar because we'd like to make it startup as quickly as possible - in a matter of a few seconds) packed in a single executable. We could then configure our non-server OS to run the executable when it starts and before user logs in. This would make it possible to login into a domain.

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Upgrade to 12.04 LTS failed, unable to boot

  - by stargazergal

  I was trying to upgrade to 12.04 LTS, but the upgrade froze in the process (it was stuck for over 8 hours) and I had to do a hard reboot. Now when I boot up, I get the following: mountall /lib/x86_64-linux-gnu/libc.so.6 version 'glibc_2.14' not found. I'm not sure what I need to do from here. Do I need to go back to the previous version? Or can 12.04 still be installed? I don't want to lose any of my files. I am still new to Linux, so please give detailed step-by-step instructions.

  Read the article

• Upgrade Ubuntu 12.04 to 12.10 failed

  - by pre-commit-hook

  I've a problem. Upgrade failed after "Setting new software channels", when Calculating changes. I tried error: Not all updates can be installed An unresolvable problem occurred while calculating the upgrade: E:Unable to correct problems, you have held broken packages. This can be caused by: * Upgrading to a pre-release version of Ubuntu * Running the current pre-release version of Ubuntu * Unofficial software packages not provided by Ubuntu If none of this applies, then please report this bug using the command 'ubuntu-bug ubuntu-release-upgrader-core' in a terminal. Now i have 1580 packages to update and do not update. Partial system upgrade also fails in the first step. What next? Alternatively, to undo the changes? Thank's to help.

  Read the article

• Why am I getting [mount error(22): Invalid argument] while trying to mount SMB network drive?

  - by Steve_

  Disclaimer: I am very new to Linux :) Anyway, onward: I have a fresh instance of Ubuntu Server (12.04.1 LTS) running on my network and I want to mount a network drive to the server so I can access the contents. The network drive is a SAMBA compatible drive running Darwin OS. If I run the following command: smbclient -L //192.168.0.2 -U myuser It prompts me for the password and then displays output similar to: Domain=[SERVER01] OS=[Darwin] Server=[@(#)PROGRAM:smbd PROJECT:smbx-105.4.0] Sharename Type Comment --------- ---- ------- Comp Staff's Public Folder Disk CompRaid03 Disk Dropbox Disk Groups Disk IPC$ IPC Public Disk Users Disk compstaff Disk However, when I try and mount the CompRaid03 share, using this command: sudo mount -t cifs //192.168.0.2/CompRaid03 /mnt/myshare -o username=myuser I get the same password prompt, but after putting the correct password in, I received this error: mount error(22): Invalid argument dmesg | tail returns: [23576.037373] CIFS VFS: cifs_mount failed w/return code = -22 I don't understand what is wrong with this command. I've managed to mount a share on my current (Windows 8) machine using basically the same command but with a different IP address and share name (obviously). I've spent a good few hours trying to solve this and got no where. Any help or pointers would be greatly appreciated. Thanks Steve EDIT As suggested I've also trued using "user=" instead of "username=": sudo mount -t cifs //192.168.0.2/CompRaid03 /mnt/svnrepo -o user=myuser This results in the same "Invalid argument" error.

  Read the article

• Languages and tools that are "portable" (work well from a USB storage drive) [closed]

  - by CodexArcanum

  I'm a huge fan of running programs from my portable hard drive: it means I always have my favorite tools no matter what computer I'm on. Sadly, development tools seem to be hard to get portable at times. I recently realized that the "portable" version of MinGW I was using off my USB drive was actually interfering with a locally installed version of MinGW, so sometimes even the tools you think are portable, aren't. So what are the best portable development tools that you've used? What runs well on a portable media, leaves the host machine clean, and generally makes moving around easier for you?

  Read the article

• Top causes of slow ssh logins

  - by Peter Lyons

  I'd love for one of you smart and helpful folks to post a list of common causes of delays during an ssh login. Specifically, there are 2 spots where I see a range from instantaneous to multi-second delays. Between issuing the ssh command and getting a login prompt and between entering the passphrase and having the shell load Now, specifically I'm looking at ssh details only here. Obviously network latency, speed of the hardware and OSes involved, complex login scripts, etc can cause delays. For context I ssh to a vast multitude of linux distributions and some Solaris hosts using mostly Ubuntu, CentOS, and MacOS X as my client systems. Almost all of the time, the ssh server configuration is unchanged from the OS's default settings. What ssh server configurations should I be interested in? Are there OS/kernel parameters that can be tuned? Login shell tricks? Etc?

  Read the article

• Compiz problems in Ubuntu 12.10

  - by Antonio Raffaele Iannaccone

  I have installed ubuntu 12.10 x64 on my notebook and I wanted to make a little customization in the UI, so i downloaded Compiz Settings Manager and opened it up. Once I opened it up, I found out that in the compiz are not all those settings and animations (that I could apply like on the photos, videos etc.) so I reinstalled it few times. Once I get bored with the reinstalling I checked one field in there and Ubuntu (OS) started to get "lagged" (Dash get hid, OS started to do not respond very well). So please, can anyone help me? How can I customize my ubuntu without get lagged and with all the animations that have to be available in the compiz? Thanks to all! thank you! It seems that it helped to fix the Dash-hide problem, but I still do not have all the animations and features that have to be in the Compiz (program). Can you help me with this too please? Thanks a lot!

  Read the article

• How to redirect a international domain to a subfolder on the English site without hurting Google rankings?

  - by ernest1a

  I have two sites: www.example.de www.main.com www.main.com is English version of www.example.de which is in German. I want to keep only www.main.com. For the English version I will keep www.main.com, but for German I want to move it to www.main.com/de. I am wondering what would be best solution for old www.example.de: Redirect everything from www.example.de to www.main.com/de using 301 redirect? Redirect everything from www.example.de towww.main.com/de/page-url-of-old-size.html? So each link actually get own address. Is that necessary or will Google realize where the page belongs on new site even if I redirect everything to home page? Any other solution, maybe just set in Google webmaster tools the new domain or anything like that?

  Read the article

• Internet Explorer 10 Preview disponible pour Windows 7, le navigateur bat Chrome et Firefox sur le test Mandelbrot

  Internet Explorer 10 bientôt disponible pour Windows 7, Microsoft annonce la sortie d'une préversion en novembre Les utilisateurs de Windows 7 pourront télécharger une préversion d'Internet Explorer 10 à partir de mi-novembre. IE 10 est la prochaine mise à jour majeure du navigateur de Microsoft qui sera disponible en version finale au même moment que Windows 8 annoncé pour le 26 octobre prochain. Cette version se distingue essentiellement par sa nouvelle interface qui repose sur les tuiles Windows 8 et le support de la navigation tactile. Le navigateur dispose de nouvelles capacités de développement et de performances améliorées grâce à l'accélération matérielle. M...

  Read the article

• Multi-monitor resolution and position settings lost after reboot

  - by SoftDeveloper

  I've had two 1280x1024 monitors running for years on an nVidia 8800GT card with no problems. I've now replaced one monitor with a new 2560x1440 one. The card seems to support both fine, however every time I reboot the resolutions and monitor positions revert to the old settings. I've tried upgrading, downgrading, stripping out and reinstalling many versions of the nvidia drivers to no avail. Logging in as another user doesn't help - same problem. Booting into another another OS (Win7 64) works OK, so it is just this OS installation. During boot up everything looks fine (ie native 2450x1440 res) until the nVidia control panel or something is loaded which flips it back into the old mode. I have no old saved nvidia profiles. I can't find anything in the registry relating to these old settings. Its driving me crazy having to set resolutions and realign monitors on every reboot! Can anybody help?

  Read the article

• IE10 : Microsoft dévoile les détails du navigateur dans Windows 8, tuiles de navigation, ergonomie et sécurité

  IE10 : Microsoft dévoile les détails du navigateur dans Windows 8 tuiles de navigation, ergonomie, support du tactile et améliorations de la sécurité Microsoft a publié depuis quelques semaines déjà la Consumer Preview de Windows 8 avec un nombre important de nouveaux composants. Parmi ceux-ci, figure la Platform Preview 5 d'Internet Explorer 10. Quoi de neuf pour la future version du navigateur dans cette mouture de l'OS ? C'est à cette question que répond Microsoft au travers du blog Windows 8, qui revient sur les améliorations et nouveautés d'IE 10 dans le système d'exploitation. La firme se concentre principalement sur la version Metro d'IE 10. Pour rappel IE 10 se décl...

  Read the article

• Installing drivers and getting -> Error Code 28

  - by Adrov

  I've recently upgraded mainboard, without reinstalling OS, so I guess that's the issue. I really don't want to install OS at this moment. Issue is I can't install USB drivers, if I right-click uninstall, just installs same driver, which isn't working ofc. and giving error code 28. I fixed such issue once long long time ago, with editing registry, but I really can't remember what and where I have to do, so if anyone know please let me know, I'm also open to all other solutions to this issue. http://i.stack.imgur.com/AuBtB.png

  Read the article

• disable intel gpu in ubuntu 12.04

  - by small_potato

  I am wondering if there is anything to disable the intel gpu on ubuntu 12.04. I want to be able to setup dual monitor using nvidia-settings. It seems the intel gpu is used for display as suggested by sudo lshw -c display the output is *-display description: VGA compatible controller product: NVIDIA Corporation vendor: NVIDIA Corporation physical id: 0 bus info: pci@0000:01:00.0 version: a1 width: 64 bits clock: 33MHz capabilities: pm msi pciexpress vga_controller bus_master cap_list rom configuration: driver=nvidia latency=0 resources: irq:16 memory:c0000000-c0ffffff memory:90000000-9fffffff memory:a0000000-a1ffffff ioport:4000(size=128) memory:a2000000-a207ffff *-display description: VGA compatible controller product: Haswell Integrated Graphics Controller vendor: Intel Corporation physical id: 2 bus info: pci@0000:00:02.0 version: 06 width: 64 bits clock: 33MHz capabilities: msi pm vga_controller bus_master cap_list rom configuration: driver=i915 latency=0 resources: irq:47 memory:c2000000-c23fffff memory:b0000000-bfffffff ioport:5000(size=64) I have a lenovoY410 with GT750M. It seems there is no way to turn off the intel gpu in bios either. Help please. Thanks.

  Read the article

< Previous Page | 450 451 452 453 454 455 456 457 458 459 460 461  | Next Page >