Search Results

Search found 22358 results on 895 pages for 'django raw query'.

Page 459/895 | < Previous Page | 455 456 457 458 459 460 461 462 463 464 465 466  | Next Page >

  • SQL Server: Output an XML field as tabular data using a stored procedure

    - by Pawan
    I am using a table with an XML data field to store the audit trails of all other tables in the database. That means the same XML field has various XML information. For example my table has two records with XML data like this: 1st record: <client> <name>xyz</name> <ssn>432-54-4231</ssn> </client> 2nd record: <emp> <name>abc</name> <sal>5000</sal> </emp> These are the two sample formats and just two records. The table actually has many more XML formats in the same field and many records in each format. Now my problem is that upon query I need these XML formats to be converted into tabular result sets. What are the options for me? It would be a regular task to query this table and generate reports from it. I want to create a stored procedure to which I can pass that I need to query "<emp>" or "<client>", then my stored procedure should return tabular data.

    Read the article

  • SqlCe odd results why? -- Same SQL, different results in different apps. Issue with

    - by NitroxDM
    When I run this SQl in my mobile app I get zero rows. select * from inventory WHERE [ITEMNUM] LIKE 'PUMP%' AND [LOCATION] = 'GARAGE' When I run the same SQL in Query Analyzer 3.5 using the same database I get my expected one row. Why the difference? Here is the code I'm using in the mobile app: SqlCeCommand cmd = new SqlCeCommand(Query); cmd.Connection = new SqlCeConnection("Data Source="+filePath+";Persist Security Info=False;"); DataTable tmpTable = new DataTable(); cmd.Connection.Open(); SqlCeDataReader tmpRdr = cmd.ExecuteReader(); if (tmpRdr.Read()) tmpTable.Load(tmpRdr); tmpRdr.Close(); cmd.Connection.Close(); return tmpTable; UPDATE: For the sake of trying I used the code found in one of the answers found here and it works as expected. So my code looks like this: SqlCeConnection conn = new SqlCeConnection("Data Source=" + filePath + ";Persist Security Info=False;"); DataTable tmpTable = new DataTable(); SqlCeDataAdapter AD = new SqlCeDataAdapter(Query, conn); AD.Fill(tmpTable); The issue appears to be with the SqlCeDataReader. Hope this helps someone else out!

    Read the article

  • How can I use "Dependency Injection" in simple php functions, and should I bother?

    - by Tchalvak
    I hear people talking about dependency injection and the benefit of it all the time, but I don't really understand it. I'm wondering if it's a solution to the "I pass database connections as arguments all the time" problem. I tried reading wikipedia's entry on it, but the example is written in Java so I don't solidly understand the difference it is trying to make clear. ( http://en.wikipedia.org/wiki/Dependency_injection ). I read this dependency-injection-in-php article ( http://www.potstuck.com/2009/01/08/php-dependency-injection/ ), and it seems like the objective is to not pass dependencies to an object directly, but to cordon off the creation of an object along with the creation of it's dependencies. I'm not sure how to apply that in a using php functions context, though. Additionally, is the following Dependency Injection, and should I bother trying to do dependency injection in a functional context? Version 1: (the kind of code that I create, but don't like, every day) function get_data_from_database($database_connection){ $data = $database_connection->query('blah'); return $data; } Version 2: (don't have to pass a database connection, but perhaps not dependency injection?) function get_database_connection(){ static $db_connection; if($db_connection){ return $db_connection; } else { // create db_connection ... } } function get_data_from_database(){ $conn = get_database_connection(); $data = $conn->query('blah'); return $data; } $data = get_data_from_database(); Version 3: (the creation of the "object"/data is separate, and the database code is still, so perhaps this would count as dependency injection?) function factory_of_data_set(){ static $db_connection; $data_set = null; $db_connection = get_database_connection(); $data_set = $db_connection->query('blah'); return $data_set; } $data = factory_of_data_set(); Anyone have a good resource or just insight that makes the method and benefit -crystal- clear?

    Read the article

  • Are Parameters really enough to prevent Sql injections?

    - by Rune Grimstad
    I've been preaching both to my colleagues and here on SO about the goodness of using parameters in SQL queries, especially in .NET applications. I've even gone so far as to promise them as giving immunity against SQL injection attacks. But I'm starting to wonder if this really is true. Are there any known SQL injection attacks that will be successfull against a parameterized query? Can you for example send a string that causes a buffer overflow on the server? There are of course other considerations to make to ensure that a web application is safe (like sanitizing user input and all that stuff) but now I am thinking of SQL injections. I'm especially interested in attacks against MsSQL 2005 and 2008 since they are my primary databases, but all databases are interesting. Edit: To clarify what I mean by parameters and parameterized queries. By using parameters I mean using "variables" instead of building the sql query in a string. So instead of doing this: SELECT * FROM Table WHERE Name = 'a name' We do this: SELECT * FROM Table WHERE Name = @Name and then set the value of the @Name parameter on the query / command object.

    Read the article

  • Dependency injection and factory

    - by legenden
    Trying to figure out how to best handle the following scenario: Assume a RequestContext class which has a dependency to an external service, such as: public class RequestContext : IRequestContext { private readonly ServiceFactory<IWeatherService> _weatherService; public RequestContext(ServiceFactory<IWeatherService> weatherService, UserLocation location, string query) { _weatherService = weatherService; ... What sort of dependency should I require in the class that will ultimately instantiate RequestContext? It could be ServiceFactory<IWeatherService>, but that doesn't seem right, or I could create an IRequestContextFactory for it along the lines of: public class RequestContextFactory : IRequestContextFactory { private readonly ServiceFactory<IWeatherService> _weatherService; public RequestContextFactory(ServiceFactory<IWeatherService> weatherService) { _weatherService = weatherService; } public RequestContext Create(UserLocation location, string query) { return new RequestContext(_weatherService, location, query); } } And then pass the IRequestContextFactory through constructor injection. This seems like a good way to do it, but the problem with this approach is that I think it hinders discoverability (devs must know about the factory and implement it, which is not really apparent). Is there a better/more discoverable way that I'm missing?

    Read the article

  • My pivot chart has the wrong Y axis values but correct data point values

    - by Mark Harnett
    I created a pivot chart based on some raw data for the x axis (dates) and 4 calculated fields for the Y values. The values on resulting lines are correct (see the data label at the end of the line) but the Y axis is off by about 100, but not off by any consistent amount. I have played with auto axis on and off, turn log scale on and off. All to no avail. Does anybody have any thoughts? Image link

    Read the article

  • sending email with codeigniter

    - by Maru
    I have this MODEL and I get the email which I want to send class Cliente_Model extends CI_Model{ public function getInfo($id){ $this->db->select('*'); $this->db->from('pendientes'); $query = $this->db->get(); if($query->num_rows() > 0) { foreach ($query->result_array() as $row) { return $row['email']; } } else { return FALSE; } } } CONTROLLER $this->load->model('cliente_model', 'client'); $clientInfo = $this->client->getInfo($id); $this->email->from('[email protected]', 'Demo'); $this->email->to($clientInfo); $this->email->subject('Email Test'); $this->email->message('your user is '.$clientInfo.' and your password is '.$clave); $this->email->send(); and I need some help here, I can get the email and it can send it perfectly but in the message I need to send the password also and I don't know how I can get it from the model. thanks in advance!

    Read the article

  • Need some help to determine the amount of recursive calls in PHP

    - by Ben Fransen
    Hi all, I've got a, I think fairly easy question, but this is bugging me for a while now. So I figured, maybe I can get some help here. Since recursive functions are always a bit tricky, and sometimes a bit unclear to me, I keep struggling to create a nice working solution to get my menudata. In one of my classes I have this function, which gives me all menu-items recursivly. The thing I want is to determine at which recursionlevel a certain object was retrieved so I can create a nicely looking HTML output with indents for the levels of nesting. public function GetObjectList($parentID = 0, $objectlist = null) { if(is_null($objectlist)) { $objectlist = new ObjectList("Model_Navigation"); } $query = MySQL::Query("SELECT * FROM `Navigation` WHERE `WebsiteID` = ".SITE_ID. " AND `LanguageID` = ".LANG_ID." AND `ParentID` = ".$parentID); while($result = MySQL::FetchAssoc($query)) { $object = new Model_Navigation(); $object->ID = $result["ID"]; $object->WebsiteID = $result["WebsiteID"]; $object->LanguageID = $result["LanguageID"]; $object->ParentID = $result["ParentID"]; $object->Name = $result["Name"]; $object->Page = Model_Page::GetObjectByID($result["PageID"]); $object->ExternalURL = $result["ExternalURL"]; $object->Index = $result["Index"]; $object->Level = [here lies my problem]; $objectlist->Add($object); self::GetObjectList($object->ID, $objectlist); } return $objectlist; } Hope to hear from you! Greetings from Holland, Ben Fransen

    Read the article

  • C++ boost.asio server and client connection undersanding

    - by Edgar Buchvalov
    i started learning boost.asio and i have some problems with undersanding tcp connections. There is example from official boost site: #include <ctime> #include <iostream> #include <string> #include <boost/asio.hpp> using boost::asio::ip::tcp; std::string make_daytime_string() { using namespace std; // For time_t, time and ctime; time_t now = time(0); return ctime(&now); } int main() { try { boost::asio::io_service io_service; tcp::acceptor acceptor(io_service, tcp::endpoint(tcp::v4(), 13)); for (;;) { tcp::socket socket(io_service); acceptor.accept(socket); std::string message = make_daytime_string(); boost::system::error_code ignored_error; boost::asio::write(socket, boost::asio::buffer(message), boost::asio::transfer_all(), ignored_error); } } catch (std::exception& e) { std::cerr << e.what() << std::endl; } return 0; } there is question, why if i want to connet to this server via client i have t write: boost::asio::io_service io_service; tcp::resolver resolver(io_service); tcp::resolver::query query(host_ip, "daytime"); //why daytime? tcp::resolver::iterator endpoint_iterator = resolver.resolve(query); tcp::resolver::iterator end; why daytime?, what it meant and where it is inicialized in server, or i just doesn't missed somefing? there is full client code : www.boost.org/doc/libs/1_39_0/doc/html/boost_asio/tutorial/tutdaytime1.html thanks for explanation in advance

    Read the article

  • Problems connecting Clariion LUNS to Solaris 10

    - by vialde
    I've got a Clariion San and a Solaris 10 server with an emulex HBA. The Thin LUNS are visible in Solaris and I can happily format the raw devices. Unfortunately that's all I can do. All other operations result in I/O errors. I'm running current versions of PowerPath and Solaris is patched as high as it'll go. Anyone have any similar experiences?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to perform Linq select new with datetime in SQL 2008

    - by kd7iwp
    In our C# code I recently changed a line from inside a linq-to-sql select new query as follows: OrderDate = (p.OrderDate.HasValue ? p.OrderDate.Value.Year.ToString() + "-" + p.OrderDate.Value.Month.ToString() + "-" + p.OrderDate.Value.Day.ToString() : "") To: OrderDate = (p.OrderDate.HasValue ? p.OrderDate.Value.ToString("yyyy-mm-dd") : "") The change makes the line smaller and cleaner. It also works fine with our SQL 2008 database in our development environment. However, when the code deployed to our production environment which uses SQL 2005 I received an exception stating: Nullable Type must have a value. For further analysis I copied (p.OrderDate.HasValue ? p.OrderDate.Value.ToString("yyyy-mm-dd") : "") into a string (outside of a Linq statement) and had no problems at all, so it only causes an in issue inside my Linq. Is this problem just something to do with SQL 2005 using different date formats than from SQL 2008? Here's more of the Linq: dt = FilteredOrders.Where(x => x != null).Select(p => new { Order = p.OrderId, link = "/order/" + p.OrderId.ToString(), StudentId = (p.PersonId.HasValue ? p.PersonId.Value : 0), FirstName = p.IdentifierAccount.Person.FirstName, LastName = p.IdentifierAccount.Person.LastName, DeliverBy = p.DeliverBy, OrderDate = p.OrderDate.HasValue ? p.OrderDate.Value.Date.ToString("yyyy-mm-dd") : ""}).ToDataTable(); This is selecting from a List of Order objects. The FilteredOrders list is from another linq-to-sql query and I call .AsEnumerable on it before giving it to this particular select new query. Doing this in regular code works fine: if (o.OrderDate.HasValue) tempString += " " + o.OrderDate.Value.Date.ToString("yyyy-mm-dd");

    Read the article

  • exim4, avoid emails end up in spam folder

    - by MultiformeIngegno
    I have a VPS: I set up exim, problem is emails always go in the spam folder.. this is a sample header: http://pastebin.com/raw.php?i=4NJ2ZaUs As you can see it PASSes SPF test but still emails don't pass spam filters (I tried with Gmail).. Here's my exim config: dc_eximconfig_configtype='internet' dc_other_hostnames='MY_DOMAIN' dc_local_interfaces='' dc_readhost='MY_DOMAIN' dc_relay_domains='MY_DOMAIN' dc_minimaldns='false' dc_relay_nets='' dc_smarthost='MY_DOMAIN' CFILEMODE='644' dc_use_split_config='false' dc_hide_mailname='' dc_mailname_in_oh='true' dc_localdelivery='mail_spool' Why does this happen?

    Read the article

  • transactions and delete using fluent nhibernate

    - by Will I Am
    I am starting to play with (Fluent) nHibernate and I am wondering if someone can help with the following. I'm sure it's a total noob question. I want to do: delete from TABX where name = 'abc' where table TABX is defined as: ID int name varchar(32) ... I build the code based on internet samples: using (ITransaction transaction = session.BeginTransaction()) { IQuery query = session.CreateQuery("FROM TABX WHERE name = :uid") .SetString("uid", "abc"); session.Delete(query.List<Person>()[0]); transaction.Commit(); } but alas, it's generating two queries (one select and one delete). I want to do this in a single statement, as in my original SQL. What is the correct way of doing this? Also, I noticed that in most samples on the internet, people tend to always wrap all queries in transactions. Why is that? If I'm only running a single statement, that seems an overkill. Do people tend to just mindlessly cut and paste, or is there a reason beyond that? For example, in my query above, if I do manage it to get it from two queries down to one, i should be able to remove the begin/commit transaction, no? if it matters, I'm using PostgreSQL for experimenting.

    Read the article

  • NHibernate stored procedure problem

    - by Calvin
    I'm having a hard time trying to get my stored procedure works with NHibernate. The data returned from the SP does not correspond to any database table. This is my mapping file: <?xml version="1.0" encoding="utf-8" ?> <hibernate-mapping xmlns="urn:nhibernate-mapping-2.2" assembly="DomainModel" namespace="DomainModel.Entities"> <sql-query name="DoSomething"> <return class="SomeClass"> <return-property name="ID" column="ID"/> </return> exec [dbo].[sp_doSomething] </sql-query> </hibernate-mapping> Here is my domain class: namespace DomainModel.Entities { public class SomeClass { public SomeClass() { } public virtual Guid ID { get; set; } } } When I run the code, it fails with Exception Details: NHibernate.HibernateException: Errors in named queries: {DoSomething} at line 80 Line 78: config.Configure(Path.Combine(AppDomain.CurrentDomain.BaseDirectory, "NHibernate.config")); Line 79: Line 80: g_sessionFactory = config.BuildSessionFactory(); When I debug into NHibernate code, it seems that SomeClass is not added to the persister dictionary because there isn't a class mapping (only sql-query) defined in hbm.xml. And later on in CheckNamedQueries function, it is not able to find the persistor for SomeClass. I've checked all the obvious things (e.g. make hbm as an embedded resource) and my code isn't too much different from other samples I found on the web, but somehow I just can't get it working. Any idea how I can resolve this issue?

    Read the article

  • SQL Server search filter and order by performance issues

    - by John Leidegren
    We have a table value function that returns a list of people you may access, and we have a relation between a search and a person called search result. What we want to do is that wan't to select all people from the search and present them. The query looks like this SELECT qm.PersonID, p.FullName FROM QueryMembership qm INNER JOIN dbo.GetPersonAccess(1) ON GetPersonAccess.PersonID = qm.PersonID INNER JOIN Person p ON p.PersonID = qm.PersonID WHERE qm.QueryID = 1234 There are only 25 rows with QueryID=1234 but there are almost 5 million rows total in the QueryMembership table. The person table has about 40K people in it. QueryID is not a PK, but it is an index. The query plan tells me 97% of the total cost is spent doing "Key Lookup" witht the seek predicate. QueryMembershipID = Scalar Operator (QueryMembership.QueryMembershipID as QM.QueryMembershipID) Why is the PK in there when it's not used in the query at all? and why is it taking so long time? The number of people total 25, with the index, this should be a table scan for all the QueryMembership rows that have QueryID=1234 and then a JOIN on the 25 people that exists in the table value function. Which btw only have to be evaluated once and completes in less than 1 second.

    Read the article

  • ZIP Numerous Blob Files

    - by Michael
    I have a database table that contains numerous PDF blob files. I am attempting to combine all of the files into a single ZIP file that I can download and then print. Please help! <?php include 'config.php'; include 'connect.php'; $session= $_GET[session]; $query = " SELECT $tbl_uploads.username, $tbl_uploads.description, $tbl_uploads.type, $tbl_uploads.size, $tbl_uploads.content, $tbl_members.session FROM $tbl_uploads LEFT JOIN $tbl_members ON $tbl_uploads.username = $tbl_members.username WHERE $tbl_members.session= '$session'"; $result = mysql_query($query) or die('Error, query failed'); while(list($username, $description, $type, $size, $content) = mysql_fetch_array($result)) { header("Content-length: $size"); header("Content-type: $type"); header("Content-Disposition: inline; filename=$username-$description.pdf"); echo $content; } $files = array('File 1 from database', 'File 2 from database'); $zip = new ZipArchive; $zip->open('file.zip', ZipArchive::CREATE); foreach ($files as $file) { $zip->addFile($file); } $zip->close(); header('Content-Type: application/zip'); header('Content-disposition: attachment; filename=filename.zip'); header('Content-Length: ' . filesize($zipfilename)); readfile($zipname); mysql_close($link); exit; ?>

    Read the article

  • HATEOAS - Discovery and URI Templating

    - by Paul Kirby
    I'm designing a HATEOAS API for internal data at my company, but have been having troubles with the discovery of links. Consider the following set of steps for someone to retrieve information about a specific employee in this system: User sends GET to http://coredata/ to get all available resources, returns a number of links including one tagged as rel = "http://coredata/rels/employees" User follows HREF on the rel from the first request, performing a GET at (for example) http://coredata/employees The data returned from this last call is my conundrum and a situation where I've heard mixed suggestions. Here are some of them: That GET will return all employees (with perhaps truncated data), and the client would be responsible for picking the one it wants from that list. That GET would return a number of URI templated links describing how to query / get one employee / get all employees. Something like: "_links": { "http://coredata/rels/employees#RetrieveOne": { "href": "http://coredata/employees/{id}" }, "http://coredata/rels/employees#Query": { "href": "http://coredata/employees{?login,firstName,lastName}" }, "http://coredata/rels/employees#All": { "href": "http://coredata/employees/all" } } I'm a little stuck here with what remains closest to HATEOAS. For option 1, I really do not want to make my clients retrieve all employees every time for the sake of navigation, but I can see how using URI templating in example two introduces some out-of-band knowledge. My other thought was to use the RetrieveOne, Query, and All operations as my cool URLs, but that seems to violate the concept that you should be able to navigate to the resources you want from one base URI. Has anyone else managed to come up with a good way to handle this? Navigation is dead simple once you've retrieved one resource or a set of resources, but it seems very difficult to use for discovery.

    Read the article

  • how to disable these logs on the screen?

    - by user62367
    using Fedora 14: http://pastebin.com/raw.php?i=jUvcfugw i mount an anonym Samba share [checks it in every 5 sec] it's working, ok, great! But: when i shut down my Fedora box, i can see the lines containing this scripts lines! Many times, about ~50x on the screen. How could i disable these lines when shutting down? I [and other people] don't want to see those lines for about ~ 5 sec Thank you!

    Read the article

  • security deleting a mysql row with jQuery $.post

    - by FFish
    I want to delete a row in my database and found an example on how to do this with jQuery's $.post() Now I am wondering about security though.. Can someone send a POST request to my delete-row.php script from another website? JS function deleterow(id) { // alert(typeof(id)); // number if (confirm('Are you sure want to delete?')) { $.post('delete-row.php', {album_id:+id, ajax:'true'}, function() { $("#row_"+id).fadeOut("slow"); }); } } PHP: delete-row.php <?php require_once("../db.php"); mysql_connect(DB_SERVER, DB_USER, DB_PASSWORD) or die("could not connect to database " . mysql_error()); mysql_select_db(DB_NAME) or die("could not select database " . mysql_error()); if (isset($_POST['album_id'])) { $query = "DELETE FROM albums WHERE album_id = " . $_POST['album_id']; $result = mysql_query($query); if (!$result) die('Invalid query: ' . mysql_error()); echo "album deleted!"; } ?>

    Read the article

  • Optimal two variable linear regression SQL statement (censoring outliers)

    - by Dave Jarvis
    Problem Am looking to apply the y = mx + b equation (where m is SLOPE, b is INTERCEPT) to a data set, which is retrieved as shown in the SQL code. The values from the (MySQL) query are: SLOPE = 0.0276653965651912 INTERCEPT = -57.2338357550468 SQL Code SELECT ((sum(t.YEAR) * sum(t.AMOUNT)) - (count(1) * sum(t.YEAR * t.AMOUNT))) / (power(sum(t.YEAR), 2) - count(1) * sum(power(t.YEAR, 2))) as SLOPE, ((sum( t.YEAR ) * sum( t.YEAR * t.AMOUNT )) - (sum( t.AMOUNT ) * sum(power(t.YEAR, 2)))) / (power(sum(t.YEAR), 2) - count(1) * sum(power(t.YEAR, 2))) as INTERCEPT FROM (SELECT D.AMOUNT, Y.YEAR FROM CITY C, STATION S, YEAR_REF Y, MONTH_REF M, DAILY D WHERE -- For a specific city ... -- C.ID = 8590 AND -- Find all the stations within a 15 unit radius ... -- SQRT( POW( C.LATITUDE - S.LATITUDE, 2 ) + POW( C.LONGITUDE - S.LONGITUDE, 2 ) ) <15 AND -- Gather all known years for that station ... -- S.STATION_DISTRICT_ID = Y.STATION_DISTRICT_ID AND -- The data before 1900 is shaky; insufficient after 2009. -- Y.YEAR BETWEEN 1900 AND 2009 AND -- Filtered by all known months ... -- M.YEAR_REF_ID = Y.ID AND -- Whittled down by category ... -- M.CATEGORY_ID = '001' AND -- Into the valid daily climate data. -- M.ID = D.MONTH_REF_ID AND D.DAILY_FLAG_ID <> 'M' GROUP BY Y.YEAR ORDER BY Y.YEAR ) t Data The data is visualized here (with five outliers highlighted): Questions How do I return the y value against all rows without repeating the same query to collect and collate the data? That is, how do I "reuse" the list of t values? How would you change the query to eliminate outliers (at an 85% confidence interval)? The following results (to calculate the start and end points of the line) appear incorrect. Why are the results off by ~10 degrees (e.g., outliers skewing the data)? (1900 * 0.0276653965651912) + (-57.2338357550468) = -4.66958228 (2009 * 0.0276653965651912) + (-57.2338357550468) = -1.65405406 I would have expected the 1900 result to be around 10 (not -4.67) and the 2009 result to be around 11.50 (not -1.65). Thank you!

    Read the article

  • mysql subselect alternative

    - by Arnold
    Hi, Lets say I am analyzing how high school sports records affect school attendance. So I have a table in which each row corresponds to a high school basketball game. Each game has an away team id and a home team id (FK to another "team table") and a home score and an away score and a date. I am writing a query that matches attendance with this seasons basketball games. My sample output will be (#_students_missed_class, day_of_game, home_team, away_team, home_team_wins_this_season, away_team_wins_this_season) I now want to add how each team did the previous season to my analysis. Well, I have their previous season stored in the game table but i should be able to accomplish that with a subselect. So in my main select statement I add the subselect: SELECT COUNT(*) FROM game_table WHERE game_table.date BETWEEN 'start of previous season' AND 'end of previous season' AND ( (game_table.home_team = team_table.id AND game_table.home_score > game_table.away_score) OR (game_table.away_team = team_table.id AND game_table.away_score > game_table.home_score)) In this case team-table.id refers to the id of the home_team so I now have all their wins calculated from the previous year. This method of calculation is neither time nor resource intensive. The Explain SQL shows that I have ALL in the Type field and I am not using a Key and the query times out. I'm not sure how I can accomplish a more efficient query with a subselect. It seems proposterously inefficient to have to write 4 of these queries (for home wins, home losses, away wins, away losses). I am sure this could be more lucid. I'll absolutely add color tomorrow if anyone has questions

    Read the article

  • Why i cant save a long text on my MySQL database?

    - by DomingoSL
    im trying to save to my data base a long text (about 2500 chars) input by my users using a web form and passed to the server using php. When i look in phpmyadmin, the text gets crop. How can i config my table in order to get the complete text? This is my table config: CREATE TABLE `extra_879` ( `id` bigint(20) NOT NULL auto_increment, `id_user` bigint(20) NOT NULL, `title` varchar(300) NOT NULL, `content` varchar(3000) NOT NULL, PRIMARY KEY (`id`), UNIQUE KEY `id_user` (`id_user`) ) ENGINE=MyISAM DEFAULT CHARSET=latin1 AUTO_INCREMENT=4 ; Take a look of the field content that have a limit of 3000 chars, but the texts always gets crop at 690 chars. Thanks for any help! EDIT: I found the problem but i dont know how to solve it. The query is getting crop always in the same char, an special char: ù EDIT 2: This is the cropped query: INSERT INTO extra_879 (id,id_user,title,content) VALUES (NULL,'1','Informazione Extra',' Riconoscimenti Laurea di ingegneria presa a le 22 anni e in il terso posto della promozione Diploma analista di sistemi ottenuto il rating massimo 20/20, primo posto della promozione. Borsa di Studio (offerta dal Ministero Esteri Italiano) vinta nel 2010 (Valutazione del territorio attraverso le nueve tecnologie) Pubblicazione di paper; Stima del RCS della nave CCGS radar sulla base dei risultati di H. Leong e H. Wilson. http://www.ing.uc.edu.vek-azozayalarchivospdf/PAPER-Sarmiento.pdf Tesi di laurea: PROGETTAZIONE E REALIZZAZIONE DI UN SIS-TEMA DI TELEMETRIA GSM PER IL CONTROLLO DELLO STATO DI TRANSITO VEICOLARE E CLIMA (ottenuto il punteggio pi') It gets crop just when the (ottenuto il punteggio più alto) phrase, just when ù appear... EDIT 3: I using jquery + ajax to send the query $.ajax({type: "POST", url: "handler.php", data: "e_text="+ $('#e_text').val() + "&e_title="+ $('#extra_title').val(),

    Read the article

  • dig works but dig +trace <domain_name> not working

    - by anoopmathew
    In my local system i can't get the proper result of dig +trace , but dig works fine. I'm using Ubuntu 10.04 LTS version. I'll attach the result of dig and dig +trace along with this updates. dig +trace gmail.com ; << DiG 9.7.0-P1 << +trace gmail.com ;; global options: +cmd ;; Received 12 bytes from 4.2.2.4#53(4.2.2.4) in 291 ms dig gmail.com ; << DiG 9.7.0-P1 << gmail.com ;; global options: +cmd ;; Got answer: ;; -HEADER<<- opcode: QUERY, status: NOERROR, id: 59528 ;; flags: qr rd ra; QUERY: 1, ANSWER: 2, AUTHORITY: 0, ADDITIONAL: 0 ;; QUESTION SECTION: ;gmail.com. IN A ;; ANSWER SECTION: gmail.com. 49 IN A 74.125.236.118 gmail.com. 49 IN A 74.125.236.117 ;; Query time: 302 msec ;; SERVER: 4.2.2.4#53(4.2.2.4) ;; WHEN: Sat Oct 13 14:57:56 2012 ;; MSG SIZE rcvd: 59 Please anyone update a solution for this issue. I'm just worried about my issue.

    Read the article

  • linq - how to sort a list

    - by Billy Logan
    Hello everyone, I have a linq query that populates a list of designers. since i am using the filters below my sorting is not functioning properly. My question is with the given code below how can i best sort this List after the fact or sort while querying? I have tried to sort the list after the fact using the following script but i receive a compiler error: List<TBLDESIGNER> designers = new List<TBLDESIGNER>(); designers = 'calls my procedure below and comes back with an unsorted list of designers' designers.Sort((x, y) => string.Compare(x.FIRST_NAME, y.LAST_NAME)); Query goes as follows: List<TBLDESIGNER> designer = null; using (SOAE strikeOffContext = new SOAE()) { //Invoke the query designer = AdminDelegates.selectDesignerDesigns.Invoke(strikeOffContext).ByActive(active).ByAdmin(admin).ToList(); } Delegate: public static Func<SOAE, IQueryable<TBLDESIGNER>> selectDesignerDesigns = CompiledQuery.Compile<SOAE, IQueryable<TBLDESIGNER>>( (designer) => from c in designer.TBLDESIGNER.Include("TBLDESIGN") orderby c.FIRST_NAME ascending select c); Filter ByActive: public static IQueryable<TBLDESIGNER> ByActive(this IQueryable<TBLDESIGNER> qry, bool active) { //Return the filtered IQueryable object return from c in qry where c.ACTIVE == active select c; } Filter ByAdmin: public static IQueryable<TBLDESIGNER> ByAdmin(this IQueryable<TBLDESIGNER> qry, bool admin) { //Return the filtered IQueryable object return from c in qry where c.SITE_ADMIN == admin select c; } Thanks in advance, Billy

    Read the article

< Previous Page | 455 456 457 458 459 460 461 462 463 464 465 466  | Next Page >