Search Results

Search found 11543 results on 462 pages for 'partition wise join'.

Page 459/462 | < Previous Page | 455 456 457 458 459 460 461 462  | Next Page >

  • Trying to run WCF web service on non-domain VM, Security Errors

    - by NealWalters
    Am I in a Catch-22 situation here? My goal is to take a WCF service that I inherited, and run it on a VM and test it by calling it from my desktop PC. The VM is in a workgroup, and not in the company's domain. Basically, we need more test environments, ideally one per developer (we may have 2 to 4 people that need this). Thus the idea of the VM was that each developer could have his own web server that somewhat matches or real environment (where we actually have two websites, an external/exposed and internal). [Using VS2010 .NET 4.0] In the internal service, each method was decorated with this attribute: [OperationBehavior(Impersonation = ImpersonationOption.Required)] I'm still researching why this was needed. I think it's because a webapp calls the "internal" service, and either a) we need the credentials of the user, or b) we may doing some PrinciplePermission.Demands to see if the user is in a group. My interest is creating some ConsoleTest programs or UnitTest programs. I changed to allowed like this: [OperationBehavior(Impersonation = ImpersonationOption.Allowed)] because I was getting this error in trying to view the .svc in the browser: The contract operation 'EditAccountFamily' requires Windows identity for automatic impersonation. A Windows identity that represents the caller is not provided by binding ('WSHttpBinding','http://tempuri.org/') for contract ('IAdminService','http://tempuri.org/'. I don't get that error with the original bindings look like this: However, I believe I need to turn off this security since the web service is not on the domain. I tend to get these errors in the client: 1) The request for security token could not be satisfied because authentication failed - as an InnerException of "SecurityNegotiation was unhandled". or 2) The caller was not authenticated by the service as an InnerException of "SecurityNegotiation was unhandled". So can I create some configuration of code and web.config that will allow each developer to work on his own VM? Or must I join the VM to the domain? The number of permutations seems near endless. I've started to create a Word.doc that says what to do with each error, but now I'm in the catch-22 where I'm stuck. Thanks, Neal Server Bindings: <bindings> <wsHttpBinding> <binding name="wsHttpEndpointBinding" maxBufferPoolSize="2147483647" maxReceivedMessageSize="500000000"> <readerQuotas maxDepth="2147483647" maxStringContentLength="2147483647" maxArrayLength="2147483647" maxBytesPerRead="2147483647" maxNameTableCharCount="2147483647" /> <!-- <security mode="None" /> This is one thing I tried --> <security> <message clientCredentialType="Windows" /> </security> </binding> </wsHttpBinding> </bindings> <behaviors> <serviceBehaviors> <behavior name="ABC.AdminService.AdminServiceBehavior"> <!-- To avoid disclosing metadata information, set the value below to false and remove the metadata endpoint above before deployment --> <serviceMetadata httpGetEnabled="true" /> <!-- To receive exception details in faults for debugging purposes, set the value below to true. Set to false before deployment to avoid disclosing exception information --> <serviceDebug includeExceptionDetailInFaults="true" /> <serviceCredentials> </serviceCredentials> <!--<serviceAuthorization principalPermissionMode="UseAspNetRoles" roleProviderName="AspNetWindowsTokenRoleProvider"/>--> <serviceAuthorization principalPermissionMode="UseWindowsGroups" impersonateCallerForAllOperations="true" /> </behavior> <behavior name="ABC.AdminService.IAdminServiceTransportBehavior"> <!-- To avoid disclosing metadata information, set the value below to false and remove the metadata endpoint above before deployment --> <serviceMetadata httpGetEnabled="true" /> <!-- To receive exception details in faults for debugging purposes, set the value below to true. Set to false before deployment to avoid disclosing exception information --> <serviceDebug includeExceptionDetailInFaults="false" /> <serviceCredentials> <clientCertificate> <authentication certificateValidationMode="PeerTrust" /> </clientCertificate> <serviceCertificate findValue="WCfServer" storeLocation="LocalMachine" storeName="My" x509FindType="FindBySubjectName" /> </serviceCredentials> </behavior> </serviceBehaviors> </behaviors> <serviceHostingEnvironment multipleSiteBindingsEnabled="true" /> CLIENT: <system.serviceModel> <bindings> <wsHttpBinding> <binding name="WSHttpBinding_IAdminService" closeTimeout="00:01:00" openTimeout="00:01:00" receiveTimeout="00:10:00" sendTimeout="00:01:00" bypassProxyOnLocal="false" transactionFlow="false" hostNameComparisonMode="StrongWildcard" maxBufferPoolSize="524288" maxReceivedMessageSize="65536" messageEncoding="Text" textEncoding="utf-8" useDefaultWebProxy="true" allowCookies="false"> <readerQuotas maxDepth="32" maxStringContentLength="8192" maxArrayLength="16384" maxBytesPerRead="4096" maxNameTableCharCount="16384" /> <reliableSession ordered="true" inactivityTimeout="00:10:00" enabled="false" /> <security mode="Message"> <transport clientCredentialType="Windows" proxyCredentialType="None" realm="" /> <message clientCredentialType="Windows" negotiateServiceCredential="true" algorithmSuite="Default" /> </security> </binding> </wsHttpBinding> </bindings> <client> <endpoint address="http://192.168.159.132/EC_AdminService/AdminService.svc" binding="wsHttpBinding" bindingConfiguration="WSHttpBinding_IAdminService" contract="svcRef.IAdminService" name="WSHttpBinding_IAdminService"> <identity> <dns value="localhost" /> </identity> </endpoint> </client> </system.serviceModel>

    Read the article

  • Custom styled select box

    - by Ivan
    Hi to all am trying to use javascript for custom styled select boxes from www.gerrendesign.com/entry_images/selectboxdemo.zip and as I have plenty entries inside one of select box I need to make but am stuck in creation of scrolling function. As this select boxes are compatible with almost all older and new browsers. I need only suggestion or solution how to add scroll in this linked/attached files above - if select box is populated with plenty of entries (example cities, states, or exchange rates...) Am stuck here... Thanks for your cooperation Ivan THIS IS CODE: $(document).ready(function(){ // first locate all of the select tags on the page and hide them $("select.changeMe").css('display','none'); //now, for each select box, run this function $("select.changeMe").each(function(){ var curSel = $(this); // get the CSS width from the original select box var gddWidth = $(curSel).css('width'); var gddWidthL = gddWidth.slice(0,-2); var gddWidth2 = gddWidthL - 28; var gddWidth3 = gddWidthL - 16; // build the new div structure var gddTop = '<div style="width:' + gddWidthL + 'px" class="selectME" tabindex="0"><div class="cornerstop"><div><div></div></div></div><div class="middle"><div><div><div>'; //get the default selected option var whatSelected = $(curSel).children('option:selected').text(); //write the default var gddFirst = '<div class="first"><span class="selectME gselected" style="width:'+ gddWidth2 + 'px;">'+ whatSelected +'</span><span id="arrowImg"></span><div class="clears"></div></div><ul class="selectME">'; // create a new array of div options from the original's options var addItems = new Array(); $(curSel).children('option').each( function() { var text = $(this).text(); var selVal = $(this).attr('value'); var before = '<li style="width:' + gddWidthL + 'px;"><a href="#" rel="' + selVal + '" tabindex="0" style="width:' + gddWidth3 + 'px;">'; var after = '</a></li>'; addItems.push(before + text + after); }); //hide the default from the list of options var removeFirst = addItems.shift(); // create the end of the div selectbox and close everything off var gddBottom ='</ul></div></div></div></div><div class="cornersbottom"><div><div></div></div></div></div>' //write everything after each selectbox var GDD = gddTop + gddFirst + addItems.join('') + gddBottom; $(curSel).after(GDD); //this var selects the div select box directly after each of the origials var nGDD = $(curSel).next('div.selectME'); $(nGDD).find('li:first').addClass("first"); $(nGDD).find('li:last').addClass('last'); //handle the on click functions - push results back to old text box $(nGDD).click( function(e) { var myTarA = $(e.target).attr('rel'); var myTarT = $(e.target).text(); var myTar = $(e.target); //if closed, then open if( $(nGDD).find('li').css('display') == 'none') { //this next line closes any other selectboxes that might be open $('div.selectME').find('li').css('display','none'); $(nGDD).find('li').css('display','block'); //if user clicks off of the div select box, then shut the whole thing down $(document.window || 'body').click( function(f) { var myTar2 = $(f.target); if (myTar2 !== nGDD) {$(nGDD).find('li').css('display','none');} }); return false; } else { if (myTarA == null){ $(nGDD).find('li').css('display','none'); return false; } else { //set the value of the old select box $(curSel).val(myTarA); //set the text of the new one $(nGDD).find('span.gselected').text(myTarT); $(nGDD).find('li').css('display','none'); return false; } } //handle the tab index functions }).focus( function(e) { $(nGDD).find('li:first').addClass('currentDD'); $(nGDD).find('li:last').addClass('lastDD'); function checkKey(e){ //on keypress handle functions function moveDown() { var current = $(nGDD).find('.currentDD:first'); var next = $(nGDD).find('.currentDD').next(); if ($(current).is('.lastDD')){ return false; } else { $(next).addClass('currentDD'); $(current).removeClass('currentDD'); } } function moveUp() { var current = $(nGDD).find('.currentDD:first'); var prev = $(nGDD).find('.currentDD').prev(); if ($(current).is('.first')){ return false; } else { $(prev).addClass('currentDD'); $(current).removeClass('currentDD'); } } var curText = $(nGDD).find('.currentDD:first').text(); var curVal = $(nGDD).find('.currentDD:first a').attr('rel'); switch (e.keyCode) { case 40: $(curSel).val(curVal); $(nGDD).find('span.gselected').text(curText); moveDown(); return false; break; case 38: $(curSel).val(curVal); $(nGDD).find('span.gselected').text(curText); moveUp(); return false; break; case 13: $(nGDD).find('li').css('display','none'); } } $(document).keydown(checkKey); }).blur( function() { $(document).unbind('keydown'); }); }); });

    Read the article

  • C# WPF application is using too much memory while GC.GetTotalMemory() is low

    - by Dmitry
    I wrote little WPF application with 2 threads - main thread is GUI thread and another thread is worker. App has one WPF form with some controls. There is a button, allowing to select directory. After selecting directory, application scans for .jpg files in that directory and checks if their thumbnails are in hashtable. if they are, it does nothing. else it's adding their full filenames to queue for worker. Worker is taking filenames from this queue, loading JPEG images (using WPF's JpegBitmapDecoder and BitmapFrame), making thumbnails of them (using WPF's TransformedBitmap) and adding them to hashtable. Everything works fine, except memory consumption by this application when making thumbnails for big images (like 5000x5000 pixels). I've added textboxes on my form to show memory consumption (GC.GetTotalMemory() and Process.GetCurrentProcess().PrivateMemorySize64) and was very surprised, cuz GC.GetTotalMemory() stays close to 1-2 Mbytes, while private memory size constantly grows, especially when loading new image (~ +100Mb per image). Even after loading all images, making thumbnails of them and freeing original images, private memory size stays at ~700-800Mbytes. My VirtualBox is limited to 512Mb of physical memory and Windows in VirtualBox starts to swap alot to handle this huge memory consumption. I guess I'm doing something wrong, but I don't know how to investigate this problem, cuz according to GC, allocated memory size is very low. Attaching code of thumbnail loader class: class ThumbnailLoader { Hashtable thumbnails; Queue<string> taskqueue; EventWaitHandle wh; Thread[] workers; bool stop; object locker; int width, height, processed, added; public ThumbnailLoader() { int workercount,i; wh = new AutoResetEvent(false); thumbnails = new Hashtable(); taskqueue = new Queue<string>(); stop = false; locker = new object(); width = height = 64; processed = added = 0; workercount = Environment.ProcessorCount; workers=new Thread[workercount]; for (i = 0; i < workercount; i++) { workers[i] = new Thread(Worker); workers[i].IsBackground = true; workers[i].Priority = ThreadPriority.Highest; workers[i].Start(); } } public void SetThumbnailSize(int twidth, int theight) { width = twidth; height = theight; if (thumbnails.Count!=0) AddTask("#resethash"); } public void GetProgress(out int Added, out int Processed) { Added = added; Processed = processed; } private void AddTask(string filename) { lock(locker) { taskqueue.Enqueue(filename); wh.Set(); added++; } } private string NextTask() { lock(locker) { if (taskqueue.Count == 0) return null; else { processed++; return taskqueue.Dequeue(); } } } public static string FileNameToHash(string s) { return FormsAuthentication.HashPasswordForStoringInConfigFile(s, "MD5"); } public bool GetThumbnail(string filename,out BitmapFrame thumbnail) { string hash; hash = FileNameToHash(filename); if (thumbnails.ContainsKey(hash)) { thumbnail=(BitmapFrame)thumbnails[hash]; return true; } AddTask(filename); thumbnail = null; return false; } private BitmapFrame LoadThumbnail(string filename) { FileStream fs; JpegBitmapDecoder bd; BitmapFrame oldbf, bf; TransformedBitmap tb; double scale, dx, dy; fs = new FileStream(filename, FileMode.Open); bd = new JpegBitmapDecoder(fs, BitmapCreateOptions.None, BitmapCacheOption.OnLoad); oldbf = bd.Frames[0]; dx = (double)oldbf.Width / width; dy = (double)oldbf.Height / height; if (dx > dy) scale = 1 / dx; else scale = 1 / dy; tb = new TransformedBitmap(oldbf, new ScaleTransform(scale, scale)); bf = BitmapFrame.Create(tb); fs.Close(); oldbf = null; bd = null; GC.Collect(); return bf; } public void Dispose() { lock(locker) { stop = true; } AddTask(null); foreach (Thread worker in workers) { worker.Join(); } wh.Close(); } private void Worker() { string curtask,hash; while (!stop) { curtask = NextTask(); if (curtask == null) wh.WaitOne(); else { if (curtask == "#resethash") thumbnails.Clear(); else { hash = FileNameToHash(curtask); try { thumbnails[hash] = LoadThumbnail(curtask); } catch { thumbnails[hash] = null; } } } } } }

    Read the article

  • Problem using Hibernate-Search

    - by KCore
    Hi, I am using hibernate search for my application. It is well configured and running perfectly till some time back, when it stopped working suddenly. The reason according to me being the number of my model (bean) classes. I have some 90 classes, which I add to my configuration, while building my Hibernate Configuration. When, I disable hibernate search (remove the search annotations and use Configuration instead of AnnotationsConfiguration), I try to start my application, it Works fine. But,the same app when I enable search, it just hangs up. I tried debugging and found the exact place where it hangs. After adding all the class to my AnnotationsConfiguration object, when I say cfg.buildSessionfactory(), It never comes out of that statement. (I have waited for hours!!!) Also when I decrease the number of my model classes (like say to half i.e. 50) it comes out of that statement and the application works fine.. Can Someone tell why is this happening?? My versions of hibernate are: hibernate-core-3.3.1.GA.jar hibernate-annotations-3.4.0.GA.jar hibernate-commons-annotations-3.1.0.GA.jar hibernate-search-3.1.0.GA.jar Also if need to avoid using AnnotationsConfiguration, I read that I need to configure the search event listeners explicitly.. can anyone list all the neccessary listeners and their respective classes? (I tried the standard ones given in Hibernate Search books, but they give me ClassNotFound exception and I have all the neccesarty libs in classpath) Here are the last few lines of hibernate trace I managed to pull : 16:09:32,814 INFO AnnotationConfiguration:369 - Hibernate Validator not found: ignoring 16:09:32,892 INFO ConnectionProviderFactory:95 - Initializing connection provider: org.hibernate.connection.C3P0ConnectionProvider 16:09:32,895 INFO C3P0ConnectionProvider:103 - C3P0 using driver: com.mysql.jdbc.Driver at URL: jdbc:mysql://localhost:3306/autolinkcrmcom_data 16:09:32,898 INFO C3P0ConnectionProvider:104 - Connection properties: {user=root, password=****} 16:09:32,900 INFO C3P0ConnectionProvider:107 - autocommit mode: false 16:09:33,694 INFO SettingsFactory:116 - RDBMS: MySQL, version: 5.1.37-1ubuntu5.1 16:09:33,696 INFO SettingsFactory:117 - JDBC driver: MySQL-AB JDBC Driver, version: mysql-connector-java-3.1.10 ( $Date: 2005/05/19 15:52:23 $, $Revision: 1.1.2.2 $ ) 16:09:33,701 INFO Dialect:175 - Using dialect: org.hibernate.dialect.MySQLDialect 16:09:33,707 INFO TransactionFactoryFactory:59 - Using default transaction strategy (direct JDBC transactions) 16:09:33,709 INFO TransactionManagerLookupFactory:80 - No TransactionManagerLookup configured (in JTA environment, use of read-write or transactional second-level cache is not recommended) 16:09:33,711 INFO SettingsFactory:170 - Automatic flush during beforeCompletion(): disabled 16:09:33,714 INFO SettingsFactory:174 - Automatic session close at end of transaction: disabled 16:09:32,814 INFO AnnotationConfiguration:369 - Hibernate Validator not found: ignoring 16:09:32,892 INFO ConnectionProviderFactory:95 - Initializing connection provider: org.hibernate.connection.C3P0ConnectionProvider 16:09:32,895 INFO C3P0ConnectionProvider:103 - C3P0 using driver: com.mysql.jdbc.Driver at URL: jdbc:mysql://localhost:3306/autolinkcrmcom_data 16:09:32,898 INFO C3P0ConnectionProvider:104 - Connection properties: {user=root, password=****} 16:09:32,900 INFO C3P0ConnectionProvider:107 - autocommit mode: false 16:09:33,694 INFO SettingsFactory:116 - RDBMS: MySQL, version: 5.1.37-1ubuntu5.1 16:09:33,696 INFO SettingsFactory:117 - JDBC driver: MySQL-AB JDBC Driver, version: mysql-connector-java-3.1.10 ( $Date: 2005/05/19 15:52:23 $, $Revision: 1.1.2.2 $ ) 16:09:33,701 INFO Dialect:175 - Using dialect: org.hibernate.dialect.MySQLDialect 16:09:33,707 INFO TransactionFactoryFactory:59 - Using default transaction strategy (direct JDBC transactions) 16:09:33,709 INFO TransactionManagerLookupFactory:80 - No TransactionManagerLookup configured (in JTA environment, use of read-write or transactional second-level cache is not recommended) 16:09:33,711 INFO SettingsFactory:170 - Automatic flush during beforeCompletion(): disabled 16:09:33,714 INFO SettingsFactory:174 - Automatic session close at end of transaction: disabled 16:09:33,716 INFO SettingsFactory:181 - JDBC batch size: 15 16:09:33,719 INFO SettingsFactory:184 - JDBC batch updates for versioned data: disabled 16:09:33,721 INFO SettingsFactory:189 - Scrollable result sets: enabled 16:09:33,723 DEBUG SettingsFactory:193 - Wrap result sets: disabled 16:09:33,725 INFO SettingsFactory:197 - JDBC3 getGeneratedKeys(): enabled 16:09:33,727 INFO SettingsFactory:205 - Connection release mode: auto 16:09:33,730 INFO SettingsFactory:229 - Maximum outer join fetch depth: 2 16:09:33,732 INFO SettingsFactory:232 - Default batch fetch size: 1000 16:09:33,735 INFO SettingsFactory:236 - Generate SQL with comments: disabled 16:09:33,737 INFO SettingsFactory:240 - Order SQL updates by primary key: disabled 16:09:33,740 INFO SettingsFactory:244 - Order SQL inserts for batching: disabled 16:09:33,742 INFO SettingsFactory:420 - Query translator: org.hibernate.hql.ast.ASTQueryTranslatorFactory 16:09:33,744 INFO ASTQueryTranslatorFactory:47 - Using ASTQueryTranslatorFactory 16:09:33,747 INFO SettingsFactory:252 - Query language substitutions: {} 16:09:33,750 INFO SettingsFactory:257 - JPA-QL strict compliance: disabled 16:09:33,752 INFO SettingsFactory:262 - Second-level cache: enabled 16:09:33,754 INFO SettingsFactory:266 - Query cache: disabled 16:09:33,757 INFO SettingsFactory:405 - Cache region factory : org.hibernate.cache.impl.bridge.RegionFactoryCacheProviderBridge 16:09:33,759 INFO RegionFactoryCacheProviderBridge:61 - Cache provider: net.sf.ehcache.hibernate.EhCacheProvider 16:09:33,762 INFO SettingsFactory:276 - Optimize cache for minimal puts: disabled 16:09:33,764 INFO SettingsFactory:285 - Structured second-level cache entries: disabled 16:09:33,766 INFO SettingsFactory:314 - Statistics: disabled 16:09:33,769 INFO SettingsFactory:318 - Deleted entity synthetic identifier rollback: disabled 16:09:33,771 INFO SettingsFactory:333 - Default entity-mode: pojo 16:09:33,774 INFO SettingsFactory:337 - Named query checking : enabled 16:09:33,869 INFO Version:20 - Hibernate Search 3.1.0.GA 16:09:35,134 DEBUG DocumentBuilderIndexedEntity:157 - Field selection in projections is set to false for entity **com.xyz.abc**. recognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernateDocumentBuilderIndexedEntity Donno what the last line indicates ??? (hibernaterecognized....) After the last line it doesnt do anything (no trace too ) and just hangs....

    Read the article

  • Google Chrome: JavaScript associative arrays, evaluated out of sequence

    - by Jerry
    Ok, so on a web page, I've got a JavaScript object which I'm using as an associative array. This exists statically in a script block when the page loads: var salesWeeks = { "200911" : ["11 / 2009", "Fiscal 2009"], "200910" : ["10 / 2009", "Fiscal 2009"], "200909" : ["09 / 2009", "Fiscal 2009"], "200908" : ["08 / 2009", "Fiscal 2009"], "200907" : ["07 / 2009", "Fiscal 2009"], "200906" : ["06 / 2009", "Fiscal 2009"], "200905" : ["05 / 2009", "Fiscal 2009"], "200904" : ["04 / 2009", "Fiscal 2009"], "200903" : ["03 / 2009", "Fiscal 2009"], "200902" : ["02 / 2009", "Fiscal 2009"], "200901" : ["01 / 2009", "Fiscal 2009"], "200852" : ["52 / 2008", "Fiscal 2009"], "200851" : ["51 / 2008", "Fiscal 2009"] }; The order of the key/value pairs is intentional, as I'm turning the object into an HTML select box such as this: <select id="ddl_sw" name="ddl_sw"> <option value="">== SELECT WEEK ==</option> <option value="200911">11 / 2009 (Fiscal 2009)</option> <option value="200910">10 / 2009 (Fiscal 2009)</option> <option value="200909">09 / 2009 (Fiscal 2009)</option> <option value="200908">08 / 2009 (Fiscal 2009)</option> <option value="200907">07 / 2009 (Fiscal 2009)</option> <option value="200906">06 / 2009 (Fiscal 2009)</option> <option value="200905">05 / 2009 (Fiscal 2009)</option> <option value="200904">04 / 2009 (Fiscal 2009)</option> <option value="200903">03 / 2009 (Fiscal 2009)</option> <option value="200902">02 / 2009 (Fiscal 2009)</option> <option value="200901">01 / 2009 (Fiscal 2009)</option> <option value="200852">52 / 2008 (Fiscal 2009)</option> <option value="200851">51 / 2008 (Fiscal 2009)</option> </select> ...with code that looks like this (snipped from a function): var arr = []; arr.push( "<select id=\"ddl_sw\" name=\"ddl_sw\">" + "<option value=\"\">== SELECT WEEK ==</option>" ); for(var key in salesWeeks) { arr.push( "<option value=\"" + key + "\">" + salesWeeks[key][0] + " (" + salesWeeks[key][1] + ")" + "<\/option>" ); } arr.push("<\/select>"); return arr.join(""); This all works fine in IE, FireFox and Opera. However in Chrome, the order comes out all weird: <select id="ddl_sw" name="ddl_sw"> <option value="">== SELECT WEEK ==</option> <option value="200852">52 / 2008 (Fiscal 2009)</option> <option value="200908">08 / 2009 (Fiscal 2009)</option> <option value="200906">06 / 2009 (Fiscal 2009)</option> <option value="200902">02 / 2009 (Fiscal 2009)</option> <option value="200907">07 / 2009 (Fiscal 2009)</option> <option value="200904">04 / 2009 (Fiscal 2009)</option> <option value="200909">09 / 2009 (Fiscal 2009)</option> <option value="200903">03 / 2009 (Fiscal 2009)</option> <option value="200905">05 / 2009 (Fiscal 2009)</option> <option value="200901">01 / 2009 (Fiscal 2009)</option> <option value="200910">10 / 2009 (Fiscal 2009)</option> <option value="200911">11 / 2009 (Fiscal 2009)</option> <option value="200851">51 / 2008 (Fiscal 2009)</option> </select> NOTE: This order, though weird, does not change on subsequent refreshes. It's always in this order. So, what is Chrome doing? Some optimization in how it processes the loop? In the first place, am I wrong to rely on the order that the key/value pairs are declared in any associative array? I never questioned it before, I just assumed the order would hold because this technique has always worked for me in the other browsers. But I suppose I've never seen it stated anywhere that the order is guaranteed. Maybe it's not? Any insight would be awesome. Thanks.

    Read the article

  • Exception on ExecuteReader() using OleDbCommand and Access

    - by Shane Fagan
    Hi again all, I'm getting the error below for this SQL statement in VB.Net 'Fill in the datagrid with the info needed from the accdb file 'to make it simple to access the db connstring = "Provider=Microsoft.ACE.OLEDB.12.0;Data " connstring += "Source=" & Application.StartupPath & "\AuctioneerSystem.accdb" 'make the new connection conn = New System.Data.OleDb.OleDbConnection(connstring) 'the sql command SQLString = "SELECT AllPropertyDetails.PropertyID, Street, Town, County, Acres, Quotas, ResidenceDetails, Status, HighestBid, AskingPrice FROM AllPropertyDetails " SQLString += "INNER JOIN Land ON AllPropertyDetails.PropertyID = Land.PropertyID " SQLString += "WHERE Deleted = False " If PriceRadioButton.Checked = True Then SQLString += "ORDER BY AskingPrice ASC" ElseIf AcresRadioButton.Checked = True Then SQLString += "ORDER BY Acres ASC" End If 'try to open the connection conn.Open() 'if the connection is open If ConnectionState.Open.ToString = "Open" Then 'use the sqlstring and conn to create the command cmd = New System.Data.OleDb.OleDbCommand(SQLString, conn) 'read the db and put it into dr dr = cmd.ExecuteReader If dr.HasRows Then 'if there is rows in the db then make sure the list box is clear 'clear the rows and columns if there is rows in the data grid LandDataGridView.Rows.Clear() LandDataGridView.Columns.Clear() 'add the columns LandDataGridView.Columns.Add("PropertyNumber", "Property Number") LandDataGridView.Columns.Add("Address", "Address") LandDataGridView.Columns.Add("Acres", "No. of Acres") LandDataGridView.Columns.Add("Quotas", "Quotas") LandDataGridView.Columns.Add("Details", "Residence Details") LandDataGridView.Columns.Add("Status", "Status") LandDataGridView.Columns.Add("HighestBid", "Highest Bid") LandDataGridView.Columns.Add("Price", "Asking Price") While dr.Read 'output the fields into the data grid LandDataGridView.Rows.Add( _ dr.Item("PropertyID").ToString _ , dr.Item("Street").ToString & " " & dr.Item("Town").ToString & ", " & dr.Item("County").ToString _ , dr.Item("Acres").ToString _ , dr.Item("Quota").ToString _ , dr.Item("ResidenceDetails").ToString _ , dr.Item("Status").ToString _ , dr.Item("HighestBid").ToString _ , dr.Item("AskingPrice").ToString) End While End If 'close the data reader dr.Close() End If 'close the connection conn.Close() Any ideas why its not working? The fields in the DB and the table names seem ok but its not working :/ The tables are AllPropertyDetails ProperyID:Number Street: text Town: text County: text Status: text HighestBid: Currency AskingPrice: Currency Deleted: Boolean Land PropertyID: Number Acres: Number Quotas: Text ResidenceDetails: text error is: System.InvalidOperationException was unhandled Message="An error occurred creating the form. See Exception.InnerException for details. The error is: No value given for one or more required parameters." Source="AuctioneerProject" StackTrace: at AuctioneerProject.My.MyProject.MyForms.Create__Instance__[T](T Instance) in 17d14f5c-a337-4978-8281-53493378c1071.vb:line 190 at AuctioneerProject.My.MyProject.MyForms.get_LandReport() at AuctioneerProject.ReportsMenu.LandButton_Click(Object sender, EventArgs e) in C:\Users\admin\Desktop\Auctioneers\AuctioneerProject\AuctioneerProject\ReportsMenu.vb:line 4 at System.Windows.Forms.Control.OnClick(EventArgs e) at System.Windows.Forms.Button.OnClick(EventArgs e) at System.Windows.Forms.Button.OnMouseUp(MouseEventArgs mevent) at System.Windows.Forms.Control.WmMouseUp(Message& m, MouseButtons button, Int32 clicks) at System.Windows.Forms.Control.WndProc(Message& m) at System.Windows.Forms.ButtonBase.WndProc(Message& m) at System.Windows.Forms.Button.WndProc(Message& m) at System.Windows.Forms.Control.ControlNativeWindow.OnMessage(Message& m) at System.Windows.Forms.Control.ControlNativeWindow.WndProc(Message& m) at System.Windows.Forms.NativeWindow.DebuggableCallback(IntPtr hWnd, Int32 msg, IntPtr wparam, IntPtr lparam) at System.Windows.Forms.UnsafeNativeMethods.DispatchMessageW(MSG& msg) at System.Windows.Forms.Application.ComponentManager.System.Windows.Forms.UnsafeNativeMethods.IMsoComponentManager.FPushMessageLoop(Int32 dwComponentID, Int32 reason, Int32 pvLoopData) at System.Windows.Forms.Application.ThreadContext.RunMessageLoopInner(Int32 reason, ApplicationContext context) at System.Windows.Forms.Application.ThreadContext.RunMessageLoop(Int32 reason, ApplicationContext context) at System.Windows.Forms.Application.Run(ApplicationContext context) at Microsoft.VisualBasic.ApplicationServices.WindowsFormsApplicationBase.OnRun() at Microsoft.VisualBasic.ApplicationServices.WindowsFormsApplicationBase.DoApplicationModel() at Microsoft.VisualBasic.ApplicationServices.WindowsFormsApplicationBase.Run(String[] commandLine) at AuctioneerProject.My.MyApplication.Main(String[] Args) in 17d14f5c-a337-4978-8281-53493378c1071.vb:line 81 at System.AppDomain._nExecuteAssembly(Assembly assembly, String[] args) at System.AppDomain.ExecuteAssembly(String assemblyFile, Evidence assemblySecurity, String[] args) at Microsoft.VisualStudio.HostingProcess.HostProc.RunUsersAssembly() at System.Threading.ThreadHelper.ThreadStart_Context(Object state) at System.Threading.ExecutionContext.Run(ExecutionContext executionContext, ContextCallback callback, Object state) at System.Threading.ThreadHelper.ThreadStart() InnerException: System.Data.OleDb.OleDbException ErrorCode=-2147217904 Message="No value given for one or more required parameters." Source="Microsoft Office Access Database Engine" StackTrace: at System.Data.OleDb.OleDbCommand.ExecuteCommandTextErrorHandling(OleDbHResult hr) at System.Data.OleDb.OleDbCommand.ExecuteCommandTextForSingleResult(tagDBPARAMS dbParams, Object& executeResult) at System.Data.OleDb.OleDbCommand.ExecuteCommandText(Object& executeResult) at System.Data.OleDb.OleDbCommand.ExecuteCommand(CommandBehavior behavior, Object& executeResult) at System.Data.OleDb.OleDbCommand.ExecuteReaderInternal(CommandBehavior behavior, String method) at System.Data.OleDb.OleDbCommand.ExecuteReader(CommandBehavior behavior) at System.Data.OleDb.OleDbCommand.ExecuteReader() at AuctioneerProject.LandReport.load_Land() in C:\Users\admin\Desktop\Auctioneers\AuctioneerProject\AuctioneerProject\LandReport.vb:line 37 at AuctioneerProject.LandReport.PriceRadioButton_CheckedChanged(Object sender, EventArgs e) in C:\Users\admin\Desktop\Auctioneers\AuctioneerProject\AuctioneerProject\LandReport.vb:line 79 at System.Windows.Forms.RadioButton.OnCheckedChanged(EventArgs e) at System.Windows.Forms.RadioButton.set_Checked(Boolean value) at AuctioneerProject.LandReport.InitializeComponent() in C:\Users\admin\Desktop\Auctioneers\AuctioneerProject\AuctioneerProject\LandReport.designer.vb:line 40 at AuctioneerProject.LandReport..ctor() in C:\Users\admin\Desktop\Auctioneers\AuctioneerProject\AuctioneerProject\LandReport.vb:line 5 InnerException:

    Read the article

  • Python hashable dicts

    - by TokenMacGuy
    As an exercise, and mostly for my own amusement, I'm implementing a backtracking packrat parser. The inspiration for this is i'd like to have a better idea about how hygenic macros would work in an algol-like language (as apposed to the syntax free lisp dialects you normally find them in). Because of this, different passes through the input might see different grammars, so cached parse results are invalid, unless I also store the current version of the grammar along with the cached parse results. (EDIT: a consequence of this use of key-value collections is that they should be immutable, but I don't intend to expose the interface to allow them to be changed, so either mutable or immutable collections are fine) The problem is that python dicts cannot appear as keys to other dicts. Even using a tuple (as I'd be doing anyways) doesn't help. >>> cache = {} >>> rule = {"foo":"bar"} >>> cache[(rule, "baz")] = "quux" Traceback (most recent call last): File "<stdin>", line 1, in <module> TypeError: unhashable type: 'dict' >>> I guess it has to be tuples all the way down. Now the python standard library provides approximately what i'd need, collections.namedtuple has a very different syntax, but can be used as a key. continuing from above session: >>> from collections import namedtuple >>> Rule = namedtuple("Rule",rule.keys()) >>> cache[(Rule(**rule), "baz")] = "quux" >>> cache {(Rule(foo='bar'), 'baz'): 'quux'} Ok. But I have to make a class for each possible combination of keys in the rule I would want to use, which isn't so bad, because each parse rule knows exactly what parameters it uses, so that class can be defined at the same time as the function that parses the rule. But combining the rules together is much more dynamic. In particular, I'd like a simple way to have rules override other rules, but collections.namedtuple has no analogue to dict.update(). Edit: An additional problem with namedtuples is that they are strictly positional. Two tuples that look like they should be different can in fact be the same: >>> you = namedtuple("foo",["bar","baz"]) >>> me = namedtuple("foo",["bar","quux"]) >>> you(bar=1,baz=2) == me(bar=1,quux=2) True >>> bob = namedtuple("foo",["baz","bar"]) >>> you(bar=1,baz=2) == bob(bar=1,baz=2) False tl'dr: How do I get dicts that can be used as keys to other dicts? Having hacked a bit on the answers, here's the more complete solution I'm using. Note that this does a bit extra work to make the resulting dicts vaguely immutable for practical purposes. Of course it's still quite easy to hack around it by calling dict.__setitem__(instance, key, value) but we're all adults here. class hashdict(dict): """ hashable dict implementation, suitable for use as a key into other dicts. >>> h1 = hashdict({"apples": 1, "bananas":2}) >>> h2 = hashdict({"bananas": 3, "mangoes": 5}) >>> h1+h2 hashdict(apples=1, bananas=3, mangoes=5) >>> d1 = {} >>> d1[h1] = "salad" >>> d1[h1] 'salad' >>> d1[h2] Traceback (most recent call last): ... KeyError: hashdict(bananas=3, mangoes=5) based on answers from http://stackoverflow.com/questions/1151658/python-hashable-dicts """ def __key(self): return tuple(sorted(self.items())) def __repr__(self): return "{0}({1})".format(self.__class__.__name__, ", ".join("{0}={1}".format( str(i[0]),repr(i[1])) for i in self.__key())) def __hash__(self): return hash(self.__key()) def __setitem__(self, key, value): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def __delitem__(self, key): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def clear(self): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def pop(self, *args, **kwargs): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def popitem(self, *args, **kwargs): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def setdefault(self, *args, **kwargs): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def update(self, *args, **kwargs): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def __add__(self, right): result = hashdict(self) dict.update(result, right) return result if __name__ == "__main__": import doctest doctest.testmod()

    Read the article

  • jQuery Toggle with Cookie

    - by Cameron
    I have the following toggle system, but I want it to remember what was open/closed using the jQuery cookie plugin. So for example if I open a toggle and then navigate away from the page, when I come back it should be still open. This is code I have so far, but it's becoming rather confusing, some help would be much appreciated thanks. jQuery.cookie = function (name, value, options) { if (typeof value != 'undefined') { options = options || {}; if (value === null) { value = ''; options = $.extend({}, options); options.expires = -1; } var expires = ''; if (options.expires && (typeof options.expires == 'number' || options.expires.toUTCString)) { var date; if (typeof options.expires == 'number') { date = new Date(); date.setTime(date.getTime() + (options.expires * 24 * 60 * 60 * 1000)); } else { date = options.expires; } expires = '; expires=' + date.toUTCString(); } var path = options.path ? '; path=' + (options.path) : ''; var domain = options.domain ? '; domain=' + (options.domain) : ''; var secure = options.secure ? '; secure' : ''; document.cookie = [name, '=', encodeURIComponent(value), expires, path, domain, secure].join(''); } else { var cookieValue = null; if (document.cookie && document.cookie != '') { var cookies = document.cookie.split(';'); for (var i = 0; i < cookies.length; i++) { var cookie = jQuery.trim(cookies[i]); if (cookie.substring(0, name.length + 1) == (name + '=')) { cookieValue = decodeURIComponent(cookie.substring(name.length + 1)); break; } } } return cookieValue; } }; // var showTop = $.cookie('showTop'); if ($.cookie('showTop') == 'collapsed') { $(".toggle_container").hide(); $(".trigger").toggle(function () { $(this).addClass("active"); }, function () { $(this).removeClass("active"); }); $(".trigger").click(function () { $(this).next(".toggle_container").slideToggle("slow,"); }); } else { $(".toggle_container").show(); $(".trigger").toggle(function () { $(this).addClass("active"); }, function () { $(this).removeClass("active"); }); $(".trigger").click(function () { $(this).next(".toggle_container").slideToggle("slow,"); }); }; $(".trigger").click(function () { if ($(".toggle_container").is(":hidden")) { $(this).next(".toggle_container").slideToggle("slow,"); $.cookie('showTop', 'expanded'); } else { $(this).next(".toggle_container").slideToggle("slow,"); $.cookie('showTop', 'collapsed'); } return false; }); and this is a snippet of the HTML it works with: <li> <label for="small"><input type="checkbox" id="small" /> Small</label> <a class="trigger" href="#">Toggle</a> <div class="toggle_container"> <p class="funding"><strong>Funding</strong></p> <ul class="childs"> <li class="child"> <label for="fully-funded1"><input type="checkbox" id="fully-funded1" /> Fully Funded</label> <a class="trigger" href="#">Toggle</a> <div class="toggle_container"> <p class="days"><strong>Days</strong></p> <ul class="days clearfix"> <li><label for="1pre16">Pre 16</label> <input type="text" id="1pre16" /></li> <li><label for="2post16">Post 16</label> <input type="text" id="2post16" /></li> <li><label for="3teacher">Teacher</label> <input type="text" id="3teacher" /></li> </ul> </div> </li>

    Read the article

  • Arduino - AdHoc Network Setup

    - by methodMan
    I`m currently working with an arduino trying to build an adhoc network to which a device can connect to and send web request to. The problem I am currently having is that I can only set up one connection and then when that connection is terminated (client.stop()) all subsequent connections are not picked up by the server, even a curl command just sits there spinning. The first connection I start when I reset the server works fine and I am able to talk to the server; but after that, the arduino can no longer find new clients (even though it's trying with the library given). I`m using the sparkfun library for the wifly shield cloned from github, along with an Arduino Uno. My current code is based off their default example 'WiFly_AdHoc_Example' but I had to remove a few things to get the network to start up which might be the cause of this problem. Here is the .ino file that I am running. #include <SPI.h> #include <WiFly.h> //#include <SoftwareSerial.h> //SoftwareSerial mySerial( 5, 4); //Part from example not used(see below) WiFlyServer server(80); void setup() { Serial.begin(9600); //The code below is from the example but when I run it the WiFly will hang // on Wifly.begin(). Without it the WiFly starts up fine but only works for // one request. //mySerial.begin(9600); //WiFly.setUart(&mySerial); // Tell the WiFly library that we are not //using the SPIUart Serial.println("**************Starting WiFly**************"); // Enable Adhoc mod WiFly.begin(true); Serial.println("WiFly started, creating network."); if (!WiFly.createAdHocNetwork("wifly")) { Serial.print("Failed to create ad hoc network."); while (1) { // Hang on failure. } } Serial.println("Network created"); Serial.print("IP: "); Serial.println(WiFly.ip()); Serial.println("Starting Server..."); server.begin(); Serial.print("Server started, waiting for client."); } void loop() { delay(200); WiFlyClient client = server.available(); if (client) { Serial.println("Client Found."); // a string to store received commands String current_command = ""; while (client.connected()) { if (client.available()) { //Gets a character from the sent request. char c = client.read(); if (c=='#' || c=='\n') //End of extraneous output { current_command = ""; } else if(c!= '\n') { current_command+=c; } if (current_command== "get") { // output the value of each analog input pin for (int i = 0; i < 6; i++) { client.print("analog input "); client.print(i); client.print(" is "); client.print(analogRead(i)); client.println("<br />"); } } else if(current_command== "hello") { client.println("Hello there, I'm still here."); } else if (current_command== "quit") { client.println("Goodbye..."); client.stop(); current_command == ""; break; } else if (current_command == "*OPEN*") { current_command == ""; } } } // give the web browser time to receive the data delay(200); // close the connection client.stop(); } } If anyone understands this better then I (I`m new to arduino) please leave some helpful comments. Or just help me out on getting this little web server up and running so that I can hit it with more then one request. If there is any other helpful information I can provide please let me know. Thanks for reading and hope you can help. EDIT: Using telnet I can successfully connect (the first time) and send commands to the arduino including one to terminate the connection (calls the client.stop() method). But when I try to reconnect though telnet, it says the connection was successful but on the arduino it's still looping thinking the client is still false. WHAT??? I know right, I'm getting mixed messages from telnet vs arduino. None of the commands work obviously since the ardunio is still looping waiting for a client that evaluates to true. I'm gonna take a look at WiFlyServer from the library I imported and see if I can dig up the problem because somehow that server.available() method isn't finding new clients. Noticing a lot of TODO's in the library code.... EDIT: So I found the reason for the problem, it was in WiFlyServer.cpp file from the sparkfun library. The code that was causing the reconnect issue was infact in the server.availible() method. Right at the top of the method, there is a check: // TODO: Ensure no active non-server client connection. if (!WiFly.serverConnectionActive) { activeClient._port = 0; } For some reason when I comment this out, I can reconnect fine and everything works as it should. I will now dive into the library and see if I can fix this, I'm not exactly sure what this is doing but it gets called when the server connection is not active and is somehow blocking subsequent connections. Does anyone have any ideas how I might get to the root of this problem without using this commenting hack? Please help, no-one has commented or answered yet! Don't you want to join in on the fun???

    Read the article

  • Rails multiple select box issue for search

    - by Reido
    First off here is my model, controller, view: My model, this is where I have my search code:--------------------------- def self.find_by_lcc(params) where = [] where << "category = 'Land'" unless params[:mls].blank? where << "mls = :mls" end unless params[:county].blank? where << "county = :county" end unless params[:acreage_range].blank? where << "acreage_range = :acreage_range" end unless params[:landtype].blank? where << "landtype = :landtype" end unless params[:price_range].blank? where << "price_range = :price_range" end if where.empty? [] else find(:all, :conditions => [where.join(" AND "), params], :order => "county, price desc") end end My controller:---------------- def land @counties = ['Adams', 'Alcorn', 'Amite', 'Attala'] @title = "Browse" return if params[:commit].nil? @properties = Property.find_by_lcc(params) else 'No properties were found' render :action = 'land_table' end My View: ---------------------- <table width="900"> <tr> <td> <% form_tag({ :action => "land" }, :method => "get") do %> <fieldset> <legend>Search our Land Properties</legend> <div class="form_row"><p>&nbsp;</p></div> <div class="form_row"> <label for="mls">MLS Number:</label>&nbsp; <%= text_field_tag 'mls', params[:mls] %> </div> <div class="form_row"> <label for "county"><font color="#ff0000">*County:</font></label>&nbsp; <%= select_tag "county", options_for_select(@counties), :multiple => true, :size => 6 %> </div> <div class="form_row"> <label for "acreage_range">Acreage:</label>&nbsp; <%= select_tag "acreage_range", options_for_select([['All',''],['1-10','1-10'],['11-25','11-25'],['26-50','26-50'],['51-100','51-100']]) %> </div> <div class="form_row"> <label for "landtype">Type:</label>&nbsp; <%= select_tag "landtype", options_for_select([['All',''],['Waterfront','Waterfront'],['Wooded','Wooded'],['Pasture','Pasture'],['Woods/Pasture','Woods/Pasture'],['Lot','Lot']]) %> </div> <div class="form_row"> <label for="price_range"><font color="#ff0000">*Price:</font></label>&nbsp; <%= select_tag "price_range", options_for_select([['All',''],['0-1,000','0-1,000'],['1,001-10,000','1,001-10,000'],['10,001-50,000','10,001-50,000'],['50,001-100,000','50,001-100,000'],['100,001-150,000']])%> </div> <input type="text" style="display: none;" disabled="disabled" size="1" /> <%= submit_tag "Search", :class => "submit" %> </fieldset> <% end%> </td> </tr> </table> The search works fine until I add ", :multiple = true, :size = 6" to make the county field multiple select. Then I get the error: Processing PublicController#land (for 65.0.81.83 at 2010-04-01 13:11:30) [GET] Parameters: {"acreage_range"=>"", "commit"=>"Search", "county"=>["Adams", "Amite"], "landtype"=>"", "price_range"=>"", "mls"=>""} ActiveRecord::StatementInvalid (Mysql::Error: Operand should contain 1 column(s): SELECT * FROM `properties` WHERE (category = 'Land' AND county = 'Adams','Amite') ORDER BY county, price desc): app/models/property.rb:93:in `find_by_lcc' app/controllers/public_controller.rb:84:in `land' /usr/lib/ruby/1.8/thread.rb:135:in `synchronize' fcgi (0.8.7) lib/fcgi.rb:117:in `session' fcgi (0.8.7) lib/fcgi.rb:104:in `each_request' fcgi (0.8.7) lib/fcgi.rb:36:in `each' dispatch.fcgi:24 I've tried to make the county, acreage_range, and price_range fields into multiple select boxes numerous ways, but can not get any method to work correctly. Any help would be greatly appreciated. Thanks,

    Read the article

  • NServiceBus pipeline with Distributors

    - by David
    I'm building a processing pipeline with NServiceBus but I'm having trouble with the configuration of the distributors in order to make each step in the process scalable. Here's some info: The pipeline will have a master process that says "OK, time to start" for a WorkItem, which will then start a process like a flowchart. Each step in the flowchart may be computationally expensive, so I want the ability to scale out each step. This tells me that each step needs a Distributor. I want to be able to hook additional activities onto events later. This tells me I need to Publish() messages when it is done, not Send() them. A process may need to branch based on a condition. This tells me that a process must be able to publish more than one type of message. A process may need to join forks. I imagine I should use Sagas for this. Hopefully these assumptions are good otherwise I'm in more trouble than I thought. For the sake of simplicity, let's forget about forking or joining and consider a simple pipeline, with Step A followed by Step B, and ending with Step C. Each step gets its own distributor and can have many nodes processing messages. NodeA workers contain a IHandleMessages processor, and publish EventA NodeB workers contain a IHandleMessages processor, and publish Event B NodeC workers contain a IHandleMessages processor, and then the pipeline is complete. Here are the relevant parts of the config files, where # denotes the number of the worker, (i.e. there are input queues NodeA.1 and NodeA.2): NodeA: <MsmqTransportConfig InputQueue="NodeA.#" ErrorQueue="error" NumberOfWorkerThreads="1" MaxRetries="5" /> <UnicastBusConfig DistributorControlAddress="NodeA.Distrib.Control" DistributorDataAddress="NodeA.Distrib.Data" > <MessageEndpointMappings> </MessageEndpointMappings> </UnicastBusConfig> NodeB: <MsmqTransportConfig InputQueue="NodeB.#" ErrorQueue="error" NumberOfWorkerThreads="1" MaxRetries="5" /> <UnicastBusConfig DistributorControlAddress="NodeB.Distrib.Control" DistributorDataAddress="NodeB.Distrib.Data" > <MessageEndpointMappings> <add Messages="Messages.EventA, Messages" Endpoint="NodeA.Distrib.Data" /> </MessageEndpointMappings> </UnicastBusConfig> NodeC: <MsmqTransportConfig InputQueue="NodeC.#" ErrorQueue="error" NumberOfWorkerThreads="1" MaxRetries="5" /> <UnicastBusConfig DistributorControlAddress="NodeC.Distrib.Control" DistributorDataAddress="NodeC.Distrib.Data" > <MessageEndpointMappings> <add Messages="Messages.EventB, Messages" Endpoint="NodeB.Distrib.Data" /> </MessageEndpointMappings> </UnicastBusConfig> And here are the relevant parts of the distributor configs: Distributor A: <add key="DataInputQueue" value="NodeA.Distrib.Data"/> <add key="ControlInputQueue" value="NodeA.Distrib.Control"/> <add key="StorageQueue" value="NodeA.Distrib.Storage"/> Distributor B: <add key="DataInputQueue" value="NodeB.Distrib.Data"/> <add key="ControlInputQueue" value="NodeB.Distrib.Control"/> <add key="StorageQueue" value="NodeB.Distrib.Storage"/> Distributor C: <add key="DataInputQueue" value="NodeC.Distrib.Data"/> <add key="ControlInputQueue" value="NodeC.Distrib.Control"/> <add key="StorageQueue" value="NodeC.Distrib.Storage"/> I'm testing using 2 instances of each node, and the problem seems to come up in the middle at Node B. There are basically 2 things that might happen: Both instances of Node B report that it is subscribing to EventA, and also that NodeC.Distrib.Data@MYCOMPUTER is subscribing to the EventB that Node B publishes. In this case, everything works great. Both instances of Node B report that it is subscribing to EventA, however, one worker says NodeC.Distrib.Data@MYCOMPUTER is subscribing TWICE, while the other worker does not mention it. In the second case, which seem to be controlled only by the way the distributor routes the subscription messages, if the "overachiever" node processes an EventA, all is well. If the "underachiever" processes EventA, then the publish of EventB has no subscribers and the workflow dies. So, my questions: Is this kind of setup possible? Is the configuration correct? It's hard to find any examples of configuration with distributors beyond a simple one-level publisher/2-worker setup. Would it make more sense to have one central broker process that does all the non-computationally-intensive traffic cop operations, and only sends messages to processes behind distributors when the task is long-running and must be load balanced? Then the load-balanced nodes could simply reply back to the central broker, which seems easier. On the other hand, that seems at odds with the decentralization that is NServiceBus's strength. And if this is the answer, and the long running process's done event is a reply, how do you keep the Publish that enables later extensibility on published events?

    Read the article

  • Unaccounted for database size

    - by Nazadus
    I currently have a database that is 20GB in size. I've run a few scripts which show on each tables size (and other incredibly useful information such as index stuff) and the biggest table is 1.1 million records which takes up 150MB of data. We have less than 50 tables most of which take up less than 1MB of data. After looking at the size of each table I don't understand why the database shouldn't be 1GB in size after a shrink. The amount of available free space that SqlServer (2005) reports is 0%. The log mode is set to simple. At this point my main concern is I feel like I have 19GB of unaccounted for used space. Is there something else I should look at? Normally I wouldn't care and would make this a passive research project except this particular situation calls for us to do a backup and restore on a weekly basis to put a copy on a satellite (which has no internet, so it must be done manually). I'd much rather copy 1GB (or even if it were down to 5GB!) than 20GB of data each week. sp_spaceused reports the following: Navigator-Production 19184.56 MB 3.02 MB And the second part of it: 19640872 KB 19512112 KB 108184 KB 20576 KB while I've found a few other scripts (such as the one from two of the server database size questions here, they all report the same information either found above or below). The script I am using is from SqlTeam. Here is the header info: * BigTables.sql * Bill Graziano (SQLTeam.com) * graz@<email removed> * v1.11 The top few tables show this (table, rows, reserved space, data, index, unused, etc): Activity 1143639 131 MB 89 MB 41768 KB 1648 KB 46% 1% EventAttendance 883261 90 MB 58 MB 32264 KB 328 KB 54% 0% Person 113437 31 MB 15 MB 15752 KB 912 KB 103% 3% HouseholdMember 113443 12 MB 6 MB 5224 KB 432 KB 82% 4% PostalAddress 48870 8 MB 6 MB 2200 KB 280 KB 36% 3% The rest of the tables are either the same in size or smaller. No more than 50 tables. Update 1: - All tables use unique identifiers. Usually an int incremented by 1 per row. I've also re-indexed everything. I ran the dbcc shrink command as well as updating the usage before and after. And over and over. An interesting thing I found is that when I restarted the server and confirmed no one was using it (and no maintenance procs are running, this is a very new application -- under a week old) and when I went to run the shrink, every now and then it would say something about data changed. Googling yielded too few useful answers with the obvious not applying (it was 1am and I disconnected everyone, so it seems impossible that was really the case). The data was migrated via C# code which basically looked at another server and brought things over. The quantity of deletes, at this point in time, are probably under 50k in rows. Even if those rows were the biggest rows, that wouldn't be more than 100M I would imagine. When I go to shrink via the GUI it reports 0% available to shrink, indicating that I've already gotten it as small as it thinks it can go. Update 2: sp_spaceused 'Activity' yields this (which seems right on the money): Activity 1143639 134488 KB 91072 KB 41768 KB 1648 KB Fill factor was 90. All primary keys are ints. Here is the command I used to 'updateusage': DBCC UPDATEUSAGE(0); Update 3: Per Edosoft's request: Image 111975 2407773 19262184 It appears as though the image table believes it's the 19GB portion. I don't understand what this means though. Is it really 19GB or is it misrepresented? Update 4: Talking to a co-worker and I found out that it's because of the pages, as someone else here has also state the potential for that. The only index on the image table is a clustered PK. Is this something I can fix or do I just have to deal with it? The regular script shows the Image table to be 6MB in size. Update 5: I think I'm just going to have to deal with it after further research. The images have been resized to be roughly 2-5KB each and on a normal file system doesn't consume much space but on SqlServer it seems to consume considerably more. The real answer, in the long run, will likely be separating that table in to another partition or something similar.

    Read the article

  • Trouble updating my datagrid in WPF

    - by wrigley06
    As the title indicates, I'm having trouble updating a datagrid in WPF. Basically what I'm trying to accomplish is a datagrid, that is connected to a SQL Server database, that updates automatically once a user enters information into a few textboxes and clicks a submit button. You'll notice that I have a command that joins two tables. The data from the Quote_Data table will be inserted by a different user at a later time. For now my only concern is getting the information from the textboxes and into the General_Info table, and from there into my datagrid. The code, which I'll include below compiles fine, but when I hit the submit button, nothing happens. This is the first application I've ever built working with a SQL Database so many of these concepts are new to me, which is why you'll probably look at my code and wonder what is he thinking. public partial class MainWindow : Window { public MainWindow() { InitializeComponent(); } public DataSet mds; // main data set (mds) private void Window_Loaded_1(object sender, RoutedEventArgs e) { try { string connectionString = Sqtm.Properties.Settings.Default.SqtmDbConnectionString; using (SqlConnection connection = new SqlConnection(connectionString)) { connection.Open(); //Merging tables General_Info and Quote_Data SqlCommand cmd = new SqlCommand("SELECT General_Info.Quote_ID, General_Info.Open_Quote, General_Info.Customer_Name," + "General_Info.OEM_Name, General_Info.Qty, General_Info.Quote_Num, General_Info.Fab_Drawing_Num, " + "General_Info.Rfq_Num, General_Info.Rev_Num, Quote_Data.MOA, Quote_Data.MOQ, " + "Quote_Data.Markup, Quote_Data.FOB, Quote_Data.Shipping_Method, Quote_Data.Freight, " + "Quote_Data.Vendor_Price, Unit_Price, Quote_Data.Difference, Quote_Data.Vendor_NRE_ET, " + "Quote_Data.NRE, Quote_Data.ET, Quote_Data.STI_NET, Quote_Data.Mfg_Time, Quote_Data.Delivery_Time, " + "Quote_Data.Mfg_Name, Quote_Data.Mfg_Location " + "FROM General_Info INNER JOIN dbo.Quote_Data ON General_Info.Quote_ID = Quote_Data.Quote_ID", connection); SqlDataAdapter da = new SqlDataAdapter(cmd); DataTable dt = new DataTable(); da.Fill(dt); MainGrid.ItemsSource = dt.DefaultView; mds = new DataSet(); da.Fill(mds, "General_Info"); MainGrid.DataContext = mds.Tables["General_Info"]; } } catch (Exception ex) { MessageBox.Show(ex.Message); } // renaming column names from the database so they are easier to read in the datagrid MainGrid.Columns[0].Header = "#"; MainGrid.Columns[1].Header = "Date"; MainGrid.Columns[2].Header = "Customer"; MainGrid.Columns[3].Header = "OEM"; MainGrid.Columns[4].Header = "Qty"; MainGrid.Columns[5].Header = "Quote Number"; MainGrid.Columns[6].Header = "Fab Drawing Num"; MainGrid.Columns[7].Header = "RFQ Number"; MainGrid.Columns[8].Header = "Rev Number"; MainGrid.Columns[9].Header = "MOA"; MainGrid.Columns[10].Header = "MOQ"; MainGrid.Columns[11].Header = "Markup"; MainGrid.Columns[12].Header = "FOB"; MainGrid.Columns[13].Header = "Shipping"; MainGrid.Columns[14].Header = "Freight"; MainGrid.Columns[15].Header = "Vendor Price"; MainGrid.Columns[16].Header = "Unit Price"; MainGrid.Columns[17].Header = "Difference"; MainGrid.Columns[18].Header = "Vendor NRE/ET"; MainGrid.Columns[19].Header = "NRE"; MainGrid.Columns[20].Header = "ET"; MainGrid.Columns[21].Header = "STINET"; MainGrid.Columns[22].Header = "Mfg. Time"; MainGrid.Columns[23].Header = "Delivery Time"; MainGrid.Columns[24].Header = "Manufacturer"; MainGrid.Columns[25].Header = "Mfg. Location"; } private void submitQuotebtn_Click(object sender, RoutedEventArgs e) { CustomerData newQuote = new CustomerData(); int quantity; quantity = Convert.ToInt32(quantityTxt.Text); string theDate = System.DateTime.Today.Date.ToString("d"); newQuote.OpenQuote = theDate; newQuote.CustomerName = customerNameTxt.Text; newQuote.OEMName = oemNameTxt.Text; newQuote.Qty = quantity; newQuote.QuoteNumber = quoteNumberTxt.Text; newQuote.FdNumber = fabDrawingNumberTxt.Text; newQuote.RfqNumber = rfqNumberTxt.Text; newQuote.RevNumber = revNumberTxt.Text; try { string insertConString = Sqtm.Properties.Settings.Default.SqtmDbConnectionString; using (SqlConnection insertConnection = new SqlConnection(insertConString)) { insertConnection.Open(); SqlDataAdapter adapter = new SqlDataAdapter(Sqtm.Properties.Settings.Default.SqtmDbConnectionString, insertConnection); SqlCommand updateCmd = new SqlCommand("UPDATE General_Info " + "Quote_ID = @Quote_ID, " + "Open_Quote = @Open_Quote, " + "OEM_Name = @OEM_Name, " + "Qty = @Qty, " + "Quote_Num = @Quote_Num, " + "Fab_Drawing_Num = @Fab_Drawing_Num, " + "Rfq_Num = @Rfq_Num, " + "Rev_Num = @Rev_Num " + "WHERE Quote_ID = @Quote_ID"); updateCmd.Connection = insertConnection; System.Data.SqlClient.SqlParameterCollection param = updateCmd.Parameters; // // Add new SqlParameters to the command. // param.AddWithValue("Open_Quote", newQuote.OpenQuote); param.AddWithValue("Customer_Name", newQuote.CustomerName); param.AddWithValue("OEM_Name", newQuote.OEMName); param.AddWithValue("Qty", newQuote.Qty); param.AddWithValue("Quote_Num", newQuote.QuoteNumber); param.AddWithValue("Fab_Drawing_Num", newQuote.FdNumber); param.AddWithValue("Rfq_Num", newQuote.RfqNumber); param.AddWithValue("Rev_Num", newQuote.RevNumber); adapter.UpdateCommand = updateCmd; adapter.Update(mds.Tables[0]); mds.AcceptChanges(); } } catch (Exception ex) { MessageBox.Show(ex.Message); } } Thanks in advance to anyone who can help, I really appreciate it, Andrew

    Read the article

  • Am I crazy? (How) should I create a jQuery content editor?

    - by Brendon Muir
    Ok, so I created a CMS mainly aimed at Primary Schools. It's getting fairly popular in New Zealand but the one thing I hate with a passion is the largely bad quality of in browser WYSIWYG editors. I've been using KTML (made by InterAKT which was purchased by Adobe a few years ago). In my opinion this editor does a lot of great things (image editing/management, thumbnailing and pretty good content editing). Unfortunately time has had its nasty way with this product and new browsers are beginning to break features and generally degrade the performance of this tool. It's also quite scary basing my livelihood on a defunct product! I've been hunting, in fact I regularly hunt around to see if anything has changed in the WYSIWYG arena. The closest thing I've seen that excites me is the WYSIHAT framework, but they've decided to ignore a pretty relevant editing paradigm which I'm going to outline below. This is the idea for my proposed editor, and I don't know of any existing products that can do this properly: Right, so the traditional model for editing let's say a Page in a CMS is to log into a 'back end' and click edit on the page. This will then load another screen with the editor in it and perhaps a few other fields. More advanced CMS's will maybe have several editing boxes that are for different portions of the page. Anyway, the big problem with this way of doing things is that the user is editing a document outside of the final context it will appear in. In the simplest terms, this means the page template. Many things can be wrong, e.g. the with of the editing area might be different to the width of the actual template area. The height is nearly always fixed because existing editors always seem to use IFRAMES for backward compatibility. And there are plenty of other beefs which I'm sure you're quite aware of if you're in this development area. Here's my editor utopia: You click 'Edit Page': The actual page (with its actual template) displays. Portions of the page have been marked as editable via a class name. You click on one of these areas (in my case it'd just be the big 'body' area in the middle of the template) and a editing bar drops down from the top of the screen with all your standard controls (bold, italic, insert image etc...). Iframes are never used, instead we rely on setting contentEditable to true on the DIV's in question. Firefox 2 and IE6 can go away, let's move on. You can edit the page knowing exactly how it will look when you save it. Because all the styles for this template are loaded, your headings will look correct, everything will be just dandy. Is this such a radical concept? Why are we still content with TinyMCE and that other editor that is too embarrassing to use because it sounds like a swear word!? Let's face the facts: I'm a JavaScript novice. I did once play around in this area using the Javascript Anthology from SitePoint as a guide. It was quite a cool learning experience, but they of course used the IFRAME to make their lives easier. I tried to go a different route and just use contentEditable and even tried to sidestep the native content editing routines (execCommand) and instead wrote my own. They kind of worked but there were always issues. Now we have jQuery, and a few libraries that abstract things like IE's lack of Range support. I'm wondering, am I crazy, or is it actually a good idea to try and build an editor around this editing paradigm using jQuery and relevant plugins to make the job easier? My actual questions: Where would you start? What plugins do you know of that would help the most? Is it worth it, or is there a magical project that already exists that I should join in on? What are the biggest hurdles to overcome in a project like this? Am I crazy? I hope this question has been posted on the right board. I figured it is a technical question as I'm wanting to know specific hurdles and pitfalls to watch out for and also if it is technically feasible with todays technology. Looking forward to hearing peoples thoughts and opinions.

    Read the article

  • retriving hearders in all pages of word

    - by udaya
    Hi I am exporting data from php page to word,, there i get 'n' number of datas in each page .... How to set the maximum number of data that a word page can contain ,,,, I want only 20 datas in a single page This is the coding i use to export the data to word i got the data in word format but the headers are not available for all the pages ex: Page:1 slno name country state Town 1 vivek india tamilnadu trichy 2 uday india kerala coimbatore like this i am getting many details but in my page:2 i dont get the headers like name country state and town....But i can get the details like kumar america xxxx yyyy i want the result to be like slno name country state town n chris newzealand ghgg jkgj Can i get the headers If it is not possible Is there anyway to limit the number of details being displayed in each page //EDIT YOUR MySQL Connection Info: $DB_Server = "localhost"; //your MySQL Server $DB_Username = "root"; //your MySQL User Name $DB_Password = ""; //your MySQL Password $DB_DBName = "cms"; //your MySQL Database Name $DB_TBLName = ""; //your MySQL Table Name $sql = "SELECT (SELECT COUNT(*) FROM tblentercountry t2 WHERE t2.dbName <= t1.dbName and t1.dbIsDelete='0') AS SLNO ,dbName as Namee,t3.dbCountry as Country,t4.dbState as State,t5.dbTown as Town FROM tblentercountry t1 join tablecountry as t3, tablestate as t4, tabletown as t5 where t1.dbIsDelete='0' and t1.dbCountryId=t3.dbCountryId and t1.dbStateId=t4.dbStateId and t1.dbTownId=t5.dbTownId order by dbName limit 0,50"; //Optional: print out title to top of Excel or Word file with Timestamp //for when file was generated: //set $Use_Titel = 1 to generate title, 0 not to use title $Use_Title = 1; //define date for title: EDIT this to create the time-format you need //$now_date = DATE('m-d-Y H:i'); //define title for .doc or .xls file: EDIT this if you want $title = "Country"; /* Leave the connection info below as it is: just edit the above. (Editing of code past this point recommended only for advanced users.) */ //create MySQL connection $Connect = @MYSQL_CONNECT($DB_Server, $DB_Username, $DB_Password) or DIE("Couldn't connect to MySQL:" . MYSQL_ERROR() . "" . MYSQL_ERRNO()); //select database $Db = @MYSQL_SELECT_DB($DB_DBName, $Connect) or DIE("Couldn't select database:" . MYSQL_ERROR(). "" . MYSQL_ERRNO()); //execute query $result = @MYSQL_QUERY($sql,$Connect) or DIE("Couldn't execute query:" . MYSQL_ERROR(). "" . MYSQL_ERRNO()); //if this parameter is included ($w=1), file returned will be in word format ('.doc') //if parameter is not included, file returned will be in excel format ('.xls') IF (ISSET($w) && ($w==1)) { $file_type = "vnd.ms-excel"; $file_ending = "xls"; }ELSE { $file_type = "msword"; $file_ending = "doc"; } //header info for browser: determines file type ('.doc' or '.xls') HEADER("Content-Type: application/$file_type"); HEADER("Content-Disposition: attachment; filename=database_dump.$file_ending"); HEADER("Pragma: no-cache"); HEADER("Expires: 0"); /* Start of Formatting for Word or Excel */ IF (ISSET($w) && ($w==1)) //check for $w again { /* FORMATTING FOR WORD DOCUMENTS ('.doc') */ //create title with timestamp: IF ($Use_Title == 1) { ECHO("$title\n\n"); } //define separator (defines columns in excel & tabs in word) $sep = "\n"; //new line character WHILE($row = MYSQL_FETCH_ROW($result)) { //set_time_limit(60); // HaRa $schema_insert = ""; FOR($j=0; $j<mysql_num_fields($result);$j++) { //define field names $field_name = MYSQL_FIELD_NAME($result,$j); //will show name of fields $schema_insert .= "$field_name:\t"; IF(!ISSET($row[$j])) { $schema_insert .= "NULL".$sep; } ELSEIF ($row[$j] != "") { $schema_insert .= "$row[$j]".$sep; } ELSE { $schema_insert .= "".$sep; } } $schema_insert = STR_REPLACE($sep."$", "", $schema_insert); $schema_insert .= "\t"; PRINT(TRIM($schema_insert)); //end of each mysql row //creates line to separate data from each MySQL table row PRINT "\n----------------------------------------------------\n"; } }ELSE{ /* FORMATTING FOR EXCEL DOCUMENTS ('.xls') */ //create title with timestamp: IF ($Use_Title == 1) { ECHO("$title\n"); } //define separator (defines columns in excel & tabs in word) $sep = "\t"; //tabbed character //start of printing column names as names of MySQL fields FOR ($i = 0; $i < MYSQL_NUM_FIELDS($result); $i++) { ECHO MYSQL_FIELD_NAME($result,$i) . "\t"; } PRINT("\n"); //end of printing column names //start while loop to get data WHILE($row = MYSQL_FETCH_ROW($result)) { //set_time_limit(60); // HaRa $schema_insert = ""; FOR($j=0; $j<mysql_num_fields($result);$j++) { IF(!ISSET($row[$j])) $schema_insert .= "NULL".$sep; ELSEIF ($row[$j] != "") $schema_insert .= "$row[$j]".$sep; ELSE $schema_insert .= "".$sep; } $schema_insert = STR_REPLACE($sep."$", "", $schema_insert); //following fix suggested by Josue (thanks, Josue!) //this corrects output in excel when table fields contain \n or \r //these two characters are now replaced with a space $schema_insert = PREG_REPLACE("/\r\n|\n\r|\n|\r/", " ", $schema_insert); $schema_insert .= "\t"; PRINT(TRIM($schema_insert)); PRINT "\n"; } } ?

    Read the article

  • Android draw using SurfaceView and Thread

    - by Morten Høgseth
    I am trying to draw a ball to my screen using 3 classes. I have read a little about this and I found a code snippet that works using the 3 classes on one page, Playing with graphics in Android I altered the code so that I have a ball that is moving and shifts direction when hitting the wall like the picture below (this is using the code in the link). Now I like to separate the classes into 3 different pages for not making everything so crowded, everything is set up the same way. Here are the 3 classes I have. BallActivity.java Ball.java BallThread.java package com.brick.breaker; import android.app.Activity; import android.os.Bundle; import android.view.Window; import android.view.WindowManager; public class BallActivity extends Activity { private Ball ball; @Override protected void onCreate(Bundle savedInstanceState) { // TODO Auto-generated method stub super.onCreate(savedInstanceState); requestWindowFeature(Window.FEATURE_NO_TITLE); getWindow().setFlags(WindowManager.LayoutParams.FLAG_FULLSCREEN,WindowManager.LayoutParams.FLAG_FULLSCREEN); ball = new Ball(this); setContentView(ball); } @Override protected void onPause() { // TODO Auto-generated method stub super.onPause(); setContentView(null); ball = null; finish(); } } package com.brick.breaker; import android.content.Context; import android.graphics.Bitmap; import android.graphics.BitmapFactory; import android.graphics.Canvas; import android.view.SurfaceHolder; import android.view.SurfaceView; public class Ball extends SurfaceView implements SurfaceHolder.Callback { private BallThread ballThread = null; private Bitmap bitmap; private float x, y; private float vx, vy; public Ball(Context context) { super(context); // TODO Auto-generated constructor stub bitmap = BitmapFactory.decodeResource(getResources(), R.drawable.ball); x = 50.0f; y = 50.0f; vx = 10.0f; vy = 10.0f; getHolder().addCallback(this); ballThread = new BallThread(getHolder(), this); } protected void onDraw(Canvas canvas) { update(canvas); canvas.drawBitmap(bitmap, x, y, null); } public void update(Canvas canvas) { checkCollisions(canvas); x += vx; y += vy; } public void checkCollisions(Canvas canvas) { if(x - vx < 0) { vx = Math.abs(vx); } else if(x + vx > canvas.getWidth() - getBitmapWidth()) { vx = -Math.abs(vx); } if(y - vy < 0) { vy = Math.abs(vy); } else if(y + vy > canvas.getHeight() - getBitmapHeight()) { vy = -Math.abs(vy); } } public int getBitmapWidth() { if(bitmap != null) { return bitmap.getWidth(); } else { return 0; } } public int getBitmapHeight() { if(bitmap != null) { return bitmap.getHeight(); } else { return 0; } } public void surfaceChanged(SurfaceHolder holder, int format, int width, int height) { // TODO Auto-generated method stub } public void surfaceCreated(SurfaceHolder holder) { // TODO Auto-generated method stub ballThread.setRunnable(true); ballThread.start(); } public void surfaceDestroyed(SurfaceHolder holder) { // TODO Auto-generated method stub boolean retry = true; ballThread.setRunnable(false); while(retry) { try { ballThread.join(); retry = false; } catch(InterruptedException ie) { //Try again and again and again } break; } ballThread = null; } } package com.brick.breaker; import android.graphics.Canvas; import android.view.SurfaceHolder; public class BallThread extends Thread { private SurfaceHolder sh; private Ball ball; private Canvas canvas; private boolean run = false; public BallThread(SurfaceHolder _holder,Ball _ball) { sh = _holder; ball = _ball; } public void setRunnable(boolean _run) { run = _run; } public void run() { while(run) { canvas = null; try { canvas = sh.lockCanvas(null); synchronized(sh) { ball.onDraw(canvas); } } finally { if(canvas != null) { sh.unlockCanvasAndPost(canvas); } } } } public Canvas getCanvas() { if(canvas != null) { return canvas; } else { return null; } } } Here is a picture that shows the outcome of these classes. I've tried to figure this out but since I am pretty new to Android development I thought I could ask for help. Does any one know what is causing the ball to be draw like that? The code is pretty much the same as the one in the link and I have tried to experiment to find a solution but no luck. Thx in advance for any help=)

    Read the article

  • NOOB Memory Problem - EXC_BAD_ACCESS

    - by Michael Bordelon
    I have been banging my head against the wall for a couple days and need some help. I have a feeling that I am doing something really silly here, but I cannot find the issue. This is the controller for a table view. I put the SQL in line to simplify it as part of the troubleshooting of this error. Normally, it would be in an accessor method in a model class. It gets through the SQL read just fine. Finds the two objects, loads them into the todaysWorkout array and then builds the cells for the table view. The table view actually comes up on the scree and then it throws the EXC_BAD_ACCESS. I ran instruments and it shows the following: 0 CFString Malloc 1 00:03.765 0x3946470 176 Foundation -[NSPlaceholderString initWithFormat:locale:arguments:] 1 CFString Autorelease 00:03.765 0x3946470 0 Foundation NSRecordAllocationEvent 2 CFString CFRelease 0 00:03.767 0x3946470 0 Bring It -[WorkoutViewController viewDidLoad] 3 CFString Zombie -1 00:03.917 0x3946470 0 Foundation NSPopAutoreleasePool Here is the source code for the controller. I left it all in there just in case there is something extraneous causing the problem. I sincerely appreciate any help I can get: #import "WorkoutViewController.h" #import "MoveListViewController.h" #import "Profile.h" static sqlite3 *database = nil; @implementation WorkoutViewController @synthesize todaysWorkouts; @synthesize woNoteCell; @synthesize bi; //@synthesize woSwitchCell; - (void)viewDidLoad { [super viewDidLoad]; bi = [[BIUtility alloc] init]; todaysWorkouts = [[NSMutableArray alloc] init]; NSString *query; sqlite3_stmt *statement; //open the database if (sqlite3_open([[BIUtility getDBPath] UTF8String], &database) != SQLITE_OK) { sqlite3_close(database); NSAssert(0, @"Failed to opendatabase"); } query = [NSString stringWithFormat:@"SELECT IWORKOUT.WOINSTANCEID, IWORKOUT.WORKOUTID, CWORKOUTS.WORKOUTNAME FROM CWORKOUTS JOIN IWORKOUT ON IWORKOUT.WORKOUTID = CWORKOUTS.WORKOUTID AND DATE = '%@'", [BIUtility todayDateString]]; if (sqlite3_prepare_v2(database, [query UTF8String], -1, &statement, nil) == SQLITE_OK) { while (sqlite3_step(statement) == SQLITE_ROW) { Workout *wo = [[Workout alloc] init]; wo.woInstanceID = sqlite3_column_int(statement, 0); wo.workoutID = sqlite3_column_int(statement, 1); wo.workoutName = [NSString stringWithUTF8String:(char *)sqlite3_column_text(statement, 2)]; [todaysWorkouts addObject:wo]; [wo release]; } sqlite3_finalize(statement); } if(database) sqlite3_close(database); [query release]; } - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { //todaysWorkouts = [BIUtility todaysScheduledWorkouts]; static NSString *noteCellIdentifier = @"NoteCellIdentifier"; UITableViewCell *cell; if (indexPath.section < ([todaysWorkouts count])) { cell = [tableView dequeueReusableCellWithIdentifier:@"OtherCell"]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithFrame:CGRectZero reuseIdentifier: @"OtherCell"] autorelease]; cell.accessoryType = UITableViewCellAccessoryNone; } if (indexPath.row == 0) { Workout *wo = [todaysWorkouts objectAtIndex:indexPath.section]; [cell.textLabel setText:wo.workoutName]; } else { [cell.textLabel setText:@"Completed?"]; [cell.textLabel setFont:[UIFont fontWithName:@"Arial" size:15]]; [cell.textLabel setTextColor:[UIColor blueColor]]; } } else { cell = (NoteCell *)[tableView dequeueReusableCellWithIdentifier:noteCellIdentifier]; if (cell == nil) { NSArray *nib = [[NSBundle mainBundle] loadNibNamed:@"NoteCell" owner:self options:nil]; cell = [nib objectAtIndex:0]; } } return cell; //[cell release]; } - (void)tableView:(UITableView *)tableView didSelectRowAtIndexPath:(NSIndexPath *)indexPath { NSUInteger row = [indexPath row]; if (indexPath.section < ([todaysWorkouts count]) && (row == 0)) { MoveListViewController *moveListController = [[MoveListViewController alloc] initWithStyle:UITableViewStylePlain]; moveListController.workoutID = [[todaysWorkouts objectAtIndex:indexPath.section] workoutID]; moveListController.workoutName = [[todaysWorkouts objectAtIndex:indexPath.section] workoutName]; moveListController.woInstanceID = [[todaysWorkouts objectAtIndex:indexPath.section] woInstanceID]; NSLog(@"Workout Selected: %@", [[todaysWorkouts objectAtIndex:indexPath.section] workoutName]); Bring_ItAppDelegate *delegate = [[UIApplication sharedApplication] delegate]; [delegate.workoutNavController pushViewController:moveListController animated:YES]; } else { UITableViewCell *cell = [tableView cellForRowAtIndexPath:indexPath]; if (indexPath.section < ([todaysWorkouts count]) && (row == 1)) { if (cell.accessoryType == UITableViewCellAccessoryNone) { cell.accessoryType = UITableViewCellAccessoryCheckmark; } else { cell.accessoryType = UITableViewCellAccessoryNone; } } } [tableView deselectRowAtIndexPath:indexPath animated:YES]; } - (CGFloat)tableView:(UITableView *)tableView heightForRowAtIndexPath:(NSIndexPath *)indexPath { NSInteger h = 35; return h; } - (NSInteger)numberOfSectionsInTableView:(UITableView *)tableView { return ([todaysWorkouts count] + 1); //return ([todaysWorkouts count]); } - (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { if (section < ([todaysWorkouts count])) { return 2; } else { return 1; } } - (NSString *)tableView:(UITableView *)tableView titleForHeaderInSection:(NSInteger)section { if (section < ([todaysWorkouts count])) { return @"Workout"; } else { return @"How Was Your Workout?"; } } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { [super viewDidUnload]; // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } - (void)dealloc { [todaysWorkouts release]; [bi release]; [super dealloc]; } @end

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Dynamic scoping in Clojure?

    - by j-g-faustus
    Hi, I'm looking for an idiomatic way to get dynamically scoped variables in Clojure (or a similar effect) for use in templates and such. Here is an example problem using a lookup table to translate tag attributes from some non-HTML format to HTML, where the table needs access to a set of variables supplied from elsewhere: (def *attr-table* ; Key: [attr-key tag-name] or [boolean-function] ; Value: [attr-key attr-value] (empty array to ignore) ; Context: Variables "tagname", "akey", "aval" '( ; translate :LINK attribute in <a> to :href [:LINK "a"] [:href aval] ; translate :LINK attribute in <img> to :src [:LINK "img"] [:src aval] ; throw exception if :LINK attribute in any other tag [:LINK] (throw (RuntimeException. (str "No match for " tagname))) ; ... more rules ; ignore string keys, used for internal bookkeeping [(string? akey)] [] )) ; ignore I want to be able to evaluate the rules (left hand side) as well as the result (right hand side), and need some way to put the variables in scope at the location where the table is evaluated. I also want to keep the lookup and evaluation logic independent of any particular table or set of variables. I suppose there are similar issues involved in templates (for example for dynamic HTML), where you don't want to rewrite the template processing logic every time someone puts a new variable in a template. Here is one approach using global variables and bindings. I have included some logic for the table lookup: ;; Generic code, works with any table on the same format. (defn rule-match? [rule-val test-val] "true if a single rule matches a single argument value" (cond (not (coll? rule-val)) (= rule-val test-val) ; plain value (list? rule-val) (eval rule-val) ; function call :else false )) (defn rule-lookup [test-val rule-table] "looks up rule match for test-val. Returns result or nil." (loop [rules (partition 2 rule-table)] (when-not (empty? rules) (let [[select result] (first rules)] (if (every? #(boolean %) (map rule-match? select test-val)) (eval result) ; evaluate and return result (recur (rest rules)) ))))) ;; Code specific to *attr-table* (def tagname) ; need these globals for the binding in html-attr (def akey) (def aval) (defn html-attr [tagname h-attr] "converts to html attributes" (apply hash-map (flatten (map (fn [[k v :as kv]] (binding [tagname tagname akey k aval v] (or (rule-lookup [k tagname] *attr-table*) kv))) h-attr )))) (defn test-attr [] "test conversion" (prn "a" (html-attr "a" {:LINK "www.google.com" "internal" 42 :title "A link" })) (prn "img" (html-attr "img" {:LINK "logo.png" }))) user=> (test-attr) "a" {:href "www.google.com", :title "A link"} "img" {:src "logo.png"} This is nice in that the lookup logic is independent of the table, so it can be reused with other tables and different variables. (Plus of course that the general table approach is about a quarter of the size of the code I had when I did the translations "by hand" in a giant cond.) It is not so nice in that I need to declare every variable as a global for the binding to work. Here is another approach using a "semi-macro", a function with a syntax-quoted return value, that doesn't need globals: (defn attr-table [tagname akey aval] `( [:LINK "a"] [:href ~aval] [:LINK "img"] [:src ~aval] [:LINK] (throw (RuntimeException. (str "No match for " tagname))) ; ... more rules [(string? ~akey)] [] ))) Only a couple of changes are needed to the rest of the code: In rule-match?, when syntax-quoted the function call is no longer a list: - (list? rule-val) (eval rule-val) + (seq? rule-val) (eval rule-val) In html-attr: - (binding [tagname tagname akey k aval v] - (or (rule-lookup [k tagname] *attr-table*) kv))) + (or (rule-lookup [k tagname] (attr-table tagname k v)) kv))) And we get the same result without globals. (And without dynamic scoping.) Are there other alternatives to pass along sets of variable bindings declared elsewhere, without the globals required by Clojure's binding? Is there an idiomatic way of doing it, like Ruby's binding or Javascript's function.apply(context)?

    Read the article

  • Perl LWP::UserAgent mishandling UTF-8 response

    - by RedGrittyBrick
    When I use LWP::UserAgent to retrieve content encoded in UTF-8 it seems LWP::UserAgent doesn't handle the encoding correctly. Here's the output after setting the Command Prompt window to Unicode by the command chcp 65001 Note that this initially gives the appearance that all is well, but I think it's just the shell reassembling bytes and decoding UTF-8, From the other output you can see that perl itself is not handling wide characters correctly. C:\perl getutf8.pl ====================================================================== HTTP/1.1 200 OK Connection: close Date: Fri, 31 Dec 2010 19:24:04 GMT Accept-Ranges: bytes Server: Apache/2.2.8 (Win32) PHP/5.2.6 Content-Length: 75 Content-Type: application/xml; charset=utf-8 Last-Modified: Fri, 31 Dec 2010 19:20:18 GMT Client-Date: Fri, 31 Dec 2010 19:24:04 GMT Client-Peer: 127.0.0.1:80 Client-Response-Num: 1 <?xml version="1.0" encoding="UTF-8"? <nameBudejovický Budvar</name ====================================================================== response content length is 33 ....v....1....v....2....v....3....v....4 <nameBudejovický Budvar</name . . . . v . . . . 1 . . . . v . . . . 2 . . . . v . . . . 3 . . . . 3c6e616d653e427564c49b6a6f7669636bc3bd204275647661723c2f6e616d653e < n a m e B u d ? ? j o v i c k ? ? B u d v a r < / n a m e Above you can see the payload length is 31 characters but Perl thinks it is 33. For confirmation, in the hex, we can see that the UTF-8 sequences c49b and c3bd are being interpreted as four separate characters and not as two Unicode characters. Here's the code #!perl use strict; use warnings; use LWP::UserAgent; my $ua = LWP::UserAgent-new(); my $response = $ua-get('http://localhost/Bud.xml'); if (! $response-is_success) { die $response-status_line; } print '='x70,"\n",$response-as_string(), '='x70,"\n"; my $r = $response-decoded_content((charset = 'UTF-8')); $/ = "\x0d\x0a"; # seems to be \x0a otherwise! chomp($r); # Remove any xml prologue $r =~ s/^<\?.*\?\x0d\x0a//; print "Response content length is ", length($r), "\n\n"; print "....v....1....v....2....v....3....v....4\n"; print $r,"\n"; print ". . . . v . . . . 1 . . . . v . . . . 2 . . . . v . . . . 3 . . . . \n"; print unpack("H*", $r), "\n"; print join(" ", split("", $r)), "\n"; Note that Bud.xml is UTF-8 encoded without a BOM. How can I persuade LWP::UserAgent to do the right thing? P.S. Ultimately I want to translate the Unicode data into an ASCII encoding, even if it means replacing each non-ASCII character with one question mark or other marker. I have accepted Ysth's "upgrade" answer - because I know it is the right thing to do when possible. However I am going to use a work-around (which may depress Tom further): $r = encode("cp437", decode("utf8", $r));

    Read the article

  • Transaction issue in java with hibernate - latest entries not pulled from database

    - by Gearóid
    Hi, I'm having what seems to be a transactional issue in my application. I'm using Java 1.6 and Hibernate 3.2.5. My application runs a monthly process where it creates billing entries for a every user in the database based on their monthly activity. These billing entries are then used to create Monthly Bill object. The process is: Get users who have activity in the past month Create the relevant billing entries for each user Get the set of billing entries that we've just created Create a Monthly Bill based on these entries Everything works fine until Step 3 above. The Billing Entries are correctly created (I can see them in the database if I add a breakpoint after the Billing Entry creation method), but they are not pulled out of the database. As a result, an incorrect Monthly Bill is generated. If I run the code again (without clearing out the database), new Billing Entries are created and Step 3 pulls out the entries created in the first run (but not the second run). This, to me, is very confusing. My code looks like the following: for (User user : usersWithActivities) { createBillingEntriesForUser(user.getId()); userBillingEntries = getLastMonthsBillingEntriesForUser(user.getId()); createXMLBillForUser(user.getId(), userBillingEntries); } The methods called look like the following: @Transactional public void createBillingEntriesForUser(Long id) { UserManager userManager = ManagerFactory.getUserManager(); User user = userManager.getUser(id); List<AccountEvent> events = getLastMonthsAccountEventsForUser(id); BillingEntry entry = new BillingEntry(); if (null != events) { for (AccountEvent event : events) { if (event.getEventType().equals(EventType.ENABLE)) { Calendar cal = Calendar.getInstance(); Date eventDate = event.getTimestamp(); cal.setTime(eventDate); double startDate = cal.get(Calendar.DATE); double numOfDaysInMonth = cal.getActualMaximum(Calendar.DAY_OF_MONTH); double numberOfDaysInUse = numOfDaysInMonth - startDate; double fractionToCharge = numberOfDaysInUse/numOfDaysInMonth; BigDecimal amount = BigDecimal.valueOf(fractionToCharge * Prices.MONTHLY_COST); amount.scale(); entry.setAmount(amount); entry.setUser(user); entry.setTimestamp(eventDate); userManager.saveOrUpdate(entry); } } } } @Transactional public Collection<BillingEntry> getLastMonthsBillingEntriesForUser(Long id) { if (log.isDebugEnabled()) log.debug("Getting all the billing entries for last month for user with ID " + id); //String queryString = "select billingEntry from BillingEntry as billingEntry where billingEntry>=:firstOfLastMonth and billingEntry.timestamp<:firstOfCurrentMonth and billingEntry.user=:user"; String queryString = "select be from BillingEntry as be join be.user as user where user.id=:id and be.timestamp>=:firstOfLastMonth and be.timestamp<:firstOfCurrentMonth"; //This parameter will be the start of the last month ie. start of billing cycle SearchParameter firstOfLastMonth = new SearchParameter(); firstOfLastMonth.setTemporalType(TemporalType.DATE); //this parameter holds the start of the CURRENT month - ie. end of billing cycle SearchParameter firstOfCurrentMonth = new SearchParameter(); firstOfCurrentMonth.setTemporalType(TemporalType.DATE); Query query = super.entityManager.createQuery(queryString); query.setParameter("firstOfCurrentMonth", getFirstOfCurrentMonth()); query.setParameter("firstOfLastMonth", getFirstOfLastMonth()); query.setParameter("id", id); List<BillingEntry> entries = query.getResultList(); return entries; } public MonthlyBill createXMLBillForUser(Long id, Collection<BillingEntry> billingEntries) { BillingHistoryManager manager = ManagerFactory.getBillingHistoryManager(); UserManager userManager = ManagerFactory.getUserManager(); MonthlyBill mb = new MonthlyBill(); User user = userManager.getUser(id); mb.setUser(user); mb.setTimestamp(new Date()); Set<BillingEntry> entries = new HashSet<BillingEntry>(); entries.addAll(billingEntries); String xml = createXmlForMonthlyBill(user, entries); mb.setXmlBill(xml); mb.setBillingEntries(entries); MonthlyBill bill = (MonthlyBill) manager.saveOrUpdate(mb); return bill; } Help with this issue would be greatly appreciated as its been wracking my brain for weeks now! Thanks in advance, Gearoid.

    Read the article

  • if isset PHP not working?

    - by Ellie
    Okay, Im trying to set a captcha up, However with this code in, it breaks. if(isset($_POST["captcha"])) if($_SESSION["captcha"]==$_POST["captcha"]) When i do it with out it, the page works, but the captcha is letting incorrect submits through. Parse error: syntax error, unexpected '"', expecting T_STRING or T_VARIABLE or T_NUM_STRING in /hermes/waloraweb085/b2027/moo.lutarinet/jointest.php on line 71 <?php $pagetitle = "Home"; $checkrank = 0; include ($_SERVER['DOCUMENT_ROOT'].'/header.inc.php'); ECHO <<<END <br><br> <b><center><i><u>DO NOT</u> USE YOUR NEOPETS PASSWORD OR PIN NUMBER!!!</b></i></center> <p> ?> <?php session_start() ?> <center><P><FORM ACTION="join.pro.php" enctype="multipart/form-data" METHOD=POST> <table width="393" height="188" border="0" cellpadding="0" cellspacing="0"> <td width="150">Username</td> <td width="243"><input type=text name="name" value="" size=32 maxlength=15></td> </tr> <tr> <td>Password</td> <td><input type=password name="pass1" VALUE="" maxlength=15></td> </tr> <tr> <td>Confirm Password</td> <td><input type=password name="pass2" VALUE="" size=32 maxlength=15></td> </tr> <tr> <td>Security Code (4 Diget Number)</td> <td><input type=password name="security" VALUE="" size=32 maxlength=4></td> </tr> <tr> <td>Email Address</td> <td><INPUT TYPE=text NAME="email" VALUE="" SIZE=32 maxlength=100></td> </tr> <tr> <td height="41" colspan="2" valign="middle"><p><p><center> By registering an account here you agree to all of our <A HREF="$baseurl/tos.php">Terms and Conditions</A>. You can also view our <A HREF="$baseurl/privacy.php">Privacy Policy</A>. </center></p></td> </tr> <tr><td align="center">CAPTCHA:<br> (antispam code, 3 black symbols)<br> <table><tr><td><img src="captcha.php" alt="captcha image"></td><td><input type="text" name="captcha" size="3" maxlength="3"></td></tr></table> </td></tr> <td height="27" colspan="2" valign="middle"> <center><input type=submit name=Submit value="Register"></center> </td> </table> </form> <?php if(isset($_POST["captcha"])) if($_SESSION["captcha"]==$_POST["captcha"]) { //CAPTHCA is valid; proceed the message: save to database, send by e-mail ... echo 'CAPTHCA is valid; proceed the message'; } else { echo 'CAPTHCA is not valid; ignore submission'; } ?> <?php END; include ($_SERVER['DOCUMENT_ROOT'].'/footer.inc.php'); ?> captcha.php <?php session_start(); header("Expires: Mon, 26 Jul 1997 05:00:00 GMT"); header("Last-Modified: " . gmdate("D, d M Y H:i:s") . " GMT"); header("Cache-Control: no-store, no-cache, must-revalidate"); header("Cache-Control: post-check=0, pre-check=0", false); header("Pragma: no-cache"); function _generateRandom($length=6) { $_rand_src = array( array(48,57) //digits , array(97,122) //lowercase chars // , array(65,90) //uppercase chars ); srand ((double) microtime() * 1000000); $random_string = ""; for($i=0;$i<$length;$i++){ $i1=rand(0,sizeof($_rand_src)-1); $random_string .= chr(rand($_rand_src[$i1][0],$_rand_src[$i1][1])); } return $random_string; } $im = @imagecreatefromjpeg("http://sketchedneo.com/images/sitedesigns/captcha.jpg"); $rand = _generateRandom(3); $_SESSION['captcha'] = $rand; ImageString($im, 5, 2, 2, $rand[0]." ".$rand[1]." ".$rand[2]." ", ImageColorAllocate ($im, 0, 0, 0)); $rand = _generateRandom(3); ImageString($im, 5, 2, 2, " ".$rand[0]." ".$rand[1]." ".$rand[2], ImageColorAllocate ($im, 255, 0, 0)); Header ('Content-type: image/jpeg'); imagejpeg($im,NULL,100); ImageDestroy($im); ?> Help please anyone? Line 71: if(isset($_POST["captcha"])) Line 72: if($_SESSION["captcha"]==$_POST["captcha"])

    Read the article

  • Using C# to detect whether a filename character is considered international

    - by Morten Mertner
    I've written a small console application (source below) to locate and optionally rename files containing international characters, as they are a source of constant pain with most source control systems (some background on this below). The code I'm using has a simple dictionary with characters to look for and replace (and nukes every other character that uses more than one byte of storage), but it feels very hackish. What's the right way to (a) find out whether a character is international? and (b) what the best ASCII substitution character would be? Let me provide some background information on why this is needed. It so happens that the danish Å character has two different encodings in UTF-8, both representing the same symbol. These are known as NFC and NFD encodings. Windows and Linux will create NFC encoding by default but respect whatever encoding it is given. Mac will convert all names (when saving to a HFS+ partition) to NFD and therefore returns a different byte stream for the name of a file created on Windows. This effectively breaks Subversion, Git and lots of other utilities that don't care to properly handle this scenario. I'm currently evaluating Mercurial, which turns out to be even worse at handling international characters.. being fairly tired of these problems, either source control or the international character would have to go, and so here we are. My current implementation: public class Checker { private Dictionary<char, string> internationals = new Dictionary<char, string>(); private List<char> keep = new List<char>(); private List<char> seen = new List<char>(); public Checker() { internationals.Add( 'æ', "ae" ); internationals.Add( 'ø', "oe" ); internationals.Add( 'å', "aa" ); internationals.Add( 'Æ', "Ae" ); internationals.Add( 'Ø', "Oe" ); internationals.Add( 'Å', "Aa" ); internationals.Add( 'ö', "o" ); internationals.Add( 'ü', "u" ); internationals.Add( 'ä', "a" ); internationals.Add( 'é', "e" ); internationals.Add( 'è', "e" ); internationals.Add( 'ê', "e" ); internationals.Add( '¦', "" ); internationals.Add( 'Ã', "" ); internationals.Add( '©', "" ); internationals.Add( ' ', "" ); internationals.Add( '§', "" ); internationals.Add( '¡', "" ); internationals.Add( '³', "" ); internationals.Add( '­', "" ); internationals.Add( 'º', "" ); internationals.Add( '«', "-" ); internationals.Add( '»', "-" ); internationals.Add( '´', "'" ); internationals.Add( '`', "'" ); internationals.Add( '"', "'" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 147 } )[ 0 ], "-" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 148 } )[ 0 ], "-" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 153 } )[ 0 ], "'" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 166 } )[ 0 ], "." ); keep.Add( '-' ); keep.Add( '=' ); keep.Add( '\'' ); keep.Add( '.' ); } public bool IsInternationalCharacter( char c ) { var s = c.ToString(); byte[] bytes = Encoding.UTF8.GetBytes( s ); if( bytes.Length > 1 && ! internationals.ContainsKey( c ) && ! seen.Contains( c ) ) { Console.WriteLine( "X '{0}' ({1})", c, string.Join( ",", bytes ) ); seen.Add( c ); if( ! keep.Contains( c ) ) { internationals[ c ] = ""; } } return internationals.ContainsKey( c ); } public bool HasInternationalCharactersInName( string name, out string safeName ) { StringBuilder sb = new StringBuilder(); Array.ForEach( name.ToCharArray(), c => sb.Append( IsInternationalCharacter( c ) ? internationals[ c ] : c.ToString() ) ); int length = sb.Length; sb.Replace( " ", " " ); while( sb.Length != length ) { sb.Replace( " ", " " ); } safeName = sb.ToString().Trim(); string namePart = Path.GetFileNameWithoutExtension( safeName ); if( namePart.EndsWith( "." ) ) safeName = namePart.Substring( 0, namePart.Length - 1 ) + Path.GetExtension( safeName ); return name != safeName; } } And this would be invoked like this: FileInfo file = new File( "Århus.txt" ); string safeName; if( checker.HasInternationalCharactersInName( file.Name, out safeName ) ) { // rename file }

    Read the article

  • Hibernate without primary keys generated by db?

    - by Michael Jones
    I'm building a data warehouse and want to use InfiniDB as the storage engine. However, it doesn't allow primary keys or foreign key constraints (or any constraints for that matter). Hibernate complains "The database returned no natively generated identity value" when I perform an insert. Each table is relational, and contains a unique integer column that was previously used as the primary key - I want to keep that, but just not have the constraint in the db that the column is the primary key. I'm assuming the problem is that Hibernate expects the db to return a generated key. Is it possible to override this behaviour so I can set the primary key field's value myself and keep Hibernate happy? -- edit -- Two of the mappings are as follows: <?xml version="1.0"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <!-- Generated Jun 1, 2010 2:49:51 PM by Hibernate Tools 3.2.1.GA --> <hibernate-mapping> <class name="com.example.project.Visitor" table="visitor" catalog="orwell"> <id name="id" type="java.lang.Long"> <column name="id" /> <generator class="identity" /> </id> <property name="firstSeen" type="timestamp"> <column name="first_seen" length="19" /> </property> <property name="lastSeen" type="timestamp"> <column name="last_seen" length="19" /> </property> <property name="sessionId" type="string"> <column name="session_id" length="26" unique="true" /> </property> <property name="userId" type="java.lang.Long"> <column name="user_id" /> </property> <set name="visits" inverse="true"> <key> <column name="visitor_id" /> </key> <one-to-many class="com.example.project.Visit" /> </set> </class> </hibernate-mapping> and: <?xml version="1.0"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <!-- Generated Jun 1, 2010 2:49:51 PM by Hibernate Tools 3.2.1.GA --> <hibernate-mapping> <class name="com.example.project.Visit" table="visit" catalog="orwell"> <id name="id" type="java.lang.Long"> <column name="id" /> <generator class="identity" /> </id> <many-to-one name="visitor" class="com.example.project.Visitor" fetch="join" cascade="all"> <column name="visitor_id" /> </many-to-one> <property name="visitId" type="string"> <column name="visit_id" length="20" unique="true" /> </property> <property name="startTime" type="timestamp"> <column name="start_time" length="19" /> </property> <property name="endTime" type="timestamp"> <column name="end_time" length="19" /> </property> <property name="userAgent" type="string"> <column name="user_agent" length="65535" /> </property> <set name="pageViews" inverse="true"> <key> <column name="visit_id" /> </key> <one-to-many class="com.example.project.PageView" /> </set> </class> </hibernate-mapping>

    Read the article

  • incrementing in php

    - by Michael Stevens
    I have a function that works on other pages but on this particular page its not working 100% the piece of code that is failing to work is: $query = "SELECT * FROM rank_punting JOIN rank_player ON rank_player.full_name=rank_punting.name WHERE active='1' AND class='$class' ORDER BY ABS(`rank_punting`.`rank_final`) ASC"; $rank = 0; $lastpct = 0; $db->setQuery($query); $result = $db->query(); if(mysql_num_rows($result) > 0) { while($row = mysql_fetch_array($result, MYSQL_ASSOC)) { if ($row['rank_final'] > $lastpct) { $rank++; $lastpct = $row['rank_final']; } $name = $row['name']; $s1= $row['s1']; $s2= $row['s2']; $s3= $row['s3']; $s4= $row['s4']; $s5= $row['s5']; $s6= $row['s6']; $s7= $row['s7']; $s8= $row['s8']; $s9= $row['s9']; $c1= $row['c1']; $c2= $row['c2']; $c3= $row['c3']; $c4= $row['c4']; $c5= $row['c5']; $c6= $row['c6']; $v1= $row['v1']; $v2= $row['v2']; $comp= $row['comp_rank_final']; $season= $row['season_rank_final']; $final=$row['rank_final']; $link = "website_url"; $link2 = "<a href=\"http://{$link}\" target='_blank'>{$name}<br>Profile Page</a>"; if ($link = ''){$link2 = "<a href='index.php?option=com_ranking&view=playerprofile&player={$name}' >{$name}<br>Profile Page</a>";} echo '<tr>'; echo " <th scope'row'>{$link2} {$lastpct} </th>"; echo "<td>"; echo 'DEBUG: '; echo $row['rank_final']; echo $lastpct;echo "{$rank}</td>"; echo "<td> Competition</td>"; echo "<td> {$comp}</td>"; echo "<td> {$c1}</td>"; echo "<td> {$c2}</td>"; echo "<td> {$c3}</td>"; echo "<td> {$c4}</td>"; echo "<td> {$c5}</td>"; echo "<td> {$c6}</td>"; echo "<td> {$c7}</td>"; echo "<td> {$c8}</td>"; echo "<td> {$v2}</td>"; echo "</tr>"; echo '<tr>'; echo "<th scope'row'> </th>"; echo "<td> </td>"; echo "<td> Game Film</td>"; echo "<td> {$season}</td>"; echo "<td> {$s1}</td>"; echo "<td> {$s2}</td>"; echo "<td> {$s3}</td>"; echo "<td> {$s4}</td>"; echo "<td> {$s5}</td>"; echo "<td> {$s7}</td>"; echo "<td> {$s8}</td>"; echo "<td> {$s6}</td>"; echo "<td> {$v1}</td>"; echo "</tr>"; } } //---------------- echo '</tbody> </table>'; }

    Read the article

< Previous Page | 455 456 457 458 459 460 461 462  | Next Page >