Search Results

Search found 18803 results on 753 pages for 'link to'.

Page 469/753 | < Previous Page | 465 466 467 468 469 470 471 472 473 474 475 476  | Next Page >

  • Load balanced proxies to avoid an API request limit

    - by ClickClickClick
    There is a certain API out there which limits the number of requests per day per IP. My plan is to create a bunch of EC2 instances with elastic IPs to sidestep the limitation. I'm familiar with EC2 and am just interested in the configuration of the proxies and a software load balancer. I think I want to run a simple TCP Proxy on each instance and a software load balancer on the machine I will be requesting from. Something that allows the following to return a response from a different IP (round robin, availability, doesn't really matter..) eg. curl http://www.bbc.co.uk -x http://myproxyloadbalancer:port Could anyone recommend a combination of software or even a link to an article that details a pleasing way to pull it off? (My client won't be curl but is proxy aware.. I'll be making the requests from a Ruby script..)

    Read the article

  • Setup Web Applications on Cisco ASA 9.1

    - by Scott
    I've been looking around the Cisco ASA administration screen with our network admin and haven't found the location where Web Applications can be setup. This seems like it should be a pretty straight forward procedure, especially if I just want to add a global application and not segment out by groups. I've looked through the docs, but they are a mess and answer most questions except for this. If you're going to post a RTFM answer, at least please provide link and location because I have looked. This is the location I'm looking to setup web applications on the clientless web VPN.

    Read the article

  • Little server for a little network: Asus TS Mini + Windows Home Server or other?

    - by microspino
    Hello, I'm building a little network with 4 computer a plotter, 3 printers an a HP Fax/Scan/Copy/Print machine. The network is connected to the web by a D-Link router/firewall. I would like to add little server to have file sharing (reachable via VPN from outside by a single user-road-warrior), automatic backups. I would like to avoid big electrics bills or, to say It in a green way, I would like to avoid useless power consumption made by a big server with hot-plug, Raid, double PSU because I don't need all this stuff. The server must work 24/7 and the budget is between 400€ and 1000€. I'm evaluating the Asus EEE Box (with XP), a TranquilPC (with XP), a FitPC (again with XP), and an Asus TS Mini (with Windows Home Server). I like the latter but since I'm Europe I don't know where I can buy It. Do you have any suggestion/experience to share with me about: which hardware do I have to buy ? which O.S. ?

    Read the article

  • Proper way to do texture mapping in modern OpenGL?

    - by RubyKing
    I'm trying to do texture mapping using OpenGL 3.3 and GLSL 150. The problem is the texture shows but has this weird flicker I can show a video here. My texcords are in a vertex array. I have my fragment color set to the texture values and texel values. I have my vertex shader sending the texture cords to texture cordinates to be used in the fragment shader. I have my ins and outs setup and I still don't know what I'm missing that could be causing that flicker. Here is my code: Fragment shader #version 150 uniform sampler2D texture; in vec2 texture_coord; varying vec3 texture_coordinate; void main(void) { gl_FragColor = texture(texture, texture_coord); } Vertex shader #version 150 in vec4 position; out vec2 texture_coordinate; out vec2 texture_coord; uniform vec3 translations; void main() { texture_coord = (texture_coordinate); gl_Position = vec4(position.xyz + translations.xyz, 1.0); } Last bit Here is my vertex array with texture coordinates: GLfloat vVerts[] = { 0.5f, 0.5f, 0.0f, 0.0f, 1.0f, 0.0f, 0.5f, 0.0f, 1.0f, 1.0f, 0.0f, 0.0f, 0.0f, 0.0f, 0.0f, 0.5f, 0.0f, 0.0f, 1.0f, 0.0f}; //tex x and y If you need to see all the code, here is a link to every file. Thank you for your help.

    Read the article

  • 1 ASPX Page, Multiple Master Pages

    - by csmith18119
    So recently I had an ASPX page that could be visited by two different user types.  User type A would use Master Page 1 and user type B would use Master Page 2.  So I put together a proof of concept to see if it was possible to change the MasterPage in code.  I found a great article on the Microsoft ASP.net website. Specifying the Master Page Programmatically (C#) by Scott Mitchell So I created a MasterPage call Alternate.Master to act as a generic place holder.  I also created a Master1.Master and a Master2.Master.  The ASPX page, Default.aspx will use this MasterPage.  It will also use the Page_PreInit event to programmatically set the MasterPage.  1: protected void Page_PreInit(object sender, EventArgs e) { 2: var useMasterPage = Request.QueryString["use"]; 3: if (useMasterPage == "1") 4: MasterPageFile = "~/Master1.Master"; 5: else if (useMasterPage == "2") 6: MasterPageFile = "~/Master2.Master"; 7: }   In my Default.aspx page I have the following links in the markup: 1: <p> 2: <asp:HyperLink runat="server" ID="cmdMaster1" NavigateUrl="~/Default.aspx?use=1" Text="Use Master Page 1" /> 3: </p> 4: <p> 5: <asp:HyperLink runat="server" ID="cmdMaster2" NavigateUrl="~/Default.aspx?use=2" Text="Use Master Page 2" /> 6: </p> So the basic idea is when a user clicks the HyperLink to use Master Page 1, the default.aspx.cs code behind will set the property MasterPageFile to use Master1.Master.  The same goes with the link to use Master Page 2.  It worked like a charm!  To see the actual code, feel free to download a copy here: Project Name: Skyhook.MultipleMasterPagesWeb http://skyhookprojectviewer.codeplex.com

    Read the article

  • Upload from URL to FTP server

    - by Bibhas
    Ok, I have a tar.gz file somewhere in a web server. The link looks like http://abcd.com/abcd.tar.gz .. And I have an FTP server running somewhere. Now, to upload the file to the FTP server, Typically I need to download it from the web server and then upload it again to the FTP server. But I'm wondering if there is anyway, I can directly transfer the file to the FTP server over the web. Not by downloading and uploading again. Any help?

    Read the article

  • moving my site, IP change worries...

    - by Sherif Buzz
    Hi all, my site has outgrown the shared hosting account it's on and i've setup a VPS that i'll be moving to soon. I cannot keep the same IP between my new account and the old one and I'm a bit at loss as to how to minimize user downtime while the new IP is reflected in all DNS caches. Note I cannot have the site running on both accounts at the same time as it's a dating site and this would cause data inconsistency. Here's what i am planning to do : Put up a 'under maintenance' page on old host Get the site up and running on new host, and update domain to point to new host. Hope downtime isn't too long. Would it be a good idea to have a link on the page in (1) that opens the new site but using it's ip ? Or even redirect all requests at the old host, to the new one (again by ip) ? Any advice much appreciated.

    Read the article

  • How to work with processes?

    - by Viesturs
    I have seen similar questions here, but I didn't get my answer. Maybe it's because I am new to all this and just don't understand. I want my app to work mostly as an indicator. And if user would start it again it would check if it is already running, if it is then give all the input data to that process and quit. So first I need to check if it is running. I saw the answer where you can make a file witch when the program starts and then check if it exists... But what if someone would delete it? Can't I just ask the OS if there is process named "myApp" or something? The next thing I don't really get is how to communicate with the process. How do I give it the input data and what is it going to do with it? Does it work just like starting a new app, through the main() method? I am trying to create this using Quickly. So it would be nice if you can give me some python examples or link to something like that.

    Read the article

  • QNAP TS-419p as a VPN Gateway?

    - by heisenberg
    Hello, I am hoping one of you might be able to help. I want to make files stored on shared folders on a QNAP TS-409p available to users over a VPN link. How is the possible? Can someone explain what I need to do. What do I need to do at the router and what do I need to do on the QNAP NAS? Effectively, what I want do do is use the built in Windows vpn client to connect to my home network and then be able to browse the shared folders. Thanks in advance.

    Read the article

  • Problem accessing the remote working space on my new SBS 2008 box

    - by Dabblernl
    This supposedly easy to install OS is starting to drive me nuts... SYMPTOMS: When trying to connect to the remote workplace I get (and ignore) the security warning because I am currently testing with the self issued certificate. After loggin in the remote workplace's main screen displays but the images on it do not load. When I try to click the email link I am thrown back to the login screen. If I try the login to exchange directly by typing in the remote.mydomain.com/owa address I get a 403 error that I am denied access. The problem occurs on both a vista and a win 7 machine. It seems that some security setting is playing tricks with me. How can I troubleshoot this?

    Read the article

  • Trouble getting PHP, Apache, and Zend talking to eachother (localhost)

    - by Joel
    Hi guys, I've searched through several other questions, but haven't found my solution. THe main reason is that I'm not even sure if I have all these things properly installed. I have a hosting account, and have always just deployed everything into the internets, but I'm finally trying to figure out how to get my desktop set up right for learning Zend Framework. I have Apache Server 2.2, PHP, And Zend Framework installed. I'm trying to do this tutorial: http://akrabat.com/wp-content/uploads/Getting-Started-with-Zend-Framework.pdf The problem is when I click on the link: http://localhost/zf-tutorial/public I get an Error 404. If I type in http://www.localhost I get "It Works!" in the browser. I'm thinking this means I have Apache installed correctly, but am not pointing correctly to the Zend tutorial? Thanks for any help!

    Read the article

  • Remote desktop connection over internet without port forwarding?

    - by hellbell.myopenid.com
    Hello, let's say that we have this situation. I want to remote desktop connection to my friend over the internet, but I don't have premission for port forwarding on the router, and my friend also can't configure his router. So the question is how to connect to computer without port forwarding, I know that is out there some programs like teamviewer, or some else that solve that task, but what I looking for is the some free site that can make "bridge" between are two computer, or is it possible to install on computer some program that simulate virtual router or something like this http://www.youtube.com/watch?v=SIof7kFTgJE .... I need this cause I have my own simple remote desktop connection program, but I can't connect to other computer outside network cause don't have premission to configure router :( any comment, link, advice, or tutorials will be very helpful :)

    Read the article

  • How to monitor nginx proxy cache?

    - by Isaac
    I would like to see which objects get cached by my nginx reverse proxy (with an apache as a backend). So far I could not find a way, only the info that its not implemented yet. The reason is that I would like to tweak my configuration for best performance without putting too much stress on the server, as the backend is a production system. I know benchmarking would be better, but its not an option right now. So I though an alternative measure would be to monitor the cache. Is that possible, and if yes, how? (despite patching nginx with the patch mentioned in the link above)

    Read the article

  • Is Apache ReverseProxy to Passenger Standalone an acceptable production deployment?

    - by davetron5000
    I have the need to deploy Rails 3 apps, using RVM and gemsets, and am expecting “public” traffic (i.e. this is not an internal-only app). I also must use Apache as the public interface to my app. I understand that Passenger Standalone can help accomplish the rails/RVM end, and I have successfully set it up in my development environment. My question is how viable this setup is for a production deployment. Is deploying via Apache configured to ReverseProxy to my passenger-powered Rails app going to create problems? Since I'm designing the production deployment now, I want to understand if I should spend the additional time to set up Passenger connected to Apache and have that Passenger communicate with Passenger Standalone instance running my Rails app. So, I'm looking for one of I guess three answers: Apache Reverse Proxy to Passenger Standalone will be generally fine You should not use the Apache/Passenger Standalone configuration, but set up Passenger on the Apache side as well Your entire setup is just Wrong, please RTFM (and include link to "FM")

    Read the article

  • Redirection & SEO related stuff while moving to a new blog

    - by Karshim Kanwar
    I have a WordPress blog and recently I have setup a new blog lets call the old blog as blog old and new blog as blog new. What I did is moved the content, photos, pictures and all 250 posts from blog old to blog new. Both the blog name are changed as they are pointing to different domain names! I read helpful things in this site itself at here. I will no longer use blog old, moreover I am concerned about the SEO of the blog new. The blog new is fairly new (just 24 hours and no pages have been indexed in Google). I have done the following stuff: Deleted all the post share at Facebook fan Page, Twitter profile, Google+ page and Finally deleted the fan page/Twitter, Google+ page. Edited the link backs of old blog in the blog new. The question I have is: How do I prevent duplicate content issues? Do I go straightaway and delete all the posts in blog old? Should I start sharing the blog posts in blog new? Should I submit the new site to Webmaster Tools or wait for few weeks? Every comment here is appreciated! What issues can I face relating to SEO?

    Read the article

  • Firefox 11 Bookmarks Toolbar too Tall

    - by tba
    After updating to Firefox 11, my Bookmarks Toolbar is unpleasantly tall. This link implies that it's due to the presence of separators in my toolbar. I tried adding the suggested CSS in post 5 to my userChrome.css file, but this did nothing. I have also tried #PersonalToolbar {max-height:10px !important;} But this simply truncates the bottom of the toolbar. Does anyone know how to change the size of the bookmarks toolbar to match Firefox 10? More info: Here is a screenshot of my Bookmarks Toolbar. I'm using OSX 10.6.8 with the default theme. I have "View Toolbars Customize Use small icons" enabled. I'm also using the LiveClick 0.4.2.0 extension, but disabling it does not fix the issue.

    Read the article

  • why page is automatically redirecting to some other sites

    - by raj
    In my browser (Firefox 10.0.7) the page is automatically redirect to some other sites without clicking any link. If I enter the superuser.com url after pressing Enter button, It redirect to some other sites. sometimes while refreshing also the page is redirect to some other site. It's redirecting to this sites http://result.seenfind.com/ncp/Default.aspx?term=gatlinburg%20cabin&u=1000670913 http://search.cpvee.com/search.php?q=gatlinburg+cabin&y=&f=2168&s= http://www.insidecelebritygossip.com/ I cleared all history and all but still same problem. I am using CentOS 6.3

    Read the article

  • South Florida Code Camp and Other Events

    - by MOSSLover
    My grandmother wanted me to make her a video when she heard I got MVP in SharePoint Server of one of my sessions.  I decided I haven’t visited in two years, so maybe I can do an in person session.  I googled around and found South Florida Code Camp, which will be Saturday, February 12th.  I will be doing a session at 9:50 in the morning on Silverlight just for my grandmother and whoever shows up.  Here is the link for more information: http://www.fladotnet.com/codecamp/. In the upcoming months I plan to return to SharePoint Saturday speaking.  We are also organizing another New York event on Saturday, July 30th.  We will open up submissions for sponsors and speakers somewhere after Best Practices Conference in LaJolla.  I will be speaking at Best Practices LaJolla and the The Expert’s Conference in the upcoming months.  I am really sorry for the lack of updates it’s just been incredibly crazy going back and forth to DC and not having internet on weekdays or having the slowest internet in the world has just not helped.  I am also trying to attend Coders 4 Charity this year, so I can visit some people in St. Louis.  I’ve already got an incredibly crazy schedule going for the year.  I might be helping organize more events.  I’m going to volunteer at New York Code Camp too doing whatever they need this year.  Check back for more updates. Technorati Tags: SharePoint Conferences 2011,Events 2011

    Read the article

  • My Router is fast when i reset it but slows down seconds later

    - by hglocke
    I have a Belkin N wireless router which until recently worked perfectly fine. Now i have to reset the router every few minutes, otherwise it slows down to a crawl. What can I do? I have tried turning the routers firewall off, but it does not make any difference. As far as I'm aware there have been no recent firmware updates. EDIT: The other devices on my network (laptop and iphone) do not have this problem. I connect to the router using a TP-Link wireless network card and I have already tried uninstalling and installing the driver. Hopefully this will narrow down the problem significantly.

    Read the article

  • Computer freezes, wireless network icon disappears

    - by Heidi
    As you can see I have two problems. I have a Toshiba Tecra A3 computer. It is 5-6 years old and it is connected to a D-link router. For a period now it has not been working correctly. The computer freezes either when i try turning it on or when I have been using the computer for a short period of time. The times the computer works normally I have a problem with a disappearing wireless network icon, and so I have no internet. Can this be fixed or do I have to buy a new computer? I only use the computer for internet surfing and easy tasks like word etc, so I would like to keep it as long as possible.

    Read the article

  • How can I prevent JungleDisk/MacOS X (10.6) creating a local volume for a removed external drive?

    - by Rew
    Ok, here is situation: I use JungleDisk to sync an online folder on to a external drive connected to my Mac. If I right click Finder, click Go to Folder... then type /Volumes/ I see the drive linked here. Once I remove the external drive, an actual folder is created here in the name of the external drive, JungleDisk continues to copy files to this folder, rather than stop. Is this a feature of Mac OS X? Can I turn if off? After I re-connect my external drive, the link to the drive is appended with a 1 (so if I called the drive SpareDrive it becomes SpareDrive 1 as the newly created folder is called SpareDrive. I realise my explanation isn't very clear, but anyone understand this, and knows how to prevent it happening please let me know. PS: I have a low reputation as I don't use this often, I tend to use stackoverflow, but will check back here for answers.

    Read the article

  • Show and Tell: What work are you the most proud of? [closed]

    - by dannywartnaby
    Hey, In the spirit of building community, and because it's always cool to see great work being pushed out and created by people, anyone up for a little show and tell? The rules are really simple, and this is supposed to be a bit of fun, so; post a link to a single piece of work (anything you've produced, designed or developed (or helped developed)) and write a little paragraph or two on what it is, what you like about it, the technology you used and perhaps one thing that you learnt from the project. It could be a website, framework, open source project, game, mobile application... etc. So, allow me to start. I'm personally very proud of a tiny iPhone application I designed and developed. It's only available to UK AppStore users, and I only have a small userbase, but, I like it. The application is called Sushi Total: http://knowledgeisporridge.com/sushitotal.html It's written in Objective-C. It's a very simply application that allows you to total up your bill at Yo Sushi restaurants by tapping coloured plates. If I learnt anything from making this application it's this: I believe software should be simple and uncluttered, and that producing an application with one feature is absolutely fine as long as it works really well. So, who's next?

    Read the article

  • mod_rewrite hide subdirectory in return url part2

    - by user64790
    Hi I am having an issue trying to get my mod_rewrite configuration correctly i have a site: 0.0.0.0/oldname/directories/index.php I would like to rename "oldname" to "newname" resulting in: 0.0.0.0/newname/directories/index.php etc.. So when a user navigates to 0.0.0.0 my site will automatically send them to 0.0.0.0/oldname/index.php I'm not planning on moving my content marketing have asked me to rename the site folder I would like to mask the request of 0.0.0.0/oldname/index.php to 0.0.0.0/newname/index.php Also if a user navigates from index.php to an link of say /oldname/project1/index.Php the final browsers returned URL will be /newname/project1.php without having to move or edit site links. I also understand my hyperlinks will refer to /oldname but this is acceptable any help would be highly appreciated. Regards

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • What is your approach to draw a representation of your network ?

    - by Kartoch
    Hello, I'm looking to the community to see how people are drawing their networks, i.e. using symbols to represent complex topology. You can have hardware approach, where every hardware unit are represented. You can also have "entity" approach, where each "service" is shown. Both are interesting but it is difficult to have both on the same schema (but this is needed, especially using virtualization environment). Furthermore, it is difficult to have complex informations on such representation. For instance security parameters (encrypted link, need for authentication) or specific details (protocol type, ports, encapsulation). So my question is: where your are drawing a representation of your network, what is your approach ? Are you using methodology and/or specific softwares ? What is your recommendations for information to put (or not) ? How to deal with the complexity when the network becomes large and/or you want to put a lot of information on it ? Examples and links to good references will be appreciated.

    Read the article

< Previous Page | 465 466 467 468 469 470 471 472 473 474 475 476  | Next Page >