Search Results

Search found 18961 results on 759 pages for 'tp link'.

Page 477/759 | < Previous Page | 473 474 475 476 477 478 479 480 481 482 483 484  | Next Page >

• Trouble getting PHP, Apache, and Zend talking to eachother (localhost)

  - by Joel

  Hi guys, I've searched through several other questions, but haven't found my solution. THe main reason is that I'm not even sure if I have all these things properly installed. I have a hosting account, and have always just deployed everything into the internets, but I'm finally trying to figure out how to get my desktop set up right for learning Zend Framework. I have Apache Server 2.2, PHP, And Zend Framework installed. I'm trying to do this tutorial: http://akrabat.com/wp-content/uploads/Getting-Started-with-Zend-Framework.pdf The problem is when I click on the link: http://localhost/zf-tutorial/public I get an Error 404. If I type in http://www.localhost I get "It Works!" in the browser. I'm thinking this means I have Apache installed correctly, but am not pointing correctly to the Zend tutorial? Thanks for any help!

  Read the article

• Problem accessing the remote working space on my new SBS 2008 box

  - by Dabblernl

  This supposedly easy to install OS is starting to drive me nuts... SYMPTOMS: When trying to connect to the remote workplace I get (and ignore) the security warning because I am currently testing with the self issued certificate. After loggin in the remote workplace's main screen displays but the images on it do not load. When I try to click the email link I am thrown back to the login screen. If I try the login to exchange directly by typing in the remote.mydomain.com/owa address I get a 403 error that I am denied access. The problem occurs on both a vista and a win 7 machine. It seems that some security setting is playing tricks with me. How can I troubleshoot this?

  Read the article

• Is Apache ReverseProxy to Passenger Standalone an acceptable production deployment?

  - by davetron5000

  I have the need to deploy Rails 3 apps, using RVM and gemsets, and am expecting “public” traffic (i.e. this is not an internal-only app). I also must use Apache as the public interface to my app. I understand that Passenger Standalone can help accomplish the rails/RVM end, and I have successfully set it up in my development environment. My question is how viable this setup is for a production deployment. Is deploying via Apache configured to ReverseProxy to my passenger-powered Rails app going to create problems? Since I'm designing the production deployment now, I want to understand if I should spend the additional time to set up Passenger connected to Apache and have that Passenger communicate with Passenger Standalone instance running my Rails app. So, I'm looking for one of I guess three answers: Apache Reverse Proxy to Passenger Standalone will be generally fine You should not use the Apache/Passenger Standalone configuration, but set up Passenger on the Apache side as well Your entire setup is just Wrong, please RTFM (and include link to "FM")

  Read the article

• Remote desktop connection over internet without port forwarding?

  - by hellbell.myopenid.com

  Hello, let's say that we have this situation. I want to remote desktop connection to my friend over the internet, but I don't have premission for port forwarding on the router, and my friend also can't configure his router. So the question is how to connect to computer without port forwarding, I know that is out there some programs like teamviewer, or some else that solve that task, but what I looking for is the some free site that can make "bridge" between are two computer, or is it possible to install on computer some program that simulate virtual router or something like this http://www.youtube.com/watch?v=SIof7kFTgJE .... I need this cause I have my own simple remote desktop connection program, but I can't connect to other computer outside network cause don't have premission to configure router :( any comment, link, advice, or tutorials will be very helpful :)

  Read the article

• Computer freezes, wireless network icon disappears

  - by Heidi

  As you can see I have two problems. I have a Toshiba Tecra A3 computer. It is 5-6 years old and it is connected to a D-link router. For a period now it has not been working correctly. The computer freezes either when i try turning it on or when I have been using the computer for a short period of time. The times the computer works normally I have a problem with a disappearing wireless network icon, and so I have no internet. Can this be fixed or do I have to buy a new computer? I only use the computer for internet surfing and easy tasks like word etc, so I would like to keep it as long as possible.

  Read the article

• How to monitor nginx proxy cache?

  - by Isaac

  I would like to see which objects get cached by my nginx reverse proxy (with an apache as a backend). So far I could not find a way, only the info that its not implemented yet. The reason is that I would like to tweak my configuration for best performance without putting too much stress on the server, as the backend is a production system. I know benchmarking would be better, but its not an option right now. So I though an alternative measure would be to monitor the cache. Is that possible, and if yes, how? (despite patching nginx with the patch mentioned in the link above)

  Read the article

• Redirection & SEO related stuff while moving to a new blog

  - by Karshim Kanwar

  I have a WordPress blog and recently I have setup a new blog lets call the old blog as blog old and new blog as blog new. What I did is moved the content, photos, pictures and all 250 posts from blog old to blog new. Both the blog name are changed as they are pointing to different domain names! I read helpful things in this site itself at here. I will no longer use blog old, moreover I am concerned about the SEO of the blog new. The blog new is fairly new (just 24 hours and no pages have been indexed in Google). I have done the following stuff: Deleted all the post share at Facebook fan Page, Twitter profile, Google+ page and Finally deleted the fan page/Twitter, Google+ page. Edited the link backs of old blog in the blog new. The question I have is: How do I prevent duplicate content issues? Do I go straightaway and delete all the posts in blog old? Should I start sharing the blog posts in blog new? Should I submit the new site to Webmaster Tools or wait for few weeks? Every comment here is appreciated! What issues can I face relating to SEO?

  Read the article

• why page is automatically redirecting to some other sites

  - by raj

  In my browser (Firefox 10.0.7) the page is automatically redirect to some other sites without clicking any link. If I enter the superuser.com url after pressing Enter button, It redirect to some other sites. sometimes while refreshing also the page is redirect to some other site. It's redirecting to this sites http://result.seenfind.com/ncp/Default.aspx?term=gatlinburg%20cabin&u=1000670913 http://search.cpvee.com/search.php?q=gatlinburg+cabin&y=&f=2168&s= http://www.insidecelebritygossip.com/ I cleared all history and all but still same problem. I am using CentOS 6.3

  Read the article

• Firefox 11 Bookmarks Toolbar too Tall

  - by tba

  After updating to Firefox 11, my Bookmarks Toolbar is unpleasantly tall. This link implies that it's due to the presence of separators in my toolbar. I tried adding the suggested CSS in post 5 to my userChrome.css file, but this did nothing. I have also tried #PersonalToolbar {max-height:10px !important;} But this simply truncates the bottom of the toolbar. Does anyone know how to change the size of the bookmarks toolbar to match Firefox 10? More info: Here is a screenshot of my Bookmarks Toolbar. I'm using OSX 10.6.8 with the default theme. I have "View Toolbars Customize Use small icons" enabled. I'm also using the LiveClick 0.4.2.0 extension, but disabling it does not fix the issue.

  Read the article

• How can I prevent JungleDisk/MacOS X (10.6) creating a local volume for a removed external drive?

  - by Rew

  Ok, here is situation: I use JungleDisk to sync an online folder on to a external drive connected to my Mac. If I right click Finder, click Go to Folder... then type /Volumes/ I see the drive linked here. Once I remove the external drive, an actual folder is created here in the name of the external drive, JungleDisk continues to copy files to this folder, rather than stop. Is this a feature of Mac OS X? Can I turn if off? After I re-connect my external drive, the link to the drive is appended with a 1 (so if I called the drive SpareDrive it becomes SpareDrive 1 as the newly created folder is called SpareDrive. I realise my explanation isn't very clear, but anyone understand this, and knows how to prevent it happening please let me know. PS: I have a low reputation as I don't use this often, I tend to use stackoverflow, but will check back here for answers.

  Read the article

• South Florida Code Camp and Other Events

  - by MOSSLover

  My grandmother wanted me to make her a video when she heard I got MVP in SharePoint Server of one of my sessions.  I decided I haven’t visited in two years, so maybe I can do an in person session.  I googled around and found South Florida Code Camp, which will be Saturday, February 12th.  I will be doing a session at 9:50 in the morning on Silverlight just for my grandmother and whoever shows up.  Here is the link for more information: http://www.fladotnet.com/codecamp/. In the upcoming months I plan to return to SharePoint Saturday speaking.  We are also organizing another New York event on Saturday, July 30th.  We will open up submissions for sponsors and speakers somewhere after Best Practices Conference in LaJolla.  I will be speaking at Best Practices LaJolla and the The Expert’s Conference in the upcoming months.  I am really sorry for the lack of updates it’s just been incredibly crazy going back and forth to DC and not having internet on weekdays or having the slowest internet in the world has just not helped.  I am also trying to attend Coders 4 Charity this year, so I can visit some people in St. Louis.  I’ve already got an incredibly crazy schedule going for the year.  I might be helping organize more events.  I’m going to volunteer at New York Code Camp too doing whatever they need this year.  Check back for more updates. Technorati Tags: SharePoint Conferences 2011,Events 2011

  Read the article

• Show and Tell: What work are you the most proud of? [closed]

  - by dannywartnaby

  Hey, In the spirit of building community, and because it's always cool to see great work being pushed out and created by people, anyone up for a little show and tell? The rules are really simple, and this is supposed to be a bit of fun, so; post a link to a single piece of work (anything you've produced, designed or developed (or helped developed)) and write a little paragraph or two on what it is, what you like about it, the technology you used and perhaps one thing that you learnt from the project. It could be a website, framework, open source project, game, mobile application... etc. So, allow me to start. I'm personally very proud of a tiny iPhone application I designed and developed. It's only available to UK AppStore users, and I only have a small userbase, but, I like it. The application is called Sushi Total: http://knowledgeisporridge.com/sushitotal.html It's written in Objective-C. It's a very simply application that allows you to total up your bill at Yo Sushi restaurants by tapping coloured plates. If I learnt anything from making this application it's this: I believe software should be simple and uncluttered, and that producing an application with one feature is absolutely fine as long as it works really well. So, who's next?

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Why is my email server in AT&T's blacklist?

  - by legoscia

  I just got this bounce message: <¦¦¦¦¦¦¦¦@att.net>: host scc-mailrelay.att.net[204.127.208.75] said: 521-88.208.246.34 blocked by sbc:blacklist.mailrelay.att.net. 521 DNSRBL: Blocked for abuse. See http://att.net/blocks (in reply to MAIL FROM command) So I'm trying to figure out why our server ended up on their blacklist. The web page link doesn't tell me why, as far as I can see. From a few multi-RBL tools I conclude that our IP is only on the collateral damage lists of uceprotect.net (you can be exempt from that with a paid subscription), and I dearly hope that AT&T doesn't use that. From the mail server logs I see that an email to another @att.net address went through two days ago without being blocked. Does anyone have any ideas how I can find out what went wrong?

  Read the article

• mod_rewrite hide subdirectory in return url part2

  - by user64790

  Hi I am having an issue trying to get my mod_rewrite configuration correctly i have a site: 0.0.0.0/oldname/directories/index.php I would like to rename "oldname" to "newname" resulting in: 0.0.0.0/newname/directories/index.php etc.. So when a user navigates to 0.0.0.0 my site will automatically send them to 0.0.0.0/oldname/index.php I'm not planning on moving my content marketing have asked me to rename the site folder I would like to mask the request of 0.0.0.0/oldname/index.php to 0.0.0.0/newname/index.php Also if a user navigates from index.php to an link of say /oldname/project1/index.Php the final browsers returned URL will be /newname/project1.php without having to move or edit site links. I also understand my hyperlinks will refer to /oldname but this is acceptable any help would be highly appreciated. Regards

  Read the article

• What is your approach to draw a representation of your network ?

  - by Kartoch

  Hello, I'm looking to the community to see how people are drawing their networks, i.e. using symbols to represent complex topology. You can have hardware approach, where every hardware unit are represented. You can also have "entity" approach, where each "service" is shown. Both are interesting but it is difficult to have both on the same schema (but this is needed, especially using virtualization environment). Furthermore, it is difficult to have complex informations on such representation. For instance security parameters (encrypted link, need for authentication) or specific details (protocol type, ports, encapsulation). So my question is: where your are drawing a representation of your network, what is your approach ? Are you using methodology and/or specific softwares ? What is your recommendations for information to put (or not) ? How to deal with the complexity when the network becomes large and/or you want to put a lot of information on it ? Examples and links to good references will be appreciated.

  Read the article

• Microsoft Outlook 2007 Limit attachment size

  - by tasmanian_devil

  I have qmail server and authetication on Active Directory. All clients use Microsoft Outlook 2007 as default mail client. A have one central location and several remote location wich are connected with slow link speed connection. I have attachment limit on qmail, but i have problem when client attach file localy and send mail, attachment is been uploaded to qmail server and rejected because exceeded limit. Is it possible to limit attachment localy on MS Outlook 2007? I know that Office 2010 have attachment limitation but i think that is not working on Office 2007.

  Read the article

• Install Problems on ASUS X401A Notebook

  - by tired_of_trying

  okay... I tried many approaches to install Ubuntu 12.xxx on my new Asus notebook with varying degrees of failure... First: I'm not a newbie but I'm as frustrated as one! Install background: Install from USB DVD drive: The install went well. Re-booted machine. choose ubuntu and it errors with a MBR file error (can't remember the exact wording - something to do with missing the file. Choosing to boot W7 works fine. Install from USB Stick: Couldn't get machine to recognize the .iso Install into Oracle's Vbox: Got the boot splash screen, then hangs with a zillion errors. Note: I didn't have any problems installing ubuntu in Vbox on my iMac and it run's great. Installed using wubi: Installed fine but get errors when booting ubuntu (it doesn't find the needed wubi files). I downloaded to the C: drive and tried installing from there - no luck. For kicks: I tried running Slax Linux .iso from a USB stick and it runs fine. Some Questions: Did I use the correct .iso? (I tried 12.04.0 and 12.04.1 both 32 and 64 bit versions. I simply downloaded them from the download link and didn't use/look for an alternate version. Do I need to do something special when burning the .iso to disc? What? I did read tons of posts but, no luck with finding the solution. Any help is appreciated... thanks

  Read the article

• Community TFS Build Manager available for Visual Studio 2012 RC

  - by Jakob Ehn

  I finally got around to push out a version of the Community TFS Build Manager that is compatible with Visual Studio 2012 RC. Unfortunately I had to do this as a separate extension, it references different versions of the TFS assemblies and also some properties and methods that the 2010 version uses are now obsolete in the TFS 2012 API. To download it, just open the Extension Manager, select Online and search for TFS Build:   You can also download it from this link: http://visualstudiogallery.msdn.microsoft.com/cfdb84b4-285e-4eeb-9fa9-dad9bfe2cd10 The functionality is identical to the 2010 version, the only difference is that you can’t start it from the Team Explorer Builds node (since the TE has been completely rewritten and the extension API’s are not yet published). So, to start it you must use the Tools menu: We will continue shipping updates to both versions in the future, as long as it functionality that is compatible with both TFS 2010 and TFS 2012. You might also note that the color scheme used for the build manager doesn’t look as good with the VS2012 theme….   Hope you will enjoy the tool in Visual Studio 2012 as well. I want to thank all the people who have downloaded and used the 2010 version! For feedback, feature requests, bug reports please post this to the CodePlex site: http://tfsbuildextensions.codeplex.com

  Read the article

• Somehow Google considers a properly 301'd URL as 200 and is still indexing the new content in old page?

  - by user2178914

  We redirected all the old URL's to new ones properly using htaccess. The problem is Google, somehow is still finding content in the old page(which it shouldn't) and stores it in the cache rather than the new URL. For eg: Old Page- http://www.natures-energies.com/iching.htm New Page- http://www.natures-energies.com/index.php?option=com_content&view=article&id=760 If you type the old URL into the browser it redirects If you fetch the old URL as Googlebot in the webmaster tools the header says 301/permanently redirected. If I try to crawl as any other bot it still says 301 redirected. Even if you click the old link in Google it redirects to the new URL. Only in its cache it shows the old URL and moreover it shows the new content in it! I am stumped on how Google manages to grab the new content and puts in the old URL instead of the new one! One more interesting thing is that if I try a cache for the new page it shows the cache of the new content with old URL! Any help would be appreciated. I am at end of my wits. I think i have tried almost everything. Is there anything that I'm missing to see? You can use this search to find the old url's. Maybe you'll some patterns that i missed. site:www.natures-energies.com inurl:htm -inurl:https|index

  Read the article

• How to enable winhlp on Windows7 64bit?

  - by BGM

  Salvete! I just discovered that winhlp32.exe won't run on Windows7 64bit. I can't run the application, and I can't run hlp files either (but .chm files run fine). How do I make this work? I have downloaded the Microsoft fix here and restarted my computer, but to no avail. I can see the file winhlp32.exe in my c:\windows directory, but cannot run it. When I do run it, I get Windows' own "Help and Support" entitled, "Why can't I get Help from this program?" which sends me to the link above! How can I make it work?

  Read the article

• What is the world wide web? [closed]

  - by think123

  I don't know where to post this question, so please move it if necessary. Ok, so I've heard of how the professional hosting companies can create 'links' to the world wide web to register an unregistered domain. So that's where my question comes from. Is the world wide web a server to which servers link? Is it created by abstract linkage? I'm not sure. Also, what does it mean for the DNS to be updated throughout the whole world?

  Read the article

• Create Adjustable Depth of Field Photos with a DSLR

  - by Jason Fitzpatrick

  If you’re fascinating by the Lytro camera–a camera that let’s you change the focus after you’ve taken the photo–this DSLR hack provides a similar post-photo focus processing without the $400 price tag. Photography tinkers at The Chaos Collective came up with a clever way of mimicking the adjustable depth-of-field adjustment effect from the Lytro camera. The secret sauce in their technique is setting the camera to manual focus and capturing a short 2-3 second video clip while they rotate the focus through the entire focal range. From there, they use a simple applet to separate out each frame of the video. Check out the interactive demo below: Anywhere you click in the photo shifts the focus to that point, just like the post processing in the Lytro camera. It’s a different approach to the problem but it yields roughly the same output. Hit up the link below for the full run down on their technique and how you can get started using it with your own video-enabled DLSR. Camera HACK: DOF-Changeable Photos with an SLR [via Hack A Day] Secure Yourself by Using Two-Step Verification on These 16 Web Services How to Fix a Stuck Pixel on an LCD Monitor How to Factory Reset Your Android Phone or Tablet When It Won’t Boot

  Read the article

• Compilation problem [closed]

  - by Misery

  I am trying to compile a program called Triangle Mesh Generator. It is an open source code written in ANSI C. I need it to bo a callable lib so I am using a switch (#define) created by it's Author. However I get this error: /usr/lib/gcc/x86_64-linux-gnu/4.6/../../../x86_64-linux-gnu/crt1.o: In function `_start': collect2: ld returned 1 exit status make: *** [triangle] Error 1 I am not sure why such an error occurs. Worth adding is that compiling it as a stand alone program is succesful. I am using GCC on 12.04. The lines quoted above constitute the total output. What I put in the terminal is just make in the proper folder. There are no other errors, warnings, or other messages. Link to the sources I found some additional instructions. I'll get back after reading them :] EDIT: I have found some additional instructions that let me compile it. Thanks for help. I am closing question right now. Regards

  Read the article

• VPN PPTPD with MPPE Support for Debian or Ubuntu

  - by user78395

  Having an unencrypted vpn connection from a windows client to linux is pretty easy by using pptpd. When I was looking for an solution for encrypted (per MPPE) connection, I found a lot of information about patching the kernel etc. - so it definitly works after some work. But all these information is pretty old (2005-2006). Is it the same solution nowadays? I am not asking for a complete instruction (only if it's short) - I am more asking for a link to the right solution.

  Read the article

< Previous Page | 473 474 475 476 477 478 479 480 481 482 483 484  | Next Page >