Search Results

Search found 88103 results on 3525 pages for 'bam data control multiple'.

Page 487/3525 | < Previous Page | 483 484 485 486 487 488 489 490 491 492 493 494  | Next Page >

  • Control XML serialization of generic types

    - by Luca
    I'm investigating about XML serialization, and since I use lot of dictionary, I would like to serialize them as well. I found the following solution for that (I'm quite proud of it! :) ). [XmlInclude(typeof(Foo))] public class XmlDictionary<TKey, TValue> { /// <summary> /// Key/value pair. /// </summary> public struct DictionaryItem { /// <summary> /// Dictionary item key. /// </summary> public TKey Key; /// <summary> /// Dictionary item value. /// </summary> public TValue Value; } /// <summary> /// Dictionary items. /// </summary> public DictionaryItem[] Items { get { List<DictionaryItem> items = new List<DictionaryItem>(ItemsDictionary.Count); foreach (KeyValuePair<TKey, TValue> pair in ItemsDictionary) { DictionaryItem item; item.Key = pair.Key; item.Value = pair.Value; items.Add(item); } return (items.ToArray()); } set { ItemsDictionary = new Dictionary<TKey,TValue>(); foreach (DictionaryItem item in value) ItemsDictionary.Add(item.Key, item.Value); } } /// <summary> /// Indexer base on dictionary key. /// </summary> /// <param name="key"></param> /// <returns></returns> public TValue this[TKey key] { get { return (ItemsDictionary[key]); } set { Debug.Assert(value != null); ItemsDictionary[key] = value; } } /// <summary> /// Delegate for get key from a dictionary value. /// </summary> /// <param name="value"></param> /// <returns></returns> public delegate TKey GetItemKeyDelegate(TValue value); /// <summary> /// Add a range of values automatically determining the associated keys. /// </summary> /// <param name="values"></param> /// <param name="keygen"></param> public void AddRange(IEnumerable<TValue> values, GetItemKeyDelegate keygen) { foreach (TValue v in values) ItemsDictionary.Add(keygen(v), v); } /// <summary> /// Items dictionary. /// </summary> [XmlIgnore] public Dictionary<TKey, TValue> ItemsDictionary = new Dictionary<TKey,TValue>(); } The classes deriving from this class are serialized in the following way: <XmlProcessList xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <Items> <DictionaryItemOfInt32Foo> <Key/> <Value/> </DictionaryItemOfInt32XmlProcess> <Items> This give me a good solution, but: How can I control the name of the element DictionaryItemOfInt32Foo What happens if I define a Dictionary<FooInt32, Int32> and I have the classes Foo and FooInt32? Is it possible to optimize the class above? THank you very much!

    Read the article

  • PHP-How to Pass Multiple Value In Form Field

    - by Tall boY
    hi i have a php based sorting method with drop down menu to sort no of rows, it is working fine. i have another sorting links to sort id & title, it is also working fine. but together they are not working fine. what happens is that when i sort(say by title) using links, result gets sorted by title, then if i sort rows using drop down menu rows get sorted but result gets back to default of id sort. sorting codes for id & tite is if ($orderby == 'title' && $sortby == 'asc') {echo " <li id='scurrent'><a href='?rpp=$rowsperpage&order=title&sort=asc'>title-asc:</a></li> ";} else {echo " <li><a href='?rpp=$rowsperpage&order=title&sort=asc'>title-asc:</a></li> ";} if ($orderby == 'title' && $sortby == 'desc') {echo " <li id='scurrent'><a href='?rpp=$rowsperpage&order=title&sort=desc'>title-desc:</a></li> ";} else {echo " <li><a href='?rpp=$rowsperpage&order=title&sort=desc'>title-desc:</a></li> ";} if ($orderby == 'id' && $sortby == 'asc') {echo " <li id='scurrent'><a href='?rpp=$rowsperpage&order=id&sort=asc'>id-asc:</a></li> ";} else {echo " <li><a href='?rpp=$rowsperpage&order=id&sort=asc'>id-asc:</a></li> ";} if ($orderby == 'id' && $sortby == 'desc') {echo " <li id='scurrent'><a href='?rpp=$rowsperpage&order=id&sort=desc'>id-desc:</a></li> ";} else {echo " <li><a href='?rpp=$rowsperpage&order=id&sort=desc'>id-desc:</a></li> ";} ?> sorting codes for rows is <form action="is-test.php" method="get"> <select name="rpp" onchange="this.form.submit()"> <option value="10" <?php if ($rowsperpage == 10) echo 'selected="selected"' ?>>10</option> <option value="20" <?php if ($rowsperpage == 20) echo 'selected="selected"' ?>>20</option> <option value="30" <?php if ($rowsperpage == 30) echo 'selected="selected"' ?>>30</option> </select> </form> this method passes only rows per page(rpp) into url. i want it to pass order, sort& rpp. is there a way around to pass multiple values in form fields like this. <form action="is-test.php" method="get"> <select name="rpp, order, sort" onchange="this.form.submit()"> <option value="10, $orderby, $sortby" <?php if ($rowsperpage == 10) echo 'selected="selected"' ?>>10</option> <option value="20, $orderby, $sortby" <?php if ($rowsperpage == 20) echo 'selected="selected"' ?>>20</option> <option value="30, $orderby, $sortby" <?php if ($rowsperpage == 30) echo 'selected="selected"' ?>>30</option> </select> </form> this may seem silly but it just to give you an idea of what i am trying to implement,(i am very new to php) please suggest any way to make this work. thanks

    Read the article

  • Markus Zirn, "Big Data with CEP and SOA" @ SOA, Cloud &amp; Service Technology Symposium 2012

    - by JuergenKress
    ORACLE PROMOTIONAL DISCOUNT FOR EXCLUSIVE ORACLE DISCOUNT, ENTER PROMO CODE: DJMXZ370 Early-Bird Registration is Now Open with Special Pricing! Register before July 1, 2012 to qualify for discounts. Visit the Registration page for details. The International SOA, Cloud + Service Technology Symposium is a yearly event that features the top experts and authors from around the world, providing a series of keynotes, talks, demonstrations, and panels, as well as training and certification workshops - all dedicated to empowering IT professionals to realize modern service technologies and practices in the real world. Click here for a two-page printable conference overview (PDF). Big Data with CEP and SOA - September 25, 2012 - 14:15 Speaker: Markus Zirn, Oracle and Baz Kuthi, Avocent The "Big Data" trend is driving new kinds of IT projects that process machine-generated data. Such projects store and mine using Hadoop/ Map Reduce, but they also analyze streaming data via event-driven patterns, which can be called "Fast Data" complementary to "Big Data". This session highlights how "Big Data" and "Fast Data" design patterns can be combined with SOA design principles into modern, event-driven architectures. We will describe specific architectures that combines CEP, Distributed Caching, Event-driven Network, SOA Composites, Application Development Framework, as well as Hadoop. Architecture patterns include pre-processing and filtering event streams as close as possible to the event source, in memory master data for event pattern matching, event-driven user interfaces as well as distributed event processing. Focus is on how "Fast Data" requirements are elegantly integrated into a traditional SOA architecture. Markus Zirn is Vice President of Product Management covering Oracle SOA Suite, SOA Governance, Application Integration Architecture, BPM, BPM Solutions, Complex Event Processing and UPK, an end user learning solution. He is the author of “The BPEL Cookbook” (rated best book on Services Oriented Architecture in 2007) as well as “Fusion Middleware Patterns”. Previously, he was a management consultant with Booz Allen & Hamilton’s High Tech practice in Duesseldorf as well as San Francisco and Vice President of Product Marketing at QUIQ. Mr. Zirn holds a Masters of Electrical Engineering from the University of Karlsruhe and is an alumnus of the Tripartite program, a joint European degree from the University of Karlsruhe, Germany, the University of Southampton, UK, and ESIEE, France. KEYNOTES & SPEAKERS More than 80 international subject matter experts will be speaking at the Symposium. Below are confirmed keynotes and speakers so far. Over 50% of the agenda has not yet been finalized. Many more speakers to come. View the partial program calendars on the Conference Agenda page. CONFERENCE THEMES & TRACKS Cloud Computing Architecture & Patterns New SOA & Service-Orientation Practices & Models Emerging Service Technology Innovation Service Modeling & Analysis Techniques Service Infrastructure & Virtualization Cloud-based Enterprise Architecture Business Planning for Cloud Computing Projects Real World Case Studies Semantic Web Technologies (with & without the Cloud) Governance Frameworks for SOA and/or Cloud Computing Projects Service Engineering & Service Programming Techniques Interactive Services & the Human Factor New REST & Web Services Tools & Techniques Oracle Specialized SOA & BPM Partners Oracle Specialized partners have proven their skills by certifications and customer references. To find a local Specialized partner please visit http://solutions.oracle.com SOA & BPM Partner Community For regular information on Oracle SOA Suite become a member in the SOA & BPM Partner Community for registration please visit  www.oracle.com/goto/emea/soa (OPN account required) If you need support with your account please contact the Oracle Partner Business Center. Blog Twitter LinkedIn Mix Forum Technorati Tags: Markus Zirn,SOA Symposium,Thomas Erl,SOA Community,Oracle SOA,Oracle BPM,BPM Community,OPN,Jürgen Kress

    Read the article

  • Why do I get "ignoring out-of-zone data" when restarting BIND

    - by 6bytes
    I've been using my own DNS server but then I moved to a third part DNS provider. Yesterday I wanted to go back to using my own DNS's and cancel this third party service. I've lowered TTL in current DNS conf, changed DNS info in GoDaddy for my domain and that's when problems started. My domain seems to be working only for some people but not for others so clearly something is wrong. When restarting bind service named restart everything seems to be OK but later in email from Logwatch I'm getting errors like this: mydomain.com:30: ignoring out-of-zone data (ns1.mydns.com): 3 Time(s) mydomain.info:16: ignoring out-of-zone data (ns1.mydns.com): 5 Time(s) Can anyone point me in the right direction? My BIND configuration for those two domains below: File: /var/named/chroot/etc/zones.external zone "mydomain.com" IN { type master; file "mydomain.com"; allow-transfer { 213.251.188.140; }; allow-update { none; }; notify yes; also-notify { 213.251.188.140; }; }; zone "mydomain.info" IN { type master; file "mydomain.info"; allow-transfer { 213.251.188.140; }; allow-update { none; }; notify yes; also-notify { 213.251.188.140; }; }; File /var/named/chroot/var/named/mydomain.com being my main domain $TTL 3600 $ORIGIN mydomain.com. @ IN SOA ns1.mydns.com. ns2.mydns.com. ( 2010032101 ; Serial 10800 ; Refresh 3600 ; Retry 2419200 ; Expire 3600 ) ; NXDOMAIN TTL IN NS ns1.mydns.com. IN NS ns2.mydns.com. IN MX 10 ASPMX.L.GOOGLE.COM. IN MX 20 ALT1.ASPMX.L.GOOGLE.COM. IN MX 20 ALT2.ASPMX.L.GOOGLE.COM. IN MX 30 ASPMX2.GOOGLEMAIL.COM. IN MX 30 ASPMX3.GOOGLEMAIL.COM. IN MX 30 ASPMX4.GOOGLEMAIL.COM. IN MX 30 ASPMX5.GOOGLEMAIL.COM. IN A 111.111.111.111 * IN A 111.111.111.111 edu IN A 111.111.111.111 googleXXXXXXXXXXXXXXXX IN CNAME google.com. ns1.mydns.com. IN A 111.111.111.111 File /var/named/chroot/var/named/mydomain.info just an alias in apache for mydomain.com $TTL 86400 $ORIGIN mydomain.info. @ IN SOA ns1.mydns.com. ns2.mydns.com. ( 2009042901 ; Serial 10800 ; Refresh 3600 ; Retry 2419200 ; Expire 3600 ) ; NXDOMAIN TTL IN NS ns1.mydns.com. IN NS ns2.mydns.com. IN A 111.111.111.111 * IN A 111.111.111.111 ns1.mydns.com. IN A 111.111.111.111

    Read the article

  • After compiling PHP, I get mod_fcgid: error reading data from FastCGI server

    - by user34295
    I'm trying to add multiple PHP version in Plesk 12. Switching my domain to the new version PHP 5.4.29 result in this error: (104)Connection reset by peer: mod_fcgid: error reading data from FastCGI server Here is phpinfo() of the complied PHP version, obtained running php54-cgi index.php from the terminal. The same script placed under document root doesn't work in FastCGI. How can I debug/try to figure out what's the error? Currently running CentOS 6.5 x64, Plesk v12.0.18_build1200140529.2, PHP 5.5.13. I've downloaded PHP 5.4.29: cd /usr/local/src curl -O http://it1.php.net/distributions/php-5.4.29.tar.gz cd php-5.4.29 And configured with: ./configure \ --prefix=/usr/local/php54 \ --with-bz2 \ --with-config-file-path=/usr/local/php54/etc \ --with-config-file-scan-dir=/usr/local/php54/etc/php.d \ --with-curl \ --with-gd \ --with-gettext \ --with-iconv \ --with-layout=PHP \ --with-libxml-dir=/usr/local/php54 \ --with-mhash \ --with-mysql=mysqlnd \ --with-mysqli=mysqlnd \ --with-openssl \ --with-pdo-mysql=mysqlnd \ --with-readline \ --with-xsl \ --with-zlib \ --enable-calendar \ --enable-cgi \ --enable-exif \ --enable-ftp \ --enable-intl \ --enable-mbstring \ --enable-pcntl \ --enable-shmop \ --enable-sockets \ --enable-sockets \ --enable-sysvmsg \ --enable-sysvsem \ --enable-sysvshm \ --enable-wddx \ --enable-zip Then: make && make install Installing PHP CLI binary: /usr/local/php54/bin/ Installing PHP CLI man page: /usr/local/php54/php/man/man1/ Installing PHP CGI binary: /usr/local/php54/bin/ Installing PHP CGI man page: /usr/local/php54/php/man/man1/ Installing build environment: /usr/local/php54/lib/php/build/ Installing header files: /usr/local/php54/include/php/ Installing helper programs: /usr/local/php54/bin/ program: phpize program: php-config Installing man pages: /usr/local/php54/php/man/man1/ page: phpize.1 page: php-config.1 Installing PEAR environment: /usr/local/php54/lib/php/ [PEAR] Archive_Tar - installed: 1.3.11 [PEAR] Console_Getopt - installed: 1.3.1 warning: pear/PEAR requires package "pear/Structures_Graph" (recommended version 1.0.4) warning: pear/PEAR requires package "pear/XML_Util" (recommended version 1.2.1) [PEAR] PEAR - installed: 1.9.4 Wrote PEAR system config file at: /usr/local/php54/etc/pear.conf You may want to add: /usr/local/php54/lib/php to your php.ini include_path [PEAR] Structures_Graph- installed: 1.0.4 [PEAR] XML_Util - installed: 1.2.1 /usr/local/src/php-5.4.29/build/shtool install -c ext/phar/phar.phar /usr/local/php54/bin ln -s -f /usr/local/php54/bin/phar.phar /usr/local/php54/bin/phar Installing PDO headers: /usr/local/php54/include/php/ext/pdo/ Copied php.ini-production to /usr/local/php54/etc/php.ini and added a new handler in Plesk: /usr/local/psa/bin/php_handler --add -displayname 5.4.29 -path /usr/local/php54/bin/php-cgi -phpini /usr/local/php54/etc/php.ini -type fastcgi -id php54 Symbolic linking: ln -s /usr/local/php54/bin/php /usr/local/bin/php54 ln -s /usr/local/php54/bin/php-cgi /usr/local/bin/php54-cgi New installed version: php54-cgi -m [PHP Modules] bz2 calendar cgi-fcgi Core ctype curl date dom ereg exif fileinfo filter ftp gd gettext hash iconv intl json libxml mbstring mhash mysql mysqli mysqlnd openssl pcntl pcre PDO pdo_mysql pdo_sqlite Phar posix readline Reflection session shmop SimpleXML sockets SPL sqlite3 standard sysvmsg sysvsem sysvshm tokenizer wddx xml xmlreader xmlwriter xsl zip zlib [Zend Modules]

    Read the article

  • How can I recover an ext4 filesystem corrupted after a fsck?

    - by Regan
    I have an ext4 filesystem on luks over software raid5. The filesystem was operating "just fine" for several years when I was beginning to run out of space. I had a 9T volume on 6x2T drives. I began upgrading to 3T drives by doing the mdadm fail, remove, add, rebuild, repeat process until I had a larger array. I then grew the luks container, and then when I unmounted and tried to resize2fs I was given the message the filesystem was dirty and needed e2fsck. Without thinking I just did e2fsck -y /dev/mapper/candybox and it began spewing all kinds of inode being removed type messages (can't remember exactly) I killed e2fsck and tried to remount the filesystem to backup data I was concerned about. When trying to mount at this point I get: # mount /dev/mapper/candybox /candybox mount: wrong fs type, bad option, bad superblock on /dev/mapper/candybox, missing codepage or helper program, or other error In some cases useful info is found in syslog - try dmesg | tail or so Looking back at my older logs I noticed the filesystem was giving this error each time the machine booted: kernel: [79137.275531] EXT4-fs (dm-2): warning: mounting fs with errors, running e2fsck is recommended So shame on me for not paying attention :( I then tried to mount using every backup superblock (one after another) and each attempt left this in my log: EXT4-fs (dm-2): ext4_check_descriptors: Checksum for group 0 failed (26534!=65440) EXT4-fs (dm-2): ext4_check_descriptors: Checksum for group 1 failed (38021!=36729) EXT4-fs (dm-2): ext4_check_descriptors: Checksum for group 2 failed (18336!=39845) ... EXT4-fs (dm-2): ext4_check_descriptors: Checksum for group 11911 failed (28743!=44098) BUG: soft lockup - CPU#0 stuck for 23s! [mount:2939] Attempts to restart e2fsck results in: # e2fsck /dev/mapper/candybox e2fsck 1.41.14 (22-Dec-2010) e2fsck: Group descriptors look bad... trying backup blocks... candy: recovering journal e2fsck: unable to set superblock flags on candy At this point, I decided it best to order some more drives and make an image using ddrescue Now two weeks later I have an image of the luks partition in a .img file. # ls -lh total 14T -rw-r--r-- 1 root root 14T Oct 25 01:57 candybox.img -rw-r--r-- 1 root root 271 Oct 20 14:32 candybox.logfile After numerous attempts using everything I could find online I could not coerce e2fsck to do anything on the image, so I used mkfs.ext4 -L candy candybox.img -m 0 -S and I was able to mount the dirty filesystem readonly without the journal and recover 960G of data. It gave all kinds of errors of various directories not existing and so forth but I was able to get some stuff. Which gave me some hope! I then ran e2fsck again and it had to recreate the root inode and gave a massive list of correcting group counts, I accepted the root inode creation and said no to everything else, leaving a completely empty filesystem. Re-ran again and said yes to all questions with the same result but now a "clean" but empty filesystem. extundelete gives me 0 recoverable inodes found. And now I'm stuck again, I can't come up with any other methods other than dropping to something like photorec which will give me an absolute mess with how large the filesystem was. I'm willing to re-copy the image from the original array and start over, if I can get any suggestions or ideas on a way to get more of my files back. I wish I could give more detailed logs of the commands that have run, but the output is long scrolled passed except for what gets logged to syslog and my memory is not as detailed due to the timeframe this has occurred over. Any help is greatly appreciated!

    Read the article

  • Data capture from other sheet into Summary sheet

    - by Hemant
    an Excel workbook which has Summary sheet, Pending and Master Sheet. My requirement is below and try to develop a Macro or VB logic for excel • I want to control this workbook from Summary sheet. o Generate Fault Summary – ? I have set logic but if doesn’t give warning if sheet name is exists , so need to add this logic . ? When we press the Fault Report Summary command button then it copy the master sheet with cell “A6” Name and will hide the Master sheet. Again when you select the another Month name then it will generate the sheet for that month name. o Generate Toll System Uptime ? When I select the sheet name and “Week” then Press the “Enter “Command button then it should get the result from that sheet number . Each sheet number has Month detail in B2 Cell. ? To calculate the Uptime formula for Week wise is • Week-01 = (1680-SUMIFS(L5:L23,B5:B23,"="&B2,B5:B23,"<="&(B2+6)))/1680 • Week-02 =(1680-SUMIFS(L5:L23,B5:B23,"="&(B2+7),B5:B23,"<="&(B2+13)))/1680 • Week-03 =(1680-SUMIFS(L5:L23,B5:B23,"="&(B2+14),B5:B23,"<="&(B2+20)))/1680 • Week-04 =(1680-SUMIFS(L5:L23,B5:B23,"="&(B2+21),B5:B23,"<="&(B2+27)))/1680 • Month =(1680-SUMIFS(L5:L23,B5:B23,"="&(B2),B5:B23,"<="&(DATE(YEAR(B2),1+MONTH(B2),1)-1)))/1680 ? Result should reflect in Summary sheet at B18 cell . o Pending Fault Report Summary ? When segregate the report on its status like which one is open or Close . It is open then it is Pending Fault Report and when it is Close status it means it is closed. ? If any fault which has OPEN status in all sheets(Jan-13,Feb-13,Mar-13….etc) then it should be come as well as in Pending Sheet which ascending date order. ? When it’s status is changed then it should be moved in that month sheet or nearby fault created date. It status is close then it should not be available in pending sheet as it’s status is Closed. ? Each fault has Reported date and we monitor all fault according reported date. ? When we press the Update Fault Report Summary command button then it should update as above logic. ? Some time we export the Pending fault report , so date calendar should be present in Start and End date to Choose the date. When we press the Export command line then it should export the Pending fault report and able to save in Excel,PDF.

    Read the article

  • How to handle "porting" software that's still in development

    - by BAM
    My company is building an iOS version of an Android app that our client is developing (but has not yet released). We have access to the latest builds and source, however since the software is frequently re-structured and refactored, we're doing a lot of unnecessary re-work. In addition, the due date on the contract will likely be passed before the client's application is even ready for release. In other words, we're supposed to build the iOS version before the original Android version is even complete. Luckily the client tossed out the original deadline, but now we may have to renegotiate pricing... never a fun situation. Are we handling this incorrectly? How are "ports" (especially between mobile platforms) normally done? Is there a correct way to pipeline development for multiple platforms without so much re-work? Thanks in advance! :)

    Read the article

  • dynamic multiple instance of swfupload (firefox vs IE)

    - by jean27
    We have this dynamic uploader which creates a new instance of swfupload. I'm a little bit confused with the outputs produced by firefox and ie. Firefox have the same output as chrome, safari and opera. Whenever I clicked a button for adding a new instance, the previous instances of swfupload in firefox refresh while IE don't. I have this debug information: For Firefox: SWF DEBUG OUTPUT IN FIREFOX ---SWFUpload Instance Info--- Version: 2.2.0 2009-03-25 Movie Name: SWFUpload_0 Settings: upload_url: /86707/listing/asynchronousuploadphoto/87085/15/E1ptdReNMwcU/cUkx4p689ChPRZYMKkLZQ== flash_url: /content/swfupload.swf?preventswfcaching=1272512466022 use_query_string: false requeue_on_error: false http_success: assume_success_timeout: 0 file_post_name: Filedata post_params: [object Object] file_types: .jpg;.gif;.png;.bmp file_types_description: Image Files file_size_limit: 1MB file_upload_limit: 1 file_queue_limit: 1 debug: true prevent_swf_caching: true button_placeholder_id: file-1_swf button_placeholder: Not Set button_image_url: /content/images/blankButton.png button_width: 109 button_height: 22 button_text: button_text_style: color: #000000; font-size: 16pt; button_text_top_padding: 1 button_text_left_padding: 30 button_action: -110 button_disabled: false custom_settings: [object Object] Event Handlers: swfupload_loaded_handler assigned: true file_dialog_start_handler assigned: true file_queued_handler assigned: true file_queue_error_handler assigned: true upload_start_handler assigned: true upload_progress_handler assigned: true upload_error_handler assigned: true upload_success_handler assigned: true upload_complete_handler assigned: true debug_handler assigned: true SWF DEBUG: SWFUpload Init CompleteSWF DEBUG: SWF DEBUG: ----- SWF DEBUG OUTPUT ---- SWF DEBUG: Build Number: SWFUPLOAD 2.2.0 SWF DEBUG: movieName: SWFUpload_0 SWF DEBUG: Upload URL: /86707/listing/asynchronousuploadphoto/87085/15/E1ptdReNMwcU/cUkx4p689ChPRZYMKkLZQ== SWF DEBUG: File Types String: .jpg;.gif;.png;.bmp SWF DEBUG: Parsed File Types: jpg,gif,png,bmp SWF DEBUG: HTTP Success: 0 SWF DEBUG: File Types Description: Image Files (.jpg;.gif;.png;.bmp) SWF DEBUG: File Size Limit: 1048576 bytes SWF DEBUG: File Upload Limit: 1 SWF DEBUG: File Queue Limit: 1 SWF DEBUG: Post Params: SWF DEBUG: ----- END SWF DEBUG OUTPUT ---- SWF DEBUG: SWF DEBUG: Event: fileDialogStart : Browsing files. Multi Select. Allowed file types: .jpg;.gif;.png;.bmpSWF DEBUG: Select Handler: Received the files selected from the dialog. Processing the file list...SWF DEBUG: Event: fileQueued : File ID: SWFUpload_0_0SWF DEBUG: Event: fileDialogComplete : Finished processing selected files. Files selected: 1. Files Queued: 1---SWFUpload Instance Info--- Version: 2.2.0 2009-03-25 Movie Name: SWFUpload_1 Settings: upload_url: /86707/listing/asynchronousuploadphoto/87085/15/E1ptdReNMwcU/cUkx4p689ChPRZYMKkLZQ== flash_url: /content/swfupload.swf?preventswfcaching=1272512476357 use_query_string: false requeue_on_error: false http_success: assume_success_timeout: 0 file_post_name: Filedata post_params: [object Object] file_types: .jpg;.gif;.png;.bmp file_types_description: Image Files file_size_limit: 1MB file_upload_limit: 1 file_queue_limit: 1 debug: true prevent_swf_caching: true button_placeholder_id: file-2_swf button_placeholder: Not Set button_image_url: /content/images/blankButton.png button_width: 109 button_height: 22 button_text: button_text_style: color: #000000; font-size: 16pt; button_text_top_padding: 1 button_text_left_padding: 30 button_action: -110 button_disabled: false custom_settings: [object Object] Event Handlers: swfupload_loaded_handler assigned: true file_dialog_start_handler assigned: true file_queued_handler assigned: true file_queue_error_handler assigned: true upload_start_handler assigned: true upload_progress_handler assigned: true upload_error_handler assigned: true upload_success_handler assigned: true upload_complete_handler assigned: true debug_handler assigned: true SWF DEBUG: SWFUpload Init CompleteSWF DEBUG: SWF DEBUG: ----- SWF DEBUG OUTPUT ---- SWF DEBUG: Build Number: SWFUPLOAD 2.2.0 SWF DEBUG: movieName: SWFUpload_1 SWF DEBUG: Upload URL: /86707/listing/asynchronousuploadphoto/87085/15/E1ptdReNMwcU/cUkx4p689ChPRZYMKkLZQ== SWF DEBUG: File Types String: .jpg;.gif;.png;.bmp SWF DEBUG: Parsed File Types: jpg,gif,png,bmp SWF DEBUG: HTTP Success: 0 SWF DEBUG: File Types Description: Image Files (.jpg;.gif;.png;.bmp) SWF DEBUG: File Size Limit: 1048576 bytes SWF DEBUG: File Upload Limit: 1 SWF DEBUG: File Queue Limit: 1 SWF DEBUG: Post Params: SWF DEBUG: ----- END SWF DEBUG OUTPUT ---- SWF DEBUG: SWF DEBUG: SWFUpload Init CompleteSWF DEBUG: SWF DEBUG: ----- SWF DEBUG OUTPUT ---- SWF DEBUG: Build Number: SWFUPLOAD 2.2.0 SWF DEBUG: movieName: SWFUpload_0 SWF DEBUG: Upload URL: /86707/listing/asynchronousuploadphoto/87085/15/E1ptdReNMwcU/cUkx4p689ChPRZYMKkLZQ== SWF DEBUG: File Types String: .jpg;.gif;.png;.bmp SWF DEBUG: Parsed File Types: jpg,gif,png,bmp SWF DEBUG: HTTP Success: 0 SWF DEBUG: File Types Description: Image Files (.jpg;.gif;.png;.bmp) SWF DEBUG: File Size Limit: 1048576 bytes SWF DEBUG: File Upload Limit: 1 SWF DEBUG: File Queue Limit: 1 SWF DEBUG: Post Params: SWF DEBUG: ----- END SWF DEBUG OUTPUT ---- SWF DEBUG: SWF DEBUG: Event: fileDialogStart : Browsing files. Multi Select. Allowed file types: .jpg;.gif;.png;.bmpSWF DEBUG: Select Handler: Received the files selected from the dialog. Processing the file list...SWF DEBUG: Event: fileQueued : File ID: SWFUpload_1_0SWF DEBUG: Event: fileDialogComplete : Finished processing selected files. Files selected: 1. Files Queued: 1SWF DEBUG: StartUpload: First file in queueSWF DEBUG: StartUpload(): No files found in the queue.SWF DEBUG: StartUpload: First file in queueSWF DEBUG: Event: uploadStart : File ID: SWFUpload_1_0SWF DEBUG: ReturnUploadStart(): File accepted by startUpload event and readied for upload. Starting upload to /86707/listing/asynchronousuploadphoto/87085/15/E1ptdReNMwcU/cUkx4p689ChPRZYMKkLZQ== for File ID: SWFUpload_1_0SWF DEBUG: Event: uploadProgress (OPEN): File ID: SWFUpload_1_0SWF DEBUG: Event: uploadProgress: File ID: SWFUpload_1_0. Bytes: 30218. Total: 30218SWF DEBUG: Event: uploadSuccess: File ID: SWFUpload_1_0 Response Received: true Data: 65-AddClassification.pngSWF DEBUG: Event: uploadComplete : Upload cycle complete. For IE: SWF DEBUG OUTPUT IN IE ---SWFUpload Instance Info--- Version: 2.2.0 2009-03-25 Movie Name: SWFUpload_0 Settings: upload_url: /86707/listing/asynchronousuploadphoto/87085/15/E1ptdReNMwcU/cUkx4p689ChPRZYMKkLZQ== flash_url: /content/swfupload.swf?preventswfcaching=1272512200531 use_query_string: false requeue_on_error: false http_success: assume_success_timeout: 0 file_post_name: Filedata post_params: [object Object] file_types: .jpg;.gif;.png;.bmp file_types_description: Image Files file_size_limit: 1MB file_upload_limit: 1 file_queue_limit: 1 debug: true prevent_swf_caching: true button_placeholder_id: file-1_swf button_placeholder: Not Set button_image_url: /content/images/blankButton.png button_width: 109 button_height: 22 button_text: Browse... button_text_style: color: #000000; font-size: 16pt; button_text_top_padding: 1 button_text_left_padding: 30 button_action: -110 button_disabled: false custom_settings: [object Object] Event Handlers: swfupload_loaded_handler assigned: true file_dialog_start_handler assigned: true file_queued_handler assigned: true file_queue_error_handler assigned: true upload_start_handler assigned: true upload_progress_handler assigned: true upload_error_handler assigned: true upload_success_handler assigned: true upload_complete_handler assigned: true debug_handler assigned: true SWF DEBUG: SWFUpload Init CompleteSWF DEBUG: SWF DEBUG: ----- SWF DEBUG OUTPUT ---- SWF DEBUG: Build Number: SWFUPLOAD 2.2.0 SWF DEBUG: movieName: SWFUpload_0 SWF DEBUG: Upload URL: /86707/listing/asynchronousuploadphoto/87085/15/E1ptdReNMwcU/cUkx4p689ChPRZYMKkLZQ== SWF DEBUG: File Types String: .jpg;.gif;.png;.bmp SWF DEBUG: Parsed File Types: jpg,gif,png,bmp SWF DEBUG: HTTP Success: 0 SWF DEBUG: File Types Description: Image Files (.jpg;.gif;.png;.bmp) SWF DEBUG: File Size Limit: 1048576 bytes SWF DEBUG: File Upload Limit: 1 SWF DEBUG: File Queue Limit: 1 SWF DEBUG: Post Params: SWF DEBUG: ----- END SWF DEBUG OUTPUT ---- SWF DEBUG: Removing Flash functions hooks (this should only run in IE and should prevent memory leaks)SWF DEBUG: Event: fileDialogStart : Browsing files. Multi Select. Allowed file types: .jpg;.gif;.png;.bmpSWF DEBUG: Select Handler: Received the files selected from the dialog. Processing the file list...SWF DEBUG: Event: fileQueued : File ID: SWFUpload_0_0SWF DEBUG: Event: fileDialogComplete : Finished processing selected files. Files selected: 1. Files Queued: 1---SWFUpload Instance Info--- Version: 2.2.0 2009-03-25 Movie Name: SWFUpload_1 Settings: upload_url: /86707/listing/asynchronousuploadphoto/87085/15/E1ptdReNMwcU/cUkx4p689ChPRZYMKkLZQ== flash_url: /content/swfupload.swf?preventswfcaching=1272512222093 use_query_string: false requeue_on_error: false http_success: assume_success_timeout: 0 file_post_name: Filedata post_params: [object Object] file_types: .jpg;.gif;.png;.bmp file_types_description: Image Files file_size_limit: 1MB file_upload_limit: 1 file_queue_limit: 1 debug: true prevent_swf_caching: true button_placeholder_id: file-2_swf button_placeholder: Not Set button_image_url: /content/images/blankButton.png button_width: 109 button_height: 22 button_text: Browse... button_text_style: color: #000000; font-size: 16pt; button_text_top_padding: 1 button_text_left_padding: 30 button_action: -110 button_disabled: false custom_settings: [object Object] Event Handlers: swfupload_loaded_handler assigned: true file_dialog_start_handler assigned: true file_queued_handler assigned: true file_queue_error_handler assigned: true upload_start_handler assigned: true upload_progress_handler assigned: true upload_error_handler assigned: true upload_success_handler assigned: true upload_complete_handler assigned: true debug_handler assigned: true SWF DEBUG: SWFUpload Init CompleteSWF DEBUG: SWF DEBUG: ----- SWF DEBUG OUTPUT ---- SWF DEBUG: Build Number: SWFUPLOAD 2.2.0 SWF DEBUG: movieName: SWFUpload_1 SWF DEBUG: Upload URL: /86707/listing/asynchronousuploadphoto/87085/15/E1ptdReNMwcU/cUkx4p689ChPRZYMKkLZQ== SWF DEBUG: File Types String: .jpg;.gif;.png;.bmp SWF DEBUG: Parsed File Types: jpg,gif,png,bmp SWF DEBUG: HTTP Success: 0 SWF DEBUG: File Types Description: Image Files (.jpg;.gif;.png;.bmp) SWF DEBUG: File Size Limit: 1048576 bytes SWF DEBUG: File Upload Limit: 1 SWF DEBUG: File Queue Limit: 1 SWF DEBUG: Post Params: SWF DEBUG: ----- END SWF DEBUG OUTPUT ---- SWF DEBUG: Removing Flash functions hooks (this should only run in IE and should prevent memory leaks)SWF DEBUG: ExternalInterface reinitializedSWF DEBUG: Event: fileDialogStart : Browsing files. Multi Select. Allowed file types: .jpg;.gif;.png;.bmpSWF DEBUG: Select Handler: Received the files selected from the dialog. Processing the file list...SWF DEBUG: Event: fileQueued : File ID: SWFUpload_1_0SWF DEBUG: Event: fileDialogComplete : Finished processing selected files. Files selected: 1. Files Queued: 1SWF DEBUG: StartUpload: First file in queueSWF DEBUG: Event: uploadStart : File ID: SWFUpload_0_0SWF DEBUG: StartUpload: First file in queueSWF DEBUG: Event: uploadStart : File ID: SWFUpload_1_0SWF DEBUG: ReturnUploadStart(): File accepted by startUpload event and readied for upload. Starting upload to /86707/listing/asynchronousuploadphoto/87085/15/E1ptdReNMwcU/cUkx4p689ChPRZYMKkLZQ== for File ID: SWFUpload_0_0SWF DEBUG: ReturnUploadStart(): File accepted by startUpload event and readied for upload. Starting upload to /86707/listing/asynchronousuploadphoto/87085/15/E1ptdReNMwcU/cUkx4p689ChPRZYMKkLZQ== for File ID: SWFUpload_1_0SWF DEBUG: Event: uploadProgress (OPEN): File ID: SWFUpload_0_0SWF DEBUG: Event: uploadProgress: File ID: SWFUpload_0_0. Bytes: 29151. Total: 29151SWF DEBUG: Event: uploadProgress (OPEN): File ID: SWFUpload_1_0SWF DEBUG: Event: uploadProgress: File ID: SWFUpload_1_0. Bytes: Total: 30218SWF DEBUG: Event: uploadSuccess: File ID: SWFUpload_0_0 Response Received: true Data: 62-Greenwich_-_Branches.pngSWF DEBUG: Event: uploadComplete : Upload cycle complete.

    Read the article

  • Asp.Net Login control (Visual Web Dev)

    - by craig
    This is the code when you take the Login control from the toolbox. <%@ Page Language="C#" AutoEventWireup="true" CodeFile="Default.aspx.cs" Inherits="_Default" %> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head runat="server"> <title></title> </head> <body> <form id="form1" runat="server"> <div> <asp:Login ID="Login1" runat="server" onauthenticate="Login1_Authenticate" BackColor="#F7F7DE" BorderColor="#CCCC99" BorderStyle="Solid" BorderWidth="1px" Font-Names="Verdana" Font-Size="10pt"> <LayoutTemplate> <table border="0" cellpadding="1" cellspacing="0" style="border-collapse:collapse;"> <tr> <td> <table border="0" cellpadding="0"> <tr> <td align="center" colspan="2"> Log In</td> </tr> <tr> <td align="right"> <asp:Label ID="UserNameLabel" runat="server" AssociatedControlID="UserName">User Name:</asp:Label> </td> <td> <asp:TextBox ID="UserName" runat="server" ></asp:TextBox> <asp:RequiredFieldValidator ID="UserNameRequired" runat="server" ControlToValidate="UserName" ErrorMessage="User Name is required." ToolTip="User Name is required." ValidationGroup="Login1">*</asp:RequiredFieldValidator> </td> </tr> <tr> <td align="right"> <asp:Label ID="PasswordLabel" runat="server" AssociatedControlID="Password">Password:</asp:Label> </td> <td> <asp:TextBox ID="Password" runat="server" TextMode="Password"></asp:TextBox> <asp:RequiredFieldValidator ID="PasswordRequired" runat="server" ControlToValidate="Password" ErrorMessage="Password is required." ToolTip="Password is required." ValidationGroup="Login1">*</asp:RequiredFieldValidator> </td> </tr> <tr> <td colspan="2"> <asp:CheckBox ID="RememberMe" runat="server" Text="Remember me next time." /> </td> </tr> <tr> <td align="center" colspan="2" style="color:Red;"> <asp:Literal ID="FailureText" runat="server" EnableViewState="False"></asp:Literal> </td> </tr> <tr> <td align="right" colspan="2"> <asp:Button ID="LoginButton" runat="server" CommandName="Login" Text="Log In" ValidationGroup="Login1" onclick="LoginButton_Click" /> </td> </tr> </table> </td> </tr> </table> </LayoutTemplate> <TitleTextStyle BackColor="#6B696B" Font-Bold="True" ForeColor="#FFFFFF" /> </asp:Login> </div> </form> </body> </html> Part of my aspx.cs protected void LoginButton_Click(object sender, EventArgs e) { String sUserName = UserName.Text; String sPassword = Password.Text; Error 1 The name 'UserName' does not exist in the current context Error 2 The name 'Password' does not exist in the current context Error 3 'ASP.default_aspx' does not contain a definition for 'Login1_Authenticate' and no extension method 'Login1_Authenticate' accepting a first argument of type 'ASP.default_aspx' could be found (are you missing a using directive or an assembly reference?) What am I doing wrong?

    Read the article

  • How to publish multiple jar files to maven on a clean install

    - by Abhijit Hukkeri
    I have a used the maven assembly plugin to create multiple jar from one jar now the problem is that I have to publish these jar to the local repo, just like other maven jars publish by them self when they are built maven clean install how will I be able to do this here is my pom file <project> <parent> <groupId>parent.common.bundles</groupId> <version>1.0</version> <artifactId>child-bundle</artifactId> </parent> <modelVersion>4.0.0</modelVersion> <groupId>common.dataobject</groupId> <artifactId>common-dataobject</artifactId> <packaging>jar</packaging> <name>common-dataobject</name> <version>1.0</version> <dependencies> </dependencies> <build> <plugins> <plugin> <groupId>org.jibx</groupId> <artifactId>maven-jibx-plugin</artifactId> <version>1.2.1</version> <configuration> <directory>src/main/resources/jibx_mapping</directory> <includes> <includes>binding.xml</includes> </includes> <verbose>false</verbose> </configuration> <executions> <execution> <goals> <goal>bind</goal> </goals> </execution> </executions> </plugin> <plugin> <artifactId>maven-assembly-plugin</artifactId> <executions> <execution> <id>make-business-assembly</id> <phase>package</phase> <goals> <goal>single</goal> </goals> <configuration> <appendAssemblyId>false</appendAssemblyId> <finalName>flight-dto</finalName> <descriptors> <descriptor>src/main/assembly/car-assembly.xml</descriptor> </descriptors> <attach>true</attach> </configuration> </execution> <execution> <id>make-gui-assembly</id> <phase>package</phase> <goals> <goal>single</goal> </goals> <configuration> <appendAssemblyId>false</appendAssemblyId> <finalName>app_gui</finalName> <descriptors> <descriptor>src/main/assembly/bike-assembly.xml</descriptor> </descriptors> <attach>true</attach> </configuration> </execution> </executions> </plugin> </plugins> </build> </project> Here is my assembly file <assembly> <id>app_business</id> <formats> <format>jar</format> </formats> <baseDirectory>target</baseDirectory> <includeBaseDirectory>false</includeBaseDirectory> <fileSets> <fileSet> <directory>${project.build.outputDirectory}</directory> <outputDirectory></outputDirectory> <includes> <include>com/dataobjects/**</include> </includes> </fileSet> </fileSets> </assembly>

    Read the article

  • Network Data Packet connectivity intent

    - by Rakesh
    I am writing an Android application which can enable and disable the Network Data packet connection. I am also using one broadcast receiver to check the Network Data packet connection. I have registered broadcast receiver and provided required permission in Manifest file. But when I run this application it changes the connection state and after that it crashes. But when I don't include this broadcast receiver it works fine. I am not able to see any kind of log which can provide some clue. Here is my code for broadcast receiver. <?xml version="1.0" encoding="utf-8"?> <manifest xmlns:android="http://schemas.android.com/apk/res/android" package="com.rakesh.simplewidget" android:versionCode="1" android:versionName="1.0" > <uses-sdk android:minSdkVersion="10" /> <!-- Permissions --> <uses-permission android:name="android.permission.CHANGE_NETWORK_STATE" /> <uses-permission android:name="android.permission.MODIFY_PHONE_STATE" /> <uses-permission android:name="android.permission.ACCESS_NETWORK_STATE" /> <application android:icon="@drawable/ic_launcher" android:label="@string/app_name" > <activity android:name=".SimpleWidgetExampleActivity" android:label="@string/app_name" > <intent-filter> <action android:name="android.intent.action.MAIN" /> <category android:name="android.intent.category.LAUNCHER" /> </intent-filter> </activity> <!-- <receiver android:name=".ExampleAppWidgetProvider" android:label="Widget ErrorBuster" > <intent-filter> <action android:name="android.appwidget.action.APPWIDGET_UPDATE" /> </intent-filter> <meta-data android:name="android.appwidget.provider" android:resource="@xml/widget1_info" /> </receiver> --> <receiver android:name=".ConnectivityReceiver" > <intent-filter> <action android:name="android.net.conn.CONNECTIVITY_CHANGE" /> </intent-filter> </receiver> </application> </manifest> My Broadcast receiver class is as following. import android.content.BroadcastReceiver; import android.content.Context; import android.content.Intent; import android.net.ConnectivityManager; import android.net.NetworkInfo; import android.util.Log; public class ConnectivityReceiver extends BroadcastReceiver { @Override public void onReceive(Context context, Intent intent) { NetworkInfo info = (NetworkInfo)intent.getParcelableExtra(ConnectivityManager.EXTRA_NETWORK_INFO); if(info.getType() == ConnectivityManager.TYPE_MOBILE){ if(info.isConnectedOrConnecting()){ Log.e("RK","Mobile data is connected"); }else{ Log.e("RK","Mobile data is disconnected"); } } } } my Main activity file. package com.rakesh.simplewidget; import java.lang.reflect.Field; import java.lang.reflect.Method; import android.app.Activity; import android.content.Context; import android.content.Intent; import android.graphics.Color; import android.net.ConnectivityManager; import android.os.Bundle; import android.telephony.TelephonyManager; import android.util.Log; import android.view.View; import android.widget.Button; import android.widget.Toast; public class SimpleWidgetExampleActivity extends Activity { private Button btNetworkSetting; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); btNetworkSetting = (Button)findViewById(R.id.btNetworkSetting); if(checkConnectivityState(getApplicationContext())){ btNetworkSetting.setBackgroundColor(Color.GREEN); }else{ btNetworkSetting.setBackgroundColor(Color.GRAY); } } public void openNetworkSetting(View view){ Method dataConnSwitchmethod; Class telephonyManagerClass; Object ITelephonyStub; Class ITelephonyClass; Context context = view.getContext(); boolean enabled = !checkConnectivityState(context); final ConnectivityManager conman = (ConnectivityManager) context.getSystemService(Context.CONNECTIVITY_SERVICE); try{ final Class conmanClass = Class.forName(conman.getClass().getName()); final Field iConnectivityManagerField = conmanClass.getDeclaredField("mService"); iConnectivityManagerField.setAccessible(true); final Object iConnectivityManager = iConnectivityManagerField.get(conman); final Class iConnectivityManagerClass = Class.forName(iConnectivityManager.getClass().getName()); final Method setMobileDataEnabledMethod = iConnectivityManagerClass.getDeclaredMethod("setMobileDataEnabled", Boolean.TYPE); setMobileDataEnabledMethod.setAccessible(true); setMobileDataEnabledMethod.invoke(iConnectivityManager, enabled); if(enabled){ Toast.makeText(view.getContext(), "Enabled Network Data", Toast.LENGTH_LONG).show(); view.setBackgroundColor(Color.GREEN); } else{ Toast.makeText(view.getContext(), "Disabled Network Data", Toast.LENGTH_LONG).show(); view.setBackgroundColor(Color.LTGRAY); } }catch(Exception e){ Log.e("Error", "some error"); Toast.makeText(view.getContext(), "It didn't work", Toast.LENGTH_LONG).show(); } } private boolean checkConnectivityState(Context context){ final TelephonyManager telephonyManager = (TelephonyManager) context .getSystemService(Context.TELEPHONY_SERVICE); ConnectivityManager af ; return telephonyManager.getDataState() == TelephonyManager.DATA_CONNECTED; } } Log file: java.lang.RuntimeException: Unable to instantiate receiver com.rakesh.simplewidget.ConnectivityReceiver: java.lang.ClassNotFoundException: com.rakesh.simplewidget.ConnectivityReceiver in loader dalvik.system.PathClassLoader[/data/app/com.rakesh.simplewidget-2.apk] E/AndroidRuntime(26094): at android.app.ActivityThread.handleReceiver(ActivityThread.java:1777) E/AndroidRuntime(26094): at android.app.ActivityThread.access$2400(ActivityThread.java:117) E/AndroidRuntime(26094): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:985) E/AndroidRuntime(26094): at android.os.Handler.dispatchMessage(Handler.java:99) E/AndroidRuntime(26094): at android.os.Looper.loop(Looper.java:130) E/AndroidRuntime(26094): at android.app.ActivityThread.main(ActivityThread.java:3691) E/AndroidRuntime(26094): at java.lang.reflect.Method.invokeNative(Native Method) E/AndroidRuntime(26094): at java.lang.reflect.Method.invoke(Method.java:507) E/AndroidRuntime(26094): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:907) E/AndroidRuntime(26094): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:665) E/AndroidRuntime(26094): at dalvik.system.NativeStart.main(Native Method) It seems Android is not able to recognize file Broadcast Receiver class. Any idea why I am getting this error? PS: Some information about Android environment and platform. - Android API 10. - Running on Samsung Galaxy II which has android 2.3.6 Edit: my broadcast receiver file ConnectivityReceiver.java was present in default package and it was not being recognized by Android. Android was looking for this file in current package i.e com.rakesh.simplewidget; I just moved connectivityReciever.java file to com.rakesh.simplewidget package and problem was solved.

    Read the article

  • Overly accessible and incredibly resource hungry relationships between business objects. How can I f

    - by Mike
    Hi, Firstly, This might seem like a long question. I don't think it is... The code is just an overview of what im currently doing. It doesn't feel right, so I am looking for constructive criticism and warnings for pitfalls and suggestions of what I can do. I have a database with business objects. I need to access properties of parent objects. I need to maintain some sort of state through business objects. If you look at the classes, I don't think that the access modifiers are right. I don't think its structured very well. Most of the relationships are modelled with public properties. SubAccount.Account.User.ID <-- all of those are public.. Is there a better way to model a relationship between classes than this so its not so "public"? The other part of this question is about resources: If I was to make a User.GetUserList() function that returns a List, and I had 9000 users, when I call the GetUsers method, it will make 9000 User objects and inside that it will make 9000 new AccountCollection objects. What can I do to make this project not so resource hungry? Please find the code below and rip it to shreds. public class User { public string ID {get;set;} public string FirstName {get; set;} public string LastName {get; set;} public string PhoneNo {get; set;} public AccountCollection accounts {get; set;} public User { accounts = new AccountCollection(this); } public static List<Users> GetUsers() { return Data.GetUsers(); } } public AccountCollection : IEnumerable<Account> { private User user; public AccountCollection(User user) { this.user = user; } public IEnumerable<Account> GetEnumerator() { return Data.GetAccounts(user); } } public class Account { public User User {get; set;} //This is public so that the subaccount can access its Account's User's ID public int ID; public string Name; public Account(User user) { this.user = user; } } public SubAccountCollection : IEnumerable<SubAccount> { public Account account {get; set;} public SubAccountCollection(Account account) { this.account = account; } public IEnumerable<SubAccount> GetEnumerator() { return Data.GetSubAccounts(account); } } public class SubAccount { public Account account {get; set;} //this is public so that my Data class can access the account, to get the account's user's ID. public SubAccount(Account account) { this.account = account; } public Report GenerateReport() { Data.GetReport(this); } } public static class Data { public static List<Account> GetSubAccounts(Account account) { using (var dc = new databaseDataContext()) { List<SubAccount> query = (from a in dc.Accounts where a.UserID == account.User.ID //this is getting the account's user's ID select new SubAccount(account) { ID = a.ID, Name = a.Name, }).ToList(); } } public static List<Account> GetAccounts(User user) { using (var dc = new databaseDataContext()) { List<Account> query = (from a in dc.Accounts where a.UserID == User.ID //this is getting the user's ID select new Account(user) { ID = a.ID, Name = a.Name, }).ToList(); } } public static Report GetReport(SubAccount subAccount) { Report report = new Report(); //database access code here //need to get the user id of the subaccount's account for data querying. //i've got the subaccount, but how should i get the user id. //i would imagine something like this: int accountID = subAccount.Account.User.ID; //but this would require the subaccount's Account property to be public. //i do not want this to be accessible from my other project (UI). //reading up on internal seems to do the trick, but within my code it still feels //public. I could restrict the property to read, and only private set. return report; } public static List<User> GetUsers() { using (var dc = new databaseDataContext()) { var query = (from u in dc.Users select new User { ID = u.ID, FirstName = u.FirstName, LastName = u.LastName, PhoneNo = u.PhoneNo }).ToList(); return query; } } }

    Read the article

  • Client no longer getting data from Web Service after introducing targetNamespace in XSD

    - by Laurence
    Sorry if there is way too much info in this post – there’s a load of story before I get to the actual problem. I thought I‘d include everything that might be relevant as I don’t have much clue what is wrong. I had a working web service and client (both written with VS 2008 in C#) for passing product data to an e-commerce site. The XSD started like this: <xs:schema id="Ecommerce" elementFormDefault="qualified" xmlns:mstns="http://tempuri.org/Ecommerce.xsd" xmlns:xs="http://www.w3.org/2001/XMLSchema"> <xs:element name="eur"> <xs:complexType> <xs:sequence> <xs:element ref="sec" minOccurs="1" maxOccurs="1"/> </xs:sequence> etc Here’s a sample document sent from client to service: <eur xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" class="ECommerce_WebService" type="product" method="GetLastDateSent" chunk_no="1" total_chunks="1" date_stamp="2010-03-10T17:16:34.523" version="1.1"> <sec guid="BFBACB3C-4C17-4786-ACCF-96BFDBF32DA5" company_name="Company" version="1.1"> <data /> </sec> </eur> Then, I had to give the service a targetNamespace. Actually I don’t know if I “had” to set it, but I added (to the same VS project) some code to act as a client to a completely unrelated service (which also had no namespace), and the project would not build until I gave my service a namespace. Now the XSD starts like this: <xs:schema id="Ecommerce" elementFormDefault="qualified" xmlns:mstns="http://tempuri.org/Ecommerce.xsd" xmlns:xs="http://www.w3.org/2001/XMLSchema" targetNamespace="http://www.company.com/ecommerce" xmlns:ecom="http://www. company.com/ecommerce"> <xs:element name="eur"> <xs:complexType> <xs:sequence> <xs:element ref="ecom:sec" minOccurs="1" maxOccurs="1" /> </xs:sequence> etc As you can see above I also updated all the xs:element ref attributes to give them the “ecom” prefix. Now the project builds again. I found the client needed some modification after this. The client uses a SQL stored procedure to generate the XML. This is then de-serialised into an object of the correct type for the service’s “get_data” method. The object’s type used to be “eur” but after updating the web reference to the service, it became “get_dataEur”. And sure enough the parent element in the XML had to be changed to “get_dataEur” to be accepted. Then bizarrely I also had to put the xmlns attribute containing my namespace on the “sec” element (the immediate child of the parent element) rather than the parent element. Here’s a sample document now sent from client to service: <get_dataEur xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" class="ECommerce_WebService" type="product" method="GetLastDateSent" chunk_no="1" total_chunks="1" date_stamp="2010-03-10T18:23:20.653" version="1.1"> <sec xmlns="http://www.company.com/ecommerce" guid="BFBACB3C-4C17-4786-ACCF-96BFDBF32DA5" company_name="Company" version="1.1"> <data /> </sec> </get_dataEur> If in the service’s get_data method I then serialize the incoming object I see this (the parent element is “eur” and the xmlns attribute is on the parent element): <eur xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns="http://www.company.com/ecommerce" class="ECommerce_WebService" type="product" method="GetLastDateSent" chunk_no="1" total_chunks="1" date_stamp="2010-03-10T18:23:20.653" version="1.1"> <sec guid="BFBACB3C-4C17-4786-ACCF-96BFDBF32DA5" company_name="Company" version="1.1"> <data /> </sec> </eur> The service then prepares a reply to go back to the client. The XML looks like this (the important data being sent back is the date_stamp attribute in the last_sent element): <eur xmlns="http://www.company.com/ecommerce" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" class="ECommerce_WebService" type="product" method="GetLastDateSent" chunk_no="1" total_chunks="1" date_stamp="2010-03-10T18:22:57.530" version="1.1"> <sec version="1.1" xmlns=""> <data> <last_sent date_stamp="2010-02-25T15:15:10.193" /> </data> </sec> </eur> Now finally, here’s the problem!!! The client does not see any data – all it sees is the parent element with nothing inside it. If I serialize the reply object in the client code it looks like this: <get_dataResponseEur xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" class="ECommerce_WebService" type="product" method="GetLastDateSent" chunk_no="1" total_chunks="1" date_stamp="2010-03-10T18:22:57.53" version="1.1" /> So, my questions are: why isn’t my client seeing the contents of the reply document? how do I fix it? why do I have to put the xmlns attribute on a child element rather than the parent element in the outgoing document? Here’s a bit more possibly relevant info: The client code (pre-namespace) called the service method like this: XmlSerializer serializer = new XmlSerializer(typeof(eur)); XmlReader reader = xml.CreateReader(); eur eur = (eur)serializer.Deserialize(reader); service.Credentials = new NetworkCredential(login, pwd); service.Url = url; rc = service.get_data(ref eur); After the namespace was added I had to change it to this: XmlSerializer serializer = new XmlSerializer(typeof(get_dataEur)); XmlReader reader = xml.CreateReader(); get_dataEur eur = (get_dataEur)serializer.Deserialize(reader); get_dataResponseEur eur1 = new get_dataResponseEur(); service.Credentials = new NetworkCredential(login, pwd); service.Url = url; rc = service.get_data(eur, out eur1);

    Read the article

  • NSOutlineView not refreshing when objects added to managed object context from NSOperations

    - by John Gallagher
    Background Cocoa app using core data Two processes - daemon and a main UI Daemon constantly writing to a data store UI process reads from same data store NSOutlineView in UI is bound to an NSTreeController which is bound to Application with key path of delegate.interpretedMOC What I want When the UI is activated, the outline view should update with the latest data inserted by the daemon. The Problem Main Thread Approach I fetch all the entities I'm interested in, then iterate over them, doing refreshObject:mergeChanges:YES. This works OK - the items get refreshed correctly. However, this is all running on the main thread, so the UI locks up for 10-20 seconds whilst it refreshes. Fine, so let's move these refreshes to NSOperations that run in the background instead. NSOperation Multithreaded Approach As soon as I move the refreshObject:mergeChanges: call into an NSOperation, the refresh no longer works. When I add logging messages, it's clear that the new objects are loaded in by the NSOperation subclass and refreshed. Not only that, but they are What I've tried I've messed around with this for 2 days solid and tried everything I can think of. Passing objectIDs to the NSOperation to refresh instead of an entity name. Resetting the interpretedMOC at various points - after the data refresh and before the outline view reload. I'd subclassed NSOutlineView. I discarded my subclass and set the view back to being an instance of NSOutlineView, just in case there was any funny goings on here. Added a rearrangeObjects call to the NSTreeController before reloading the NSOutlineView data. Made sure I had set the staleness interval to 0 on all managed object contexts I was using. I've got a feeling this problem is somehow related to caching core data objects in memory. But I've totally exhausted all my ideas on how I get this to work. I'd be eternally grateful of any ideas anyone else has. Code Main Thread Approach // In App Delegate -(void)applicationDidBecomeActive:(NSNotification *)notification { // Delay to allow time for the daemon to save [self performSelector:@selector(refreshTrainingEntriesAndGroups) withObject:nil afterDelay:3]; } -(void)refreshTrainingEntriesAndGroups { NSSet *allTrainingGroups = [[[NSApp delegate] interpretedMOC] fetchAllObjectsForEntityName:kTrainingGroup]; for(JGTrainingGroup *thisTrainingGroup in allTrainingGroups) [interpretedMOC refreshObject:thisTrainingGroup mergeChanges:YES]; NSError *saveError = nil; [interpretedMOC save:&saveError]; [windowController performSelectorOnMainThread:@selector(refreshTrainingView) withObject:nil waitUntilDone:YES]; } // In window controller class -(void)refreshTrainingView { [trainingViewTreeController rearrangeObjects]; // Didn't really expect this to have any effect. And it didn't. [trainingView reloadData]; } NSOperation Multithreaded Approach // In App Delegate -(void)refreshTrainingEntriesAndGroups { JGRefreshEntityOperation *trainingGroupRefresh = [[JGRefreshEntityOperation alloc] initWithEntityName:kTrainingGroup]; NSOperationQueue *refreshQueue = [[NSOperationQueue alloc] init]; [refreshQueue setMaxConcurrentOperationCount:1]; [refreshQueue addOperation:trainingGroupRefresh]; while ([[refreshQueue operations] count] > 0) { [[NSRunLoop currentRunLoop] runUntilDate:[NSDate dateWithTimeIntervalSinceNow:0.05]]; [windowController performSelectorOnMainThread:@selector(refreshTrainingView) withObject:nil waitUntilDone:YES]; } // JGRefreshEntityOperation.m @implementation JGRefreshEntityOperation @synthesize started; @synthesize executing; @synthesize paused; @synthesize finished; -(void)main { [self startOperation]; NSSet *allEntities = [imoc fetchAllObjectsForEntityName:entityName]; for(id thisEntity in allEntities) [imoc refreshObject:thisEntity mergeChanges:YES]; [self finishOperation]; } -(void)startOperation { [self willChangeValueForKey:@"isExecuting"]; [self willChangeValueForKey:@"isStarted"]; [self setStarted:YES]; [self setExecuting:YES]; [self didChangeValueForKey:@"isExecuting"]; [self didChangeValueForKey:@"isStarted"]; imoc = [[NSManagedObjectContext alloc] init]; [imoc setStalenessInterval:0]; [imoc setUndoManager:nil]; [imoc setPersistentStoreCoordinator:[[NSApp delegate] interpretedPSC]]; [[NSNotificationCenter defaultCenter] addObserver:self selector:@selector(mergeChanges:) name:NSManagedObjectContextDidSaveNotification object:imoc]; } -(void)finishOperation { saveError = nil; [imoc save:&saveError]; if (saveError) { NSLog(@"Error saving. %@", saveError); } imoc = nil; [self willChangeValueForKey:@"isExecuting"]; [self willChangeValueForKey:@"isFinished"]; [self setExecuting:NO]; [self setFinished:YES]; [self didChangeValueForKey:@"isExecuting"]; [self didChangeValueForKey:@"isFinished"]; } -(void)mergeChanges:(NSNotification *)notification { NSManagedObjectContext *mainContext = [[NSApp delegate] interpretedMOC]; [mainContext performSelectorOnMainThread:@selector(mergeChangesFromContextDidSaveNotification:) withObject:notification waitUntilDone:YES]; } -(id)initWithEntityName:(NSString *)entityName_ { [super init]; [self setStarted:false]; [self setExecuting:false]; [self setPaused:false]; [self setFinished:false]; [NSThread setThreadPriority:0.0]; entityName = entityName_; return self; } @end // JGRefreshEntityOperation.h @interface JGRefreshEntityOperation : NSOperation { NSString *entityName; NSManagedObjectContext *imoc; NSError *saveError; BOOL started; BOOL executing; BOOL paused; BOOL finished; } @property(readwrite, getter=isStarted) BOOL started; @property(readwrite, getter=isPaused) BOOL paused; @property(readwrite, getter=isExecuting) BOOL executing; @property(readwrite, getter=isFinished) BOOL finished; -(void)startOperation; -(void)finishOperation; -(id)initWithEntityName:(NSString *)entityName_; -(void)mergeChanges:(NSNotification *)notification; @end

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Not able to get data from Json completely

    - by Abhinav Raja
    i am getting JSON data from http://abinet.org/?json=1 and displaying the titles in a ListView. the code is working fine but the problem is, it is skipping few titles in my ListView and one title is being repeated. You can see the json data from url given above by copy paste it in JSON editor online http://www.jsoneditoronline.org/ i want titles in the "posts" array to be displayed in ListView, however it is being displayed like this: if you see the JSON data from the link above, its missing like 3 titles (they should come between the first and second title) and 5th title is being repeated. Dont know why this is happening. What minor adjustments i need to do? Please help me. this is my code : public class MainActivity extends Activity { // URL to get contacts JSON private static String url = "http://abinet.org/?json=1"; // JSON Node names private static final String TAG_POSTS = "posts"; static final String TAG_TITLE = "title"; private ProgressDialog pDialog; JSONArray contacts = null; TextView img_url; ArrayList<HashMap<String, Object>> contactList; ListView lv; LazyAdapter adapter; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.activity_main); lv = (ListView) findViewById(R.id.newslist); contactList = new ArrayList<HashMap<String, Object>>(); new GetContacts().execute(); } private class GetContacts extends AsyncTask<Void, Void, Void> { protected void onPreExecute() { super.onPreExecute(); // Showing progress dialog pDialog = new ProgressDialog(MainActivity.this); pDialog.setMessage("Please wait..."); pDialog.setCancelable(false); pDialog.show(); } protected Void doInBackground(Void... arg0) { // Making a request to url and getting response JSONParser jParser = new JSONParser(); // Getting JSON from URL JSONObject jsonObj = jParser.getJSONFromUrl(url); // if (jsonStr != null) { try { // Getting JSON Array node contacts = jsonObj.getJSONArray(TAG_POSTS); // looping through All Contacts for (int i = 0; i < contacts.length(); i++) { // JSONObject c = contacts.getJSONObject(i); JSONObject posts = contacts.getJSONObject(i); String title = posts.getString(TAG_TITLE).replace("&#8217;", "'"); JSONArray attachment = posts.getJSONArray("attachments"); for (int j = 0; j< attachment.length(); j++){ JSONObject obj = attachment.getJSONObject(j); JSONObject image = obj.getJSONObject("images"); JSONObject image_small = image.getJSONObject("thumbnail"); String imgurl = image_small.getString("url"); HashMap<String, Object> contact = new HashMap<String, Object>(); contact.put("image_url", imgurl); contact.put(TAG_TITLE, title); contactList.add(contact); } } } catch (JSONException e) { e.printStackTrace(); } return null; } @Override protected void onPostExecute(Void result) { super.onPostExecute(result); // Dismiss the progress dialog if (pDialog.isShowing()) pDialog.dismiss(); adapter=new LazyAdapter(MainActivity.this, contactList); lv.setAdapter(adapter); } } } this is my JsonParser class (although its not required): public JSONParser() { } public JSONObject getJSONFromUrl(String url) { // Making HTTP request try { // defaultHttpClient DefaultHttpClient httpClient = new DefaultHttpClient(); HttpPost httpPost = new HttpPost(url); HttpResponse httpResponse = httpClient.execute(httpPost); HttpEntity httpEntity = httpResponse.getEntity(); is = httpEntity.getContent(); } catch (UnsupportedEncodingException e) { e.printStackTrace(); } catch (ClientProtocolException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } try { BufferedReader reader = new BufferedReader(new InputStreamReader( is, "iso-8859-1"), 8); StringBuilder sb = new StringBuilder(); String line = null; while ((line = reader.readLine()) != null) { sb.append(line + "n"); } is.close(); json = sb.toString(); } catch (Exception e) { Log.e("Buffer Error", "Error converting result " + e.toString()); } // try parse the string to a JSON object try { jObj = new JSONObject(json); } catch (JSONException e) { Log.e("JSON Parser", "Error parsing data " + e.toString()); } // return JSON String return jObj; } } and this is adapter class: public class LazyAdapter extends BaseAdapter { private Activity activity; private ArrayList<HashMap<String, Object>> data; private static LayoutInflater inflater=null; public LazyAdapter(Activity a,ArrayList<HashMap<String, Object>> d) { activity = a; data=d; inflater = (LayoutInflater)activity.getSystemService(Context.LAYOUT_INFLATER_SERVICE); } public int getCount() { return data.size(); } public Object getItem(int position) { return position; } public long getItemId(int position) { return position; } public View getView(int position, View convertView, ViewGroup parent) { View vi=convertView; if(convertView==null) vi = inflater.inflate(R.layout.third_row, null); TextView title = (TextView)vi.findViewById(R.id.headline3); // title SmartImageView iv = (SmartImageView) vi.findViewById(R.id.imageicon); HashMap<String, Object> song = new HashMap<String, Object>(); song = data.get(position); // Setting all values in listview title.setText((CharSequence) song.get(MainActivity.TAG_TITLE)); iv.setImageUrl((String) song.get("image_url")); thumb_image); return vi; } } Please help me. I am stuck at this for more than a week now. I think there is just something to be changed in my MainActivity class.

    Read the article

  • PHP, MySQL, jQuery, AJAX: json data returns correct response but frontend returns error

    - by Devner
    Hi all, I have a user registration form. I am doing server side validation on the fly via AJAX. The quick summary of my problem is that upon validating 2 fields, I get error for the second field validation. If I comment first field, then the 2nd field does not show any error. It has this weird behavior. More details below: The HTML, JS and Php code are below: HTML FORM: <form id="SignupForm" action=""> <fieldset> <legend>Free Signup</legend> <label for="username">Username</label> <input name="username" type="text" id="username" /><span id="status_username"></span><br /> <label for="email">Email</label> <input name="email" type="text" id="email" /><span id="status_email"></span><br /> <label for="confirm_email">Confirm Email</label> <input name="confirm_email" type="text" id="confirm_email" /><span id="status_confirm_email"></span><br /> </fieldset> <p> <input id="sbt" type="button" value="Submit form" /> </p> </form> JS: <script type="text/javascript"> $(document).ready(function() { $("#email").blur(function() { var email = $("#email").val(); var msgbox2 = $("#status_email"); if(email.length > 3) { $.ajax({ type: 'POST', url: 'check_ajax2.php', data: "email="+ email, dataType: 'json', cache: false, success: function(data) { if(data.success == 'y') { alert('Available'); } else { alert('Not Available'); } } }); } return false; }); $("#confirm_email").blur(function() { var confirm_email = $("#confirm_email").val(); var email = $("#email").val(); var msgbox3 = $("#status_confirm_email"); if(confirm_email.length > 3) { $.ajax({ type: 'POST', url: 'check_ajax2.php', data: 'confirm_email='+ confirm_email + '&email=' + email, dataType: 'json', cache: false, success: function(data) { if(data.success == 'y') { alert('Available'); } else { alert('Not Available'); } } , error: function (data) { alert('Some error'); } }); } return false; }); }); </script> PHP code: <?php //check_ajax2.php if(isset($_POST['email'])) { $email = $_POST['email']; $res = mysql_query("SELECT uid FROM members WHERE email = '$email' "); $i_exists = mysql_num_rows($res); if( 0 == $i_exists ) { $success = 'y'; $msg_email = 'Email available'; } else { $success = 'n'; $msg_email = 'Email is already in use.</font>'; } print json_encode(array('success' => $success, 'msg_email' => $msg_email)); } if(isset($_POST['confirm_email'])) { $confirm_email = $_POST['confirm_email']; $email = ( isset($_POST['email']) && trim($_POST['email']) != '' ? $_POST['email'] : '' ); $res = mysql_query("SELECT uid FROM members WHERE email = '$confirm_email' "); $i_exists = mysql_num_rows($res); if( 0 == $i_exists ) { if( isset($email) && isset($confirm_email) && $email == $confirm_email ) { $success = 'y'; $msg_confirm_email = 'Email available and match'; } else { $success = 'n'; $msg_confirm_email = 'Email and Confirm Email do NOT match.'; } } else { $success = 'n'; $msg_confirm_email = 'Email already exists.'; } print json_encode(array('success' => $success, 'msg_confirm_email' => $msg_confirm_email)); } ?> THE PROBLEM: As long as I am validating the $_POST['email'] as well as $_POST['confirm_email'] in the check_ajax2.php file, the validation for confirm_email field always returns an error. With my limited knowledge of Firebug, however, I did find out that the following were the responses when I entered email and confirm_email in the fields: RESPONSE 1: {"success":"y","msg_email":"Email available"} RESPONSE 2: {"success":"y","msg_email":"Email available"}{"success":"n","msg_confirm_email":"Email and Confirm Email do NOT match."} Although the RESPONSE 2 shows that we are receiving the correct message via msg_confirm_email, in the front end, the alert 'Some error' is popping up (I have enabled the alert for debugging). I have spent 48 hours trying to change every part of the code wherever possible, but with only little success. What is weird about this is that if I comment the validation for $_POST['email'] field completely, then the validation for $_POST['confirm_email'] field is displaying correctly without any errors. If I enable it back, it is validating email field correctly, but when it reaches the point of validating confirm_email field, it is again showing me the error. I have also tried renaming success variable in check_ajax2.php page to other different names for both $_POST['email'] and $_POST['confirm_email'] but no success. I will be adding more fields in the form and validating within the check_ajax2.php page. So I am not planning on using different ajax pages for validating each of those fields (and I don't think it's smart to do it that way). I am not a jquery or AJAX guru, so all help in resolving this issue is highly appreciated. Thank you in advance.

    Read the article

  • Android Multiple objects in SimpleAdapter

    - by Adam Sherratt
    I have a need (unless you can think of a better way) of passing multiple objects to a custom list adapter. I know that I'm barking up the wrong tree here, and would appreciate someone setting me on the right course! Thanks playlistadapter = new MyPlaylistAdapter(MyApplication.getAppContext(), songsList, retained_songsList, folderMode, R.layout.file_view, new String[] { "songTitle","songAlbum", "songPath" }, new int[] { R.id.checkTextView, R.id.text2, R.id.text3 }); And my adapter class: public class MyPlaylistAdapter extends SimpleAdapter{ private ArrayList <Song> songsList = new ArrayList<Song>(); private ArrayList <Song> retained_songsList = new ArrayList<Song>(); private ArrayList<Song> playlistcheck = new ArrayList<Song>(); private String folderMode; private String TAG = "AndroidMediaCenter"; public MyPlaylistAdapter(Context context,List<Song> SongsList, List<Song> Retained_songsList, String FolderMode,int resource, String[] from, int[] to) { super(context, null, resource, from, to); songsList.clear(); songsList.addAll(SongsList); Log.i(TAG, "MyPlayListAdapter Songslist = " + songsList.size()); retained_songsList.clear(); retained_songsList.addAll(Retained_songsList); folderMode = FolderMode; } public View getView(int position, View convertView, ViewGroup parent) { //PlayListViewHolder holder; CheckedTextView checkTextView; TextView text2; TextView text3; if (convertView == null) { LayoutInflater inflater = (LayoutInflater) MyApplication.getAppContext().getSystemService(Context.LAYOUT_INFLATER_SERVICE); //LayoutInflater inflater=getLayoutInflater(); convertView=inflater.inflate(R.layout.file_view, parent, false); //convertView.setBackgroundColor(0xFF00FF00 ); //holder = new PlayListViewHolder(); checkTextView = (CheckedTextView) convertView.findViewById(R.id.checkTextView); text2 = (TextView) convertView.findViewById(R.id.text2); text3 = (TextView) convertView.findViewById(R.id.text3); //convertView.setTag(holder); } else { //holder = (PlayListViewHolder) convertView.getTag(); } //put something into textviews String tracks = null; String tracks_Details = null; String trackspath = null; tracks = songsList.get(position).getSongTitle(); tracks_Details = songsList.get(position).getAlbum() + " (" + songsList.get(position).getArtist() + ")"; trackspath = songsList.get(position).getSongPath(); checkTextView = (CheckedTextView) convertView.findViewById(R.id.checkTextView); text2 = (TextView) convertView.findViewById(R.id.text2); text3 = (TextView) convertView.findViewById(R.id.text3); checkTextView.setText(tracks); if(folderMode.equals("Playlists")){ checkTextView.setBackgroundColor(Color.GREEN); checkTextView.setChecked(false); try { int listsize_rs = retained_songsList.size(); for (int j = 0; j<listsize_rs;j++){ if((retained_songsList.get(j).getSongPath()).equals(songsList.get(position).getSongPath())){ checkTextView.setBackgroundColor(Color.TRANSPARENT); //Need to check here whether the checkedtextview is ticked or not checkTextView.setChecked(true); playlistcheck.add(songsList.get(position)); break; } } } catch (Exception e) { e.printStackTrace(); } }else { //Need to check here whether the checkedtextview is ticked or not try { if (songsList.get(position).getSongCheckedStatus()==true){ checkTextView.setChecked(true); }else{ checkTextView.setChecked(false); } } catch (Exception e) { e.printStackTrace(); } } text2.setText(tracks_Details); text3.setText(trackspath); Log.i(TAG, "MyPlayListAdapter Songslist = " + songsList.size()); return convertView; } } However, this doesn't inflate, throwing the following errors: 10-26 23:11:09.464: E/AndroidRuntime(2826): FATAL EXCEPTION: main 10-26 23:11:09.464: E/AndroidRuntime(2826): java.lang.RuntimeException: Error receiving broadcast Intent { act=android.intent.action.GetMusicComplete flg=0x10 } in com.Nmidia.AMC.MusicActivity$18@414c5770 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.LoadedApk$ReceiverDispatcher$Args.run(LoadedApk.java:765) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Handler.handleCallback(Handler.java:615) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Handler.dispatchMessage(Handler.java:92) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Looper.loop(Looper.java:137) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.ActivityThread.main(ActivityThread.java:4745) 10-26 23:11:09.464: E/AndroidRuntime(2826): at java.lang.reflect.Method.invokeNative(Native Method) 10-26 23:11:09.464: E/AndroidRuntime(2826): at java.lang.reflect.Method.invoke(Method.java:511) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:786) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:553) 10-26 23:11:09.464: E/AndroidRuntime(2826): at dalvik.system.NativeStart.main(Native Method) 10-26 23:11:09.464: E/AndroidRuntime(2826): Caused by: java.lang.NullPointerException 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.widget.SimpleAdapter.getCount(SimpleAdapter.java:93) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.widget.ListView.setAdapter(ListView.java:460) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.Nmidia.AMC.MusicActivity.setFilterMusic(MusicActivity.java:1230) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.Nmidia.AMC.MusicActivity$18.onReceive(MusicActivity.java:996) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.LoadedApk$ReceiverDispatcher$Args.run(LoadedApk.java:755) 10-26 23:11:09.464: E/AndroidRuntime(2826): ... 9 more

    Read the article

  • How can I use curl to login multiple users from one php script

    - by kamal
    Here is the scenario: I have configured multiple users with login names aa1, aa2 .. zz99 , all with the same password, now i want to login to a php based server with these login ID's. I have a working script that logs in one user with a username and password, and using curl, browses to a target page: // Assume php , since somehow the php encapsulation quotes were giving me trouble $sHost = $argv[2]; $sStart = $argv[3]; $sReqId = $argv[4]; $sPage = $argv[5]; $sReqLogFile = $argv[6]; $sRespLogFile = $argv[7]; $sUserName = $argv[8]; $sPassword = $argv[9]; $sExecDelay = $argv[10]; //optional args: if($argc 11) { $sCommonSID = $argv[11]; } //$sXhprofLogFile = ""; $sSysStatsLogFile= ""; $sBaseUrl = 'https://'.$sHost.'/'; $nExecTime = 0; $sCookieFileName = 'cookiejar/'.genRandomString().'.txt'; touch($sCookieFileName); // Set the execution delay: $sStart += $sExecDelay; // Get the PHP Session Id: if(isset($sCommonSID)) { $sSID = $sCommonSID; }else{ $sSID = getSID($sHost,$sBaseUrl, $sUserName, $sPassword); } // Sleep for 100us intervals until we reach the stated execution time: do { usleep(100); }while(getFullMicrotime()$sPage, "pageUrl"=$sBaseUrl, "execStart" =$nExecStart, "execEnd"=$nExecEnd, "respTime"=$nExecTime, "xhprofToken"=$sXhpToken, "xhprofLink"=$sXhpLink, "fiveMinLoad"=$nFiveMinLoad); }else{ $nExecStart = 0; $sUrl = "***ERROR***"; $aReturn = null; } writeReqLog($sReqId, $nExecStart, $sSID, $sUrl, $sReqLogFile); return $aReturn; } function getFullMicrotime() { $fMtime = microtime(true); if(strpos($fMtime, ' ') !== false) { list($nUsec, $nSec) = explode(' ', $fMtime); return $nSec + $nUsec; } return $fMtime; } function writeRespLog($nReqId, $sHost, $sPage, $sSID = "***ERROR***", $nExecStart = 0, $nExecEnd = 0, $nRespTime = 0, $sXhpToken = "", $sXhpLink = "", $nFiveMinLoad = 0, $sRespLogFile) { $sMsg = $nReqId; $sMsg .= "\t".$sHost; $sMsg .= "/".$sPage; $sMsg .= "\t".$sSID; $sMsg .= "\t".$nExecStart; $sMsg .= "\t".$nExecEnd; $sMsg .= "\t".$nRespTime; $sMsg .= "\t".$sXhpToken; $sMsg .= "\t".$nFiveMinLoad; error_log($sMsg."\n",3,$sRespLogFile); } function writeReqLog($nReqId, $nExecStart, $sSID, $sUrl, $sReqLogFile) { $sMsg = $nReqId; $sMsg .= "\t".$sUrl; $sMsg .= "\t".$sSID; $sMsg .= "\t".$nExecStart; error_log($sMsg."\n",3,$sReqLogFile); } function parseSIDValue($sText) { $sSID = ""; preg_match('/SID:(.*)/',$sText, $aSID); if (count($aSID)) { $sSID = $aSID[1]; } return $sSID; } function parseFiveMinLoad($sText) { $nLoad = 0; $aMatch = array(); preg_match('/--5-MIN-LOAD:(.*)--/',$sText, $aMatch); if (count($aMatch)) { $nLoad = $aMatch[1]; } return $nLoad; } function curlRequest($sUrl, $sSID="") { global $sCookieFileName; $ch = curl_init(); curl_setopt($ch, CURLOPT_URL, $sUrl); curl_setopt($ch, CURLOPT_SSL_VERIFYPEER, FALSE); curl_setopt($ch, CURLOPT_SSL_VERIFYHOST, 2); curl_setopt($ch, CURLOPT_HEADER, 1); curl_setopt($ch, CURLOPT_USERAGENT, "Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.0)"); curl_setopt($ch, CURLOPT_RETURNTRANSFER,1); if($sSID == "") { curl_setopt($ch, CURLOPT_COOKIEJAR, $sCookieFileName); } else { curl_setopt($ch, CURLOPT_COOKIEFILE, $sCookieFileName); } $result =curl_exec ($ch); curl_close ($ch); return $result; } function parseXHProfToken($sPageContent) { //https://ktest.server.net/xhprof/xhprof_html/index.php?run=4d004b280a990&source=mybox $sToken = ""; $sRelLink = ""; $aMatch = array(); $aResp = array(); preg_match('/$sToken, "relLink"=$sRelLink); return $aResp; } function genRandomString() { $length = 10; $characters = '0123456789abcdefghijklmnopqrstuvwxyz'; $string = ''; for ($p = 0; $p

    Read the article

  • Send mail to multiple recipient

    - by Ahmad Maslan
    Hi, i have already research on using the mail() to send to multiple recipient's but i just cant get it to work. What im trying to do is, for every order that i have, order 1,2,3, each having their own email addresses, when i change their order status from pending to confirm, the mail() will use that id to refer to the db table and send the email of those 3 orders. But for my case, it mailed just the latest order which is order 3. This is the form that i use to change the order status. <form action="results-action" method="post" enctype="multipart/form-data"> <fieldset> <table id ="table_id" class="display"> <thead> <tr><td><h2>Pending Order</h2></td></tr> <tr> <th scope="col">Order ID</th> <th scope="col"> </th> <th scope="col">Name</th> <th scope="col">Address</th> <th scope="col">Product Name</th> <th scope="col">Produt Quantity</th> <th scope="col">Price</th> <th scope="col">Order status</th> </tr> </thead> <tbody> <?php while ($row = mysqli_fetch_array($result)) { ?> <tr> <td><input type="text" value='<?=$row['virtuemart_order_id']?>' name="orderid" id="virtuemart_order_id"></td> <td><input type="hidden" value='<?=$row['virtuemart_product_id']?>' name="productid" id="virtuemart_product_id"></td> <td><?=$row['first_name']?></td> <td><?=$row['address_1']?></td> <td><?=$row['order_item_name']?></td> <td><?=$row['product_quantity']?></td> <td><?=$row['product_final_price'] ?></td> <td><select name='change[<?=$row['virtuemart_order_id']?>]'> <option value='C'> Confirmed</option> <option value='X'> Cancelled</option></select></td> </tr> <?php } ?> </tbody> </table> </fieldset> <fieldset> <table> <tr> <td><input type="submit" value="Update status" name="update status"> </td> </tr> </table> </fieldset> </form> This is the php, using the order id from the form to select the email addresses. <?php $orderid = $_POST['orderid']; // build SQL statement to select email addresses $query3 = "SELECT email from ruj3d_virtuemart_order_userinfos where virtuemart_order_id = '$orderid'"; // execute SQL statement $result3 = mysqli_query($link, $query3) or die(mysqli_error($link)); $subject = "Order confirmed by Home and decor"; $message = "Hello! This is a message to inform that your order has been confirmed"; $from = "[email protected]"; $headers = "From: $from"; while($row3 = mysqli_fetch_array($result3)){ $addresses[] = $row3['email']; } $to = implode(",", $addresses); mail($to, $subject, $message, $headers); ?>

    Read the article

  • Changing multiple objects with a new class name using Jquery

    - by liquilife
    I'd like to click on a trigger and show a specific image. There are multiple triggers which would show a specific image related to it within a set. There are 4 sets The challenge for me is toggling the other images to hide only in this 'set' when one of these triggers are clicked, as there can only be one image showing at a time in each set. Here is the HTML I've put together thus far: <!-- Thumbnails which can be clicked on to toggle the larger preview image --> <div class="materials"> <a href="javascript:;" id="shirtgrey"><img src="/grey_shirt.png" height="122" width="122" /></a> <a href="javascript:;" id="shirtred"><img src="red_shirt.png" height="122" width="122" /></a> <a href="javascript:;" id="shirtblue"><img src="hblue_shirt.png" height="122" width="122" /></a> <a href="javascript:;" id="shirtgreen"><img src="green_shirt.png" height="122" width="122" /></a> </div> <div class="collars"> <a href="javascript:;" id="collargrey"><img src="grey_collar.png" height="122" width="122" /></a> <a href="javascript:;" id="collarred"><img src="red_collar.png" height="122" width="122" /></a> <a href="javascript:;" id="collarblue"><img src="blue_collar.png" height="122" width="122" /></a> <a href="javascript:;" id="collargreen"><img src="green_collar.png" height="122" width="122" /></a> </div> <div class="cuffs"> <a href="javascript:;" id="cuffgrey"><img src="grey_cuff.png" height="122" width="122" /></a> <a href="javascript:;" id="cuffred"><img src="red_cuff.png" height="122" width="122" /></a> <a href="javascript:;" id="cuffblue"><img src="blue_cuff.png" height="122" width="122" /></a> <a href="javascript:;" id="cuffgreen"><img src="/green_cuff.png" height="122" width="122" /></a> </div> <div class="pockets"> <a href="javascript:;" id="pocketgrey"><img src="grey_pocket.png" height="122" width="122" /></a> <a href="javascript:;" id="pocketred"><img src=".png" height="122" width="122" /></a> <a href="javascript:;" id="pocketblue"><img src="blue_pocket.png" height="122" width="122" /></a> <a href="javascript:;" id="pocketgreen"><img src="green_pocket.png" height="122" width="122" /></a> </div> <!-- The larger images where one from each set should be viewable at one time, triggered by the thumb clicked above --> <div class="selectionimg"> <div class="selectShirt"> <img src="grey_shirt.png" height="250" width="250" class="selectShirtGrey show" /> <img src="red_shirt.png" height="250" width="250" class="selectShirtRed hide" /> <img src="blue_shirt.png" height="250" width="250" class="selectShirtBlue hide" /> <img src="green_shirt.png" height="250" width="250" class="selectShirtGreen hide" /> </div> <div class="selectCollar"> <img src="grey_collar.png" height="250" width="250" class="selectCollarGrey show" /> <img src="red_collar.png" height="250" width="250" class="selectCollarRed hide" /> <img src="blue_collar.png" height="250" width="250" class="selectCollarBlue hide" /> <img src="green_collar.png" height="250" width="250" class="selectCollarGreen hide" /> </div> <div class="selectCuff"> <img src="grey_cuff.png" height="250" width="250" class="selectCuffGrey show" /> <img src="red_cuff.png" height="250" width="250" class="selectCuffRed hide" /> <img src="blue_cuff.png" height="250" width="250" class="selectCuffBlue hide" /> <img src="green_cuff.png" height="250" width="250" class="selectCuffGreen hide" /> </div> <div class="selectPocket"> <img src="grey_pocket.png" height="250" width="250" class="selectPocketGrey show" /> <img src="hred_pocket.png" height="250" width="250" class="selectPocketRed hide" /> <img src="blue_pocket.png" height="250" width="250" class="selectPocketBlue hide" /> <img src="green_pocket.png" height="250" width="250" class="selectPocketGreen hide" /> </div> </div> How can jQuery be used to change a class of an image to "show" and ensure that all other images in that same div are set to a class of "hide"? First time posting here. I'm very efficient with HTML and CSS and have a basic understanding of jQuery. I'm learning and this just seems a little bit beyond my abilities at the moment. I hope this all makes sense. Thanks for any help.

    Read the article

  • Dropped hard drive won't mount

    - by Dave DeLong
    I have a 2 TB HFS+-formatted external hard drive that got dropped a couple of days ago while transferring files onto a Macbook Pro. Now the drive's partitions won't mount. Disk Utility can see the drive, but doesn't recognize that it has any partitions. I've tried using Data Rescue 2 to recover files off of it, but it couldn't find anything. In addition, our local computer repair shop said they couldn't find anything on there either. I know that I could ship the drive off to someone like DriveSavers, but I was hoping for a cheaper option (since they start at about $500 for the attempt). Is there something else I could try on my own? Would TestDisk be able to help with something like this?

    Read the article

  • Can't install Windows 7 on Acer Aspire M1100

    - by r0ca
    When I install Windows 7, everything goes smooth but as soon as it's done and Windows needs to reboot for the last time before getting the desktop, the computer stucks to Verify DMI Pool Data............. and then, nothing. I change the CMOS battery, I tried so many setup in BIOS, even load default settings... Nothing worked. The HDD light is not flickering anymore, no HDD activity. CTRL-ALT-DEL doesn't work. It's just impossible to load Windows 7. I tried Windows XP and this works fine. I also tried the Acer (Futureshop) recovery CD and I get an Hexademical error message stating the install cannot continue. Is there a BIOS flash apps somewhere or a fix I can apply to have Windows 7 Ultimate installed on my computer. Any takers?

    Read the article

< Previous Page | 483 484 485 486 487 488 489 490 491 492 493 494  | Next Page >