Search Results

Search found 17443 results on 698 pages for 'base convert'.

Page 49/698 | < Previous Page | 45 46 47 48 49 50 51 52 53 54 55 56  | Next Page >

  • jQuery arange li order base on #ID

    - by Mircea
    Hi, I have the following code: <ul> <li id="project_25">Proj Something</li> <li id="project_26">Proj Blah</li> <li id="project_27">Proj Else</li> <li id="project_31">Proj More</li> ... </ul> Is there a way to arrange these LIs, reverse their order, based on the LI ID? Something like: <ul> <li id="project_31">Proj More</li> <li id="project_27">Proj Else</li> <li id="project_26">Proj Blah</li> <li id="project_25">Proj Something</li> ... </ul> Thank you.

    Read the article

  • Script or Utility to convert .nab to .csv without importing double entries in Outlook

    - by Chris
    Currently our environment is migrating from Groupwise 7 to Outlook 2003 and we have multiple users with mission critical outside contacts in their frequent contacts that will have to be imported in Outlook. Currently our only solution is to export GW contacts to a .nab, import to excel to scrub out the contacts in our own domain (to avoid double entry) and convert to .csv. This current solution will require a lot of man hours for hand holding because most of our users are not technically savvy AT ALL and are frankly too busy to do this themselves. Anyone know of any kind of tool or script to assist with this?

    Read the article

  • What is this video format, and how do I convert It

    - by OrangeRind
    Description I have a big (7.4G) .mkv file (1080p) which I want to convert to H.264 (using x264) Problem MediaCoder and GSpot are unable to detect the codec. They don't display anything. Just that the file is a matroska Container Video with a MIMEtype of video/x-matroska. No bitrate, profile etc. But the source tells me that is VC-1 encoded. Question So how do I encode this file. as in, using what encoding software, since MediaCoder has failed.

    Read the article

  • Getting all types from an assembly derived from a base class

    - by CaptnCraig
    I am trying to examine the contents of an assembly and find all classes in it that are directly or indirectly derived from Windows.Forms.UserControl. I am doing this: Assembly dll = Assembly.LoadFrom(filename); var types = dll.GetTypes().Where(x => x.BaseType == typeof(UserControl)); But it is giving an empty list because none of the classes directly extend UserControl. I don't know enough about reflection to do it quickly, and I'd rather not write a recursive function if I don't have to.

    Read the article

  • Need to create a string token dynamically base on which method is calling it

    - by sa
    This is a minimal code. I have the string Str which is used by various methods. I want to in getId method be able to do 2 things Assign class="PDP" to it and Give it a value3 So the final string looks like <tr class='PDP' id='{2}'> <td {0}</td><td>{1}</td></tr> But please note that I will need different values for class in different methods so some Str will have PDP, another will have PTM etc. Is there a clean way to achieve this . private const string Str = "<tr><td >{0}</td><td>{1}</td></tr>"; public static string getId() { string field=string.Format(str, value1,value2, found=true? value3:""); }

    Read the article

  • Convert XML to UDT in Oracle

    - by Josh
    Is there an easy way to convert an XMLType to a User Defined Type? I can convert the UDT to XMLType using the below. select SYS_XMLGEN(pUDT) into param2 from dual; I can't though, is find a function that takes that and turns it back into that UDT using the same mappings the SYS_XMLGEN used.

    Read the article

  • Dynamic WCF base addresses in SharePoint

    - by Paul Bevis
    I'm attempting to host a WCF service in SharePoint. I have configured the service to be compatible with ASP.NET to allow me access to HttpContext and session information [AspNetCompatibilityRequirements(RequirementsMode = AspNetCompatibilityRequirementsMode.Required)] public class MISDataService : IMISDataService { ... } And my configuration looks like this <system.serviceModel> <serviceHostingEnvironment aspNetCompatibilityEnabled="true" /> <services> <service name="MISDataService"> <endpoint address="" binding="webHttpBinding" contract="MISDataViews.IMISDataService" /> </service> </services> </system.serviceModel> Whilst this gives me access to the current HTTP context, the serivce is always hosted under the root domain, i.e. http://www.mydomain.com/_layouts/MISDataService.svc. In SharePoint the URL being accessed gives you specific context information about the current site via the SPContext class. So with the service hosted in a virtual directory, I would like it to be available on mulitple addresses e.g. http://www.mydomain.com/_layouts/MISDataService.svc http://www.mydomain.com/sites/site1/_layouts/MISDataService.svc http://www.mydomain.com/sites/site2/_layouts/MISDataService.svc so that the service can figure out what data to return based upon the current context. Is it possible to configure the endpoint address dynamically? Or is the only alternative to host the service in one location and then pass the "context" to it some how?

    Read the article

  • convert class object collection to List

    - by prince23
    hi, here i have an return type as class object collection. where Emp is class , having properties like Fname, lname,Age WebApplication1.kumar .Job Emp = objEmp.GetJobInfo2(1); i need to convert the oject collections into List List objEmp = new List(); what is the steps that i need to do here to convert class object to List thanks in advance

    Read the article

  • how do I base encode a binary file (JPG) in ruby

    - by Angela
    I have a binary files which needs to be sent as a string to a third-party web-service. Turns out it requires that it needs to be base64 encoded. In ruby I use the following: body = body << IO.read("#{@postalcard.postalimage.path}") body is a strong which conists of a bunch of strings as parameters. So...how do I base64 encode it into this string? Thanks.

    Read the article

  • Convert GMT time to local time

    - by Dibish
    Am getting a GMT time from my server in this format Fri, 18 Oct 2013 11:38:23 GMT My requirement is to convert this time to local time using Javascript, eg:/ if the user is from India, first i need to take the time zone +5.30 and add that to my servertime and convert the time string to the following format 2013-10-18 16:37:06 I tried with following code but not working var date = new Date('Fri, 18 Oct 2013 11:38:23 GMT'); date.toString(); Please help me to solve this issue, Thanks in advance

    Read the article

  • Count in base 2, 3, 4 etc in Java and output all permutations

    - by tree-hacker
    I want to write a function in Java that takes as input an integer and outputs every possible permutation of numbers up to that integer. For example: f(1) 0 f(2) should output: 00 01 10 11 f(3) should output: 000 001 002 010 011 012 020 021 022 100 .... 220 221 222 That is it should output all 27 permutations of the digits of the numbers 0, 1, 2. f(4) should output 0000 0001 0002 0003 0010 ... 3330 3331 3332 3333 f(4) should output 00000 00001 ... 44443 44444 I have been trying to solve this problem but cannot seem to work out how to do it and keep getting confused by how many loops I need. Does anyone know how to solve this problem? Thanks in advance.

    Read the article

  • Problem accessing base member in derived constructor

    - by LeopardSkinPillBoxHat
    Given the following classes: class Foo { struct BarBC { protected: BarBC(uint32_t aKey) : mKey(aKey) mOtherKey(0) public: const uint32_t mKey; const uint32_t mOtherKey; }; struct Bar : public BarBC { Bar(uint32_t aKey, uint32_t aOtherKey) : BarBC(aKey), mOtherKey(aOtherKey) // Compile error here }; }; I am getting a compilation error at the point indicated: error: class `Foo::Bar' does not have any field named `mOtherKey'. Can anyone explain this? I suspect it's a syntactical problem due to my Bar class being defined within the Foo class, but can't seem to find a way around it. This is simple public inheritance, so mOtherKey should be accessible from the Bar constructor. Right? Or is it something to do with the fact that mOtherKey is const and I have already initialised it to 0 in the BarBC constructor?

    Read the article

  • How to convert a BufferedImage to 8 bit?

    - by Zach Sugano
    I was looking at the ImageConverter class, trying to figure out how to convert a BufferedImage to 8-bit color, but I have no idea how I would do this. I was also searching around the internet and I could find no simple answer, they were all talking about 8 bit grayscale images. I simply want to convert the colors of an image to 8 bit... nothing else, no resizing no nothing. Does anyone mind telling me how to do this.

    Read the article

  • cannot set a variable to base on user input post method

    - by user1318960
    Hello i´m trying to set info from a post method into a variable that sets a session named name the value that the user input. I get the following error: Notice: Undefined index: name in F:\xampp\htdocs\Impossible game\index.php on line 18 This is line 18: $session = $_POST['name']; <form action="ms1.php" method="POST"> Name <input type="text" name="name"> <input type="Submit" value="Begin"> </form> <?php $session = $_POST['name']; session_start(); $_SESSION['name'] = $session;

    Read the article

  • How to Execute Page_Load() in Page's Base Class?

    - by DaveDev
    I have the following PerformanceFactsheet.aspx.cs page class public partial class PerformanceFactsheet : FactsheetBase { protected void Page_Load(object sender, EventArgs e) { // do stuff with the data extracted in FactsheetBase divPerformance.Controls.Add(this.Data); } } where FactsheetBase is defined as public class FactsheetBase : System.Web.UI.Page { public MyPageData Data { get; set; } protected void Page_Load(object sender, EventArgs e) { // get data that's common to all implementors of FactsheetBase // and store the values in FactsheetBase's properties this.Data = ExtractPageData(Request.QueryString["data"]); } } The problem is that FactsheetBase's Page_Load is not executing. Can anyone tell me what I'm doing wrong? Is there a better way to get the result I'm after? Thanks

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Storing data locally and synchronizing it with data base on linux server

    - by Miraaj
    Hi all, I have developed a mac application, which is continuously interacting with database on linux server. As data is increasing it has become costlier affair in terms of time to fetch data from server. So I am planning to store required data locally, say on mysqlite and find some mechanism through which I can synchronize it with database on linux server. Can anyone suggest me some way to accomplish it? Thanks, Miraaj

    Read the article

  • Custom Image Button and Radio/Toggle Button from Common Base Class

    - by Wonko the Sane
    Hi All, I would like to create a set of custom controls that are basically image buttons (it's a little more complex than that, but that's the underlying effect I'm going for) that I've seen a few different examples for. However, I would like to further extend that to also allow radio/toggle buttons. What I'd like to do is have a common abstract class called ImageButtonBase that has default implementations for ImageSource and Text, etc. That makes a regular ImageButton implementation pretty easy. The issue I am having is creating the RadioButton flavor of it. As I see it, there are at least three options: It would be easy to create something that derives from RadioButton, but then I can't use the abstract class I've created. I could change the abstract class to an interface, but then I lose the abstract implementations, and will in fact have duplication of code. I could derive from my abstract class, and re-implement the RadioButton-type properties and events (IsChecked, GroupName, etc.), but that certainly doesn't seem like a great idea. Note: I have seen http://stackoverflow.com/questions/2362641/how-to-get-a-group-of-toggle-buttons-to-act-like-radio-buttons-in-wpf, but what I want to do is a little more complex. I'm just wondering if anybody has an example of an implementation, or something that might be adapted to this kind of scenario. I can see pros and cons of each of the ideas above, but each comes with potential pitfalls. Thanks, wTs

    Read the article

  • How to get base url with php?

    - by shin
    I am using XAMPP on windows vista. In my development, I have http://127.0.0.1/test_website/ Now I would like get this http://127.0.0.1/test_website/ with php. I tried something like these, but none of them worked. echo dirname(__FILE__) or echo basename(__FILE__); etc. I will appreciate any help. Thanks in advance.

    Read the article

< Previous Page | 45 46 47 48 49 50 51 52 53 54 55 56  | Next Page >