Search Results

Search found 13958 results on 559 pages for 'ex mode'.

Page 519/559 | < Previous Page | 515 516 517 518 519 520 521 522 523 524 525 526  | Next Page >

  • ASP.NET MVC Custom Error Pages with Magical Unicorn

    - by FLClover
    my question is regarding Pure.Kromes answer to this post. I tried implementing my pages' custom error messages using his method, yet there are some problems I can't quite explain. a) When I provoke a 404 Error by entering in invalid URL such as localhost:3001/NonexistantPage, it defaults to the ServerError() Action of my error controller even though it should go to NotFound(). Here is my ErrorController: public class ErrorController : Controller { public ActionResult NotFound() { Response.TrySkipIisCustomErrors = true; Response.StatusCode = (int)HttpStatusCode.NotFound; var viewModel = new ErrorViewModel() { ServerException = Server.GetLastError(), HTTPStatusCode = Response.StatusCode }; return View(viewModel); } public ActionResult ServerError() { Response.TrySkipIisCustomErrors = true; Response.StatusCode = (int)HttpStatusCode.InternalServerError; var viewModel = new ErrorViewModel() { ServerException = Server.GetLastError(), HTTPStatusCode = Response.StatusCode }; return View(viewModel); } } My error routes in Global.asax.cs: routes.IgnoreRoute("{resource}.axd/{*pathInfo}"); routes.IgnoreRoute("{*favicon}", new { favicon = @"(.*/)?favicon.ico(/.*)?" }); routes.MapRoute( name: "Error - 404", url: "NotFound", defaults: new { controller = "Error", action = "NotFound" } ); routes.MapRoute( name: "Error - 500", url: "ServerError", defaults: new { controller = "Error", action = "ServerError" } ); And my web.config settings: <system.web> <customErrors mode="On" redirectMode="ResponseRewrite" defaultRedirect="/ServerError"> <error statusCode="404" redirect="/NotFound" /> </customErrors> ... </system.web> <system.webServer> <httpErrors errorMode="Custom" existingResponse="Replace"> <remove statusCode="404" subStatusCode="-1" /> <error statusCode="404" path="/NotFound" responseMode="ExecuteURL" /> <remove statusCode="500" subStatusCode="-1" /> <error statusCode="500" path="/ServerError" responseMode="ExecuteURL" /> </httpErrors> ... The Error views are located in /Views/Error/ as NotFound.cshtml and ServerError.cshtml. b) One funny thing is, When a server error occurs, it does in fact display the Server Error view I defined, however it also outputs a default error message as well saying that the Error page could not be found. Here's how it looks like: Do you have any advice how I could fix these two problems? I really like Pure.Kromes approach to implementing these error messages, but if there are better ways of achieving this don't hestitate to tell me. Thanks! *EDIT : * I can directly navigate to my views through the ErrorController by accessing /Error/NotFound or Error/ServerError. The views themselves only contain some text, no markup or anything. As I said, it actually works in some way, just not the way I intended it to work. There seems to be an issue with the redirect in the web.config, but I haven't been able to figure it out.

    Read the article

  • Mootools Accordion nonfunctional in Opera

    - by nona
    While working as expected in all other browsers, opera refuses to tween the height of content. oddly enough, as i sat annoyed rapidly clicking it over and over again, if it's closed, and you select some text, and keep clicking the same spot long enough, sometimes it pops open. lol. seriously. ahh, it seems to sometimes open the first time clicked after the page is loaded. wth? the javascript: window.addEvent('domready', function(){ var content_height = [];i=0; $$( '.bio_accordion' ).each(function(item){ i++; content_height.push(item.getElement('.moreInfo').offsetHeight); var thisSlider = new Fx.Slide( item.getElement( '.moreInfo' ), { mode: 'horizontal' } ); thisSlider.hide(); item.getElement('.moreInfo').set('tween').tween('height', '0px'); var morph = new Fx.Morph(item.getElement( '.divToggle' )); var selected = 0; item.getElement( '.divToggle' ).addEvents({ 'mouseenter': function(){ if(!selected) this.morph('.div_highlight'); }, 'mouseleave': function(){ if(!selected) { this.morph('.divToggle'); } }, 'click': function(){ if (!selected){ if (this.getElement('.symbol').innerHTML == '+') this.getElement('.symbol').innerHTML = '-'; else this.getElement('.symbol').innerHTML = '+'; item.getElement('.moreInfo').set('tween', { duration: 1500, transition: Fx.Transitions.Bounce.easeOut }).tween('height', content_height[i]); selected = 1; thisSlider.slideIn(); } else{ if (this.getElement('.symbol').innerHTML == '+') this.getElement('.symbol').innerHTML = '-'; else this.getElement('.symbol').innerHTML = '+'; thisSlider.slideOut(); item.getElement('.moreInfo').set('tween', { duration: 1000, transition: Fx.Transitions.Bounce.easeOut }).tween('height', '0px'); selected = 0; } } }); } ); }); the html: <div class="bio_accordion"> <div class="divToggle">test<span class="symbol">-</span></div> <div class="moreInfo" style="margin-left:10px;"> aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa asdfasdfasdfasdfasdfasdfasdfasdfasdfasdfasdf aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa asdfasdfasdfasdfasdfasdfasdfasdfasdfasdfasdf aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa asdfasdfasdfasdfasdfasdfasdfasdfasdfasdfasdf </div> </div> the css: .bio_accordion { padding:0px; margin:0px; } .divToggle { cursor: pointer; color: #ffffff; background-color:#1089b5; padding: 8px; } .div_highlight { padding-left:30px; padding-right:30px; background-color:#096687; } .moreInfo { padding: 2px; padding-top:15px; padding-bottom:15px; overflow: hidden; } .symbol { float:right; }

    Read the article

  • FormsAuthentication redirecting to login page when visiting root of website

    - by Ryan Lattimer
    I wanted to use FormsAuthentication to secure my static files as well on my site, so I followed the instructions located here http://learn.iis.net/page.aspx/244/how-to-take-advantage-of-the-iis7-integrated-pipeline/ under title "Enabling Forms Authentication for the Entire Application". Now though, when I try to visit the site by going directly to http://www.mysite.com I get redirected to http://www.mysite.com/Login.aspx?ReturnUrl=%2f instead of it using my DefaultDocument I have set. I can go to my default document by just visiting http://www.mysite.com/Home.aspx without any issues because it is set to allow anonymous access. Is there something I need to add into my web.config file to make iis7 allow anonymous access to the root? I tried adding with anonymous access but no such luck. Any help would be much appreciated. Both Home and the Login form allow anonymous. <location path="Home.aspx"> <system.web> <authorization> <allow users="*" /> </authorization> </system.web> </location> <location path="Login.aspx"> <system.web> <authorization> <allow users="*" /> </authorization> </system.web> </location> Login form is set as the loginUrl <authentication mode="Forms"> <forms protection="All" loginUrl="Login.aspx"> </forms> </authentication> Default document is set as Home.aspx <defaultDocument> <files> <add value="Home.aspx" /> </files> </defaultDocument> I have not removed any of the iis7 default documents. However, Home.aspx is first in the priority.

    Read the article

  • ASP.NET application developed in 32 bit environment not working in 64 bit environment

    - by jgonchik
    We have developed an ASP.NET website on a Windows 7 - 32 bit platform using Visual Studio 2008. This website is being hosted at a hosting company where we share a server with hundreds of other ASP.NET websites. We are in the process of changing our hosting to a dedicated Windows 2008 - 64 bit server. We have installed Visual Studio on this new server in order to debug our application. If we try to start the application on this new server using Visual Studios 2008's own web server (not IIS 7) we get the error below. We have tried to compile the application in both 32 as well as 64 bit mode. We also tried to compile to "Any CPU". But nothing helps. We also tried running Visual Studio as an administrator but without success. We get the following error: Server Error in '/' Application. The specified module could not be found. (Exception from HRESULT: 0x8007007E) Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.IO.FileNotFoundException: The specified module could not be found. (Exception from HRESULT: 0x8007007E) Source Error: An unhandled exception was generated during the execution of the current web request. Information regarding the origin and location of the exception can be identified using the exception stack trace below. Stack Trace: [FileNotFoundException: The specified module could not be found. (Exception from HRESULT: 0x8007007E)] System.Reflection.Assembly._nLoad(AssemblyName fileName, String codeBase, Evidence assemblySecurity, Assembly locationHint, StackCrawlMark& stackMark, Boolean throwOnFileNotFound, Boolean forIntrospection) +0 System.Reflection.Assembly.nLoad(AssemblyName fileName, String codeBase, Evidence assemblySecurity, Assembly locationHint, StackCrawlMark& stackMark, Boolean throwOnFileNotFound, Boolean forIntrospection) +43 System.Reflection.Assembly.InternalLoad(AssemblyName assemblyRef, Evidence assemblySecurity, StackCrawlMark& stackMark, Boolean forIntrospection) +127 System.Reflection.Assembly.InternalLoad(String assemblyString, Evidence assemblySecurity, StackCrawlMark& stackMark, Boolean forIntrospection) +142 System.Reflection.Assembly.Load(String assemblyString) +28 System.Web.Configuration.CompilationSection.LoadAssemblyHelper(String assemblyName, Boolean starDirective) +46 [ConfigurationErrorsException: The specified module could not be found. (Exception from HRESULT: 0x8007007E)] System.Web.Configuration.CompilationSection.LoadAssemblyHelper(String assemblyName, Boolean starDirective) +613 System.Web.Configuration.CompilationSection.LoadAllAssembliesFromAppDomainBinDirectory() +203 System.Web.Configuration.CompilationSection.LoadAssembly(AssemblyInfo ai) +105 System.Web.Compilation.BuildManager.GetReferencedAssemblies(CompilationSection compConfig) +178 System.Web.Compilation.BuildProvidersCompiler..ctor(VirtualPath configPath, Boolean supportLocalization, String outputAssemblyName) +54 System.Web.Compilation.ApplicationBuildProvider.GetGlobalAsaxBuildResult(Boolean isPrecompiledApp) +232 System.Web.Compilation.BuildManager.CompileGlobalAsax() +51 System.Web.Compilation.BuildManager.EnsureTopLevelFilesCompiled() +337 [HttpException (0x80004005): The specified module could not be found. (Exception from HRESULT: 0x8007007E)] System.Web.Compilation.BuildManager.ReportTopLevelCompilationException() +58 System.Web.Compilation.BuildManager.EnsureTopLevelFilesCompiled() +512 System.Web.Hosting.HostingEnvironment.Initialize(ApplicationManager appManager, IApplicationHost appHost, IConfigMapPathFactory configMapPathFactory, HostingEnvironmentParameters hostingParameters) +729 [HttpException (0x80004005): The specified module could not be found. (Exception from HRESULT: 0x8007007E)] System.Web.HttpRuntime.FirstRequestInit(HttpContext context) +8897659 System.Web.HttpRuntime.EnsureFirstRequestInit(HttpContext context) +85 System.Web.HttpRuntime.ProcessRequestInternal(HttpWorkerRequest wr) +259 Does anyone know why this error appears and how to solve it?

    Read the article

  • Reliable and fast way to convert a zillion ODT files in PDF?

    - by Marco Mariani
    I need to pre-produce a million or two PDF files from a simple template (a few pages and tables) with embedded fonts. Usually, I would stay low level in a case like this, and compose everything with a library like ReportLab, but I joined late in the project. Currently, I have a template.odt and use markers in the content.xml files to fill with data from a DB. I can smoothly create the ODT files, they always look rigth. For the ODT to PDF conversion, I'm using openoffice in server mode (and PyODConverter w/ named pipe), but it's not very reliable: in a batch of documents, there is eventually a point after which all the processed files are converted into garbage (wrong fonts and letters sprawled all over the page). Problem is not predictably reproducible (does not depend on the data), happens in OOo 2.3 and 3.2, in Ubuntu, XP, Server 2003 and Windows 7. My Heisenbug detector is ticking. I tried to reduce the size of batches and restarting OOo after each one; still, a small percentage of the documents are messed up. Of course I'll write about this on the Ooo mailing lists, but in the meanwhile, I have a delivery and lost too much time already. Where do I go? Completely avoid the ODT format and go for another template system. Suggestions? Anything that takes a few seconds to run is way too slow. OOo takes around a second and it sums to 15 days of processing time. I had to write a program for clustering the jobs over several clients. Keep the format but go for another tool/program for the conversion. Which one? There are many apps in the shareware or commercial repositories for windows, but trying each one is a daunting task. Some are too slow, some cannot be run in batch without buying it first, some cannot work from command line, etc. Open source tools tend not to reinvent the wheel and often depend on openoffice. Converting to an intermediate .DOC format could help to avoid the OOo bug, but it would double the processing time and complicate a task that is already too hairy. Try to produce the PDFs twice and compare them, discarding the whole batch if there's something wrong. Although the documents look equal, I know of no way to compare the binary content. Restart OOo after processing each document. it would take a lot more time to produce them it would lower the percentage of the wrong files, and make it very hard to identify them. Go for ReportLab and recreate the pages programmatically. This is the approach I'm going to try in a few minutes. Learn to properly format bulleted lists Thanks a lot.

    Read the article

  • WCF (REST) multiple host headers with one endpoint

    - by Maan
    I have an issue with a WCF REST service (.NET 4) which has multiple host headers, but one end point. The host headers are for example: xxx.yyy.net xxx.yyy.com Both host headers are configured in IIS over HTTPS and redirect to the same WCF service endpoint. I have an Error Handling behavior which logs some extra information in case of an error. The problem is that the logging behavior only works for one of both URLs. When I first call the .net URL, the logging is only working for requests on the .net URL. When I first call the .com URL (after a Worker Process recycle), it’s only working on requests on the .com URL. The configuration looks like this: <system.serviceModel> <serviceHostingEnvironment aspNetCompatibilityEnabled="true"/> <services> <service name="XXX.RemoteHostService"> <endpoint address="" behaviorConfiguration="RemoteHostEndPointBehavior" binding="webHttpBinding" bindingConfiguration="HTTPSTransport" contract="XXX.IRemoteHostService" /> </service> </services> <extensions> <behaviorExtensions> <add name="errorHandling" type="XXX.ErrorHandling.ErrorHandlerBehavior, XXX.Services, Version=1.0.0.0, Culture=neutral, PublicKeyToken=null" /> </behaviorExtensions> </extensions> <bindings> <webHttpBinding> <binding name="HTTPSTransport"> <security mode="Transport"> <transport clientCredentialType="None"/> </security> </binding> </webHttpBinding> </bindings> <behaviors> <endpointBehaviors> <behavior name="RemoteHostEndPointBehavior"> <webHttp /> <errorHandling /> </behavior> </endpointBehaviors> </behaviors> …. Should I configure multiple endpoints? Or in which way could I configure the WCF Service so the logging behavior is working for both URLs? I tried several things, also solutions mentioned earlier on StackOverflow. But no luck until now...

    Read the article

  • How are you using IronPython?

    - by Will Dean
    I'm keen to drink some modern dynamic language koolaid, so I've believed all the stuff on Michael Foord's blog and podcasts, I've bought his book (and read some of it), and I added an embedded IPy runtime to a large existing app a year or so ago (though that was for someone else and I didn't really use it myself). Now I need to do some fairly simple code generation stuff, where I'm going to call a few methods on a few .net objects (custom, C#-authored objects), create a few strings, write some files, etc. The experience of trying this leaves me feeling like the little boy who thinks he's the only one who can see that The Emperor has no clothes on. If you're using IronPython, I'd really appreciate knowing how you deal with the following aspects of it: Code editing - do you use the .NET framework without Intellisense? Refactoring - I know a load of 'refactoring' is about working around language-related busywork, so if Python is sufficiently lightweight then we won't need that, But things like renames seem to me to be essential to iteratively developing quality code regardless of language. Crippling startup time - One of the things which is supposed to be good about interpreted languages is the lack of compile time leading to fast interactive development. Unfortunately I can compile a C# application and launch it quicker than IPy can start up. Interactive hacking - the IPy console/repl is supposed to be good for this, but I haven't found a good way to take the code you've interactively arrived at and persist it into a file - cut and paste from the console is fairly miserable. And the console seems to hold references to .NET assemblies you've imported, so you have to quit it and restart it if you're working on the C# stuff as well. Hacking on C# in something like LinqPad seems a much faster and easier way to try things out (and has proper Intellisense). Do you use the console? Debugging - what's the story here? I know someone on the IPy team is working on a command-line hobby-project, but let's just say I'm not immediately attracted to a command line debugger. I don't really need a debugger from little Python scripts, but I would if I were to use IPy for scripting unit tests, for example. Unit testing - I can see that dynamic languages could be great for this, but is there any IDE test-runner integration (like for Resharper, etc). The Foord book has a chapter about this, which I'll admit I have not yet read properly, but it does seem to involve driving a console-mode test-runner from the command prompt, which feels to be an enormous step back from using an integrated test runner like TestDriven.net or Resharper. I really want to believe in this stuff, so I am still working on the assumption that I've missed something. I would really like to know how other people are dealing with IPy, particularly if they're doing it in a way which doesn't feel like we've just lost 15 years'-worth of tool development.

    Read the article

  • A Question about using jython when run a receving socket in python

    - by abusemind
    Hi, I have not a lot of knowledge of python and network programming. Currently I am trying to implement a simple application which can receive a text message sent by the user, fetch some information from the google search api, and return the results via text message to the user. This application will continue to listening to the users messages and reply immediately. How I get the text short message sent by the user? It's a program named fetion from the mobile supplier in China. The client side fetion, just like a instant communication tool, can send/receive messages to/from other people who are using mobile to receive/send SMS. I am using a open source python program that simulates the fetion program. So basically I can use this python program to communate with others who using cell phone via SMS. My core program is based on java, so I need to take this python program into java environment. I am using jython, and now I am available to send messages to users by some lines of java codes. But the real question is the process of receving from users via SMS. In python code, a new thread is created to continuously listen to the user. It should be OK in Python, but when I run the similar process in Jython, the following exception occurs: Exception in thread Thread:Traceback (most recent call last): File "D:\jython2.5.1\Lib\threading.py", line 178, in _Thread__bootstrap self.run() File "<iostream>", line 1389, in run File "<iostream>", line 1207, in receive File "<iostream>", line 1207, in receive File "<iostream>", line 150, in recv File "D:\jython2.5.1\Lib\select.py", line 223, in native_select pobj.register(fd, POLLIN) File "D:\jython2.5.1\Lib\select.py", line 104, in register raise _map_exception(jlx) error: (20000, 'socket must be in non-blocking mode') The line 150 in the python code is as follows: def recv(self,timeout=False): if self.login_type == "HTTP": time.sleep(10) return self.get_offline_msg() pass else: if timeout: infd,outfd,errfd = select([self.__sock,],[],[],timeout)//<---line 150 here else: infd,outfd,errfd = select([self.__sock,],[],[]) if len(infd) != 0: ret = self.__tcp_recv() num = len(ret) d_print(('num',),locals()) if num == 0: return ret if num == 1: return ret[0] for r in ret: self.queue.put(r) d_print(('r',),locals()) if not self.queue.empty(): return self.queue.get() else: return "TimeOut" Because of I am not very familiar with python, especially the socket part, and also new in Jython use, I really need your help or only advice or explanation. Thank you very much!

    Read the article

  • PHP submit problem

    - by TaG
    I'm trying to check if the username is available and display it for the user to see when they check there account settings, which I have done. BUT when the user tries to fill out another field I get the Your username is unavailable! which should not pop up because its the users username already. I want to know how can I fix this problem using PHP so that the users name is displayed every time the user views their account settings and it wont cause problems when a user submits additional info? Here is the PHP code. if (isset($_POST['submitted'])) { require_once '../htmlpurifier/library/HTMLPurifier.auto.php'; $config = HTMLPurifier_Config::createDefault(); $config->set('Core.Encoding', 'UTF-8'); $config->set('HTML.Doctype', 'XHTML 1.0 Strict'); $config->set('HTML.TidyLevel', 'heavy'); $config->set('HTML.SafeObject', true); $config->set('HTML.SafeEmbed', true); $purifier = new HTMLPurifier($config); $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"SELECT users.* FROM users WHERE user_id=3"); $first_name = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['first_name'])))); $username = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['username'])))); if($_POST['username']) { $u = "SELECT user_id FROM users WHERE username = '$username'"; $r = mysqli_query ($mysqli, $u) or trigger_error("Query: $q\n<br />MySQL Error: " . mysqli_error($mysqli)); if (mysqli_num_rows($r) == TRUE) { $username = NULL; echo '<p class="error">Your username is unavailable!</p>'; } else if(mysqli_num_rows($r) == 0) { $username = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['username'])))); if ($_POST['password1'] == $_POST['password2']) { $sha512 = hash('sha512', $_POST['password1']); $password = mysqli_real_escape_string($mysqli, $purifier->purify(strip_tags($sha512))); } else { $password = NULL; } if($password == NULL) { echo '<p class="error">Your password did not match the confirmed password!</p>'; } else { if (mysqli_num_rows($dbc) == 0) { $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"INSERT INTO users (user_id, first_name, username, password) VALUES ('$user_id', '$first_name', '$username', '$password')"); } if ($dbc == TRUE) { $dbc = mysqli_query($mysqli,"UPDATE users SET first_name = '$first_name', username = '$username', password = '$password' WHERE user_id = '$user_id'"); echo '<p class="changes-saved">Your changes have been saved!</p>'; } if (!$dbc) { print mysqli_error($mysqli); return; } } } } } Here is the html form. <form method="post" action="index.php"> <fieldset> <ul> <li><label for="first_name">First Name: </label><input type="text" name="first_name" id="first_name" size="25" class="input-size" value="<?php if (isset($_POST['first_name'])) { echo stripslashes(htmlentities(strip_tags($_POST['first_name']))); } else if(!empty($first_name)) { echo stripslashes(htmlentities(strip_tags($first_name))); } ?>" /></li> <li><label for="username">UserName: </label><input type="text" name="username" id="username" size="25" class="input-size" value="<?php if (isset($_POST['username'])) { echo stripslashes(htmlentities(strip_tags($_POST['username']))); } else if(!empty($username)) { echo stripslashes(htmlentities(strip_tags($username))); } ?>" /><br /><span>(ex: CSSKing, butterball)</span></li> <li><label for="password1">Password: </label><input type="password" name="password1" id="password1" size="25" class="input-size" value="<?php if (isset($_POST['password1'])) { echo stripslashes(htmlentities(strip_tags($_POST['password1']))); } ?>" /></li> <li><label for="password2">Confirm Password: </label><input type="password" name="password2" id="password2" size="25" class="input-size" value="<?php if (isset($_POST['password2'])) { echo stripslashes(htmlentities(strip_tags($_POST['password2']))); } ?>" /></li> <li><input type="submit" name="submit" value="Save Changes" class="save-button" /> <input type="hidden" name="submitted" value="true" /> <input type="submit" name="submit" value="Preview Changes" class="preview-changes-button" /></li> </ul> </fieldset> </form>

    Read the article

  • Different positions in ViewPager

    - by Kalai Selvan.G
    In my Application am using ViewPager to swipe the images,which comes through webservice as URL. Everything goes smoothly,the problem is while swiping myself getting the position as collapsed one.. Swipe left-right: positions are 1,2,3,4,5,etc.. if i stops swiping at 5th pos and started to Swipe from right-left: positions are 2,1...why this happens? I need to catch the position of the imageURL to find out the ID of the specific image and so i need to download and set it as wallpaper.. Normally while we swipe from right-left,the positions should decrease like 4,3,2,1. Also in debugger mode i got some start position,end position,last position with different values.. Any Clue about ViewPager. Here is my code: public class ImagePagerActivity extends BaseActivity { private ViewPager pager; private DisplayImageOptions options; public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.ac_image_pager); Bundle bundle = getIntent().getExtras(); String[] imageUrls = bundle.getStringArray(Extra.IMAGES); int pagerPosition = bundle.getInt(Extra.IMAGE_POSITION, 0); options = new DisplayImageOptions.Builder() .showImageForEmptyUrl(R.drawable.image_for_empty_url) .cacheOnDisc() .decodingType(DecodingType.MEMORY_SAVING) .build(); pager = (ViewPager) findViewById(R.id.pager); pager.setAdapter(new ImagePagerAdapter(imageUrls)); pager.setCurrentItem(pagerPosition); } private class ImagePagerAdapter extends PagerAdapter { private String[] images; private LayoutInflater inflater; ImagePagerAdapter(String[] images) { this.images = images; inflater = getLayoutInflater(); } @Override public void destroyItem(View container, int position, Object object) { ((ViewPager) container).removeView((View) object); } @Override public void finishUpdate(View container) { } @Override public int getCount() { return images.length; } @Override public Object instantiateItem(View view, int position) { final FrameLayout imageLayout = (FrameLayout) inflater.inflate(R.layout.item_pager_image, null); final ImageView imageView = (ImageView) imageLayout.findViewById(R.id.image); final ProgressBar spinner = (ProgressBar) imageLayout.findViewById(R.id.loading); imageLoader.displayImage(images[position], imageView, options, new ImageLoadingListener() { public void onLoadingStarted() { spinner.setVisibility(View.VISIBLE); } public void onLoadingFailed() { spinner.setVisibility(View.GONE); imageView.setImageResource(android.R.drawable.ic_delete); } public void onLoadingComplete() { spinner.setVisibility(View.GONE); } }); ((ViewPager) view).addView(imageLayout, 0); return imageLayout; } @Override public boolean isViewFromObject(View view, Object object) { return view.equals(object); } @Override public void restoreState(Parcelable state, ClassLoader loader) { } @Override public Parcelable saveState() { return null; } @Override public void startUpdate(View container) { } } }

    Read the article

  • Visual Studio soft-crashing when encountering XAML Errors in initialize.

    - by Aren
    I've been having some serious issues with Visual Studio 2010 as of late. It's been crashing in a peculiar way when I encounter certain types of XAML errors during the InitializeComponent() of a control/window. The program breaks and visual studio gears up like it's catching an exception (because it is) and then stops midway displaying a broken highlight in my XAML file with no details as to what is wrong. Example: There is not pop outs, or details Anywhere about what is wrong, only a callstack that points to my InitializeComponent() call. Now normally I'd just do some trial and error to fix this problem, and find out where i messed up, but the real problem isn't my code. Visual Studio is rendered completely useless at this point. It reports my application still in "Running" mode. The Stop/Break/Restart buttons on the toolbar or in the menus don't do anything (but grey out). Closing the application does not stop this behaviour, closing visual studio gets it stuck in a massive loop where it yells at me complaining every file open is not in the debug project, then repeats this process when i have exausted every open file. I have to force-close devenv.exe, and after this happening 3-4 times in a row it's a lot of wasted time (as my projects are usually pretty big and studio can be quite slow @ loading). To the point Has anyone else experienced this? How can I stop studio from locking up. Can I at LEAST get information out of this beast another way so i can fix my XAML error sooner rather than after 3-4 trial-and-error compiles yielding the same crash? Any & All help would be appreciated. Visual Studio 2010 version: 10.0.30319.1RTM Edit & Update FWIW, mostly the errors that cause this are XamlParseExceptions (I figured this out after i found what was wrong with my XAML). I think I need to be clearer though, Im not looking for the solution to my code problem, as these are usually typos / small things, I'm looking for a solution to VStudio getting all buggered up as a result. The particular error in the above image that 100% for sure caused this was a XamlParseException caused by forgetting a Value attribute on a data trigger. I've fixed that part but it still doesn't tell my why my studio becomes a lump of neutered program when a perfectly normal exception is thrown in the parsing of the XAML. Code that will cause this issue (at least for me) This is the base template WPF Application, with the following Window.xaml code. The problem is a missing Value="True" on the <DataTrigger ...> in the template. It generates a XamlParseException and Visual Studio Crashes as described above when debugging it. Final Notes The following solutions did not help me: Restarting Visual Studio Rebooting Reinstalling Visual Studio

    Read the article

  • PHP max_execution_time not timing out

    - by Joey Ezekiel
    This is not one of the regular questions if sleep is counted for timeout or stuff like that. Ok, here's the problem: I've set the max_execution_time for PHP as 15 seconds and ideally this should time out when it crosses the set limit, but it doesn't. Apache has been restarted after the change to the php.ini file and an ini_get('max_execution_time') is all fine. Sometimes the script runs for upto 200 seconds which is crazy. I have no database communication whatsoever. All the script does is looking for files on the unix filesystem and in some cases re-directing to another JSP page. There is no sleep() on the script. I calculate the total execution time of the PHP script like this: At the start of the script I set : $_mtime = microtime(); $_mtime = explode(" ",$_mtime); $_mtime = $_mtime[1] + $_mtime[0]; $_gStartTime = $_mtime; and the end time($_gEndTime) is calculated similarly. The total time is calculated in a shutdown function that I've registered: register_shutdown_function('shutdown'); ............. function shutdown() { .............. .............. $_total_time = $_gEndTime - $_gStartTime; .............. switch (connection_status ()) { case CONNECTION_NORMAL: .... break; .... case CONNECTION_TIMEOUT: .... break; ...... } } Note: I cannot use $_SERVER['REQUEST_TIME'] because my PHP version is incompatible. That sucks - I know. 1) Well, my first question obviously is is why is my PHP script executing even after the set timeout limit? 2) Apache has the Timeout directive which is 300 seconds but the PHP binary does not read the Apache config and this should not be a problem. 3) Is there a possibility that something is sending PHP into a sleep mode? 4) Am I calculating the execution time in a wrong way? Is there a better way to do this? I'm stumped at this point. PHP Wizards - please help.

    Read the article

  • Proper way to use Linq with WPF

    - by Ingó Vals
    I'm looking for a good guide into the right method of using Linq to Sql together with WPF. Most guides only go into the bare basics like how to show data from a database but noone I found goes into how to save back to the database. Can you answer or point out to me a guide that can answer these questions. I have a separate Data project because the same data will also be used in a web page so I have the repository method. That means I have a seperate class that uses the DataContext and there are methods like GetAllCompanies() and GetCompanyById ( int id ). 1) Where there are collections is it best to return as a IQueryable or should I return a list? Inside the WPF project I have seen reccomendations to wrap the collection in a ObservabgleCollection. 2) Why should I use ObservableCollection and should I use it even with Linq / IQueryable Some properties of the linq entities should be editable in the app so I set them to two-way mode. That would change the object in the observableCollection. 3) Is the object in the ObservableCollection still a instance of the original linq entity and so is the change reflected in the database ( when submitchanges is called ) I should have somekind of save method in the repository. But when should I call it? What happens if someone edits a field but decides not to save it, goes to another object and edits it and then press save. Doesn't the original change also save? When does it not remember the changes to a linq entity object anymore. Should I instance the Datacontext class in each method so it loses scope when done. 4) When and how to call the SubmitChanges method 5) Should I have the DataContext as a member variable of the repository class or a method variable To add a new row I should create a new object in a event ( "new" button push ) and then add it to the database using a repo method. 6) When I add the object to the database there will be no new object in the ObservableCollection. Do I refresh somehow. 7) I wan't to reuse the edit window when creating new but not sure how to dynamically changing from referencing selected item from a listview to this new object. Any examples you can point out.

    Read the article

  • WPF - ListBox ignores Style When ItemsSource is bound

    - by Andy T
    Hi, I have created styled a ListBox in WPF so that it is rendered as a checkbox list. When I populate the ListBox's items manually, the styling works perfectly. However, when I instead bind the ItemsSource of the ListBox to a static resource (an ItemsControl containing the required items), the styling is completely dropped. Here's the style: <Style x:Key="CheckBoxListStyle" TargetType="ListBox"> <Style.Resources> <Style TargetType="ListBoxItem"> <Setter Property="Template"> <Setter.Value> <ControlTemplate TargetType="ListBoxItem"> <Grid Margin="2"> <Grid.ColumnDefinitions> <ColumnDefinition Width="Auto" /> <ColumnDefinition /> </Grid.ColumnDefinitions> <CheckBox IsChecked="{Binding IsSelected, RelativeSource={RelativeSource TemplatedParent}, Mode=TwoWay}"/> <ContentPresenter Grid.Column="1" Margin="2,0,0,0" /> </Grid> </ControlTemplate> </Setter.Value> </Setter> </Style> </Style.Resources> <Setter Property="ItemsPanel"> <Setter.Value> <ItemsPanelTemplate> <WrapPanel Orientation="Vertical" /> </ItemsPanelTemplate> </Setter.Value> </Setter> <Setter Property="BorderThickness" Value="0" /> <Setter Property="Background" Value="Transparent" /> </Style> Here's the code for the ListBox that shows the style correctly: <ListBox x:Name="ColumnsList" Grid.Column="0" Grid.Row="0" Style="{StaticResource CheckBoxListStyle}" BorderThickness="1"> <ListBox.Items> <ListBoxItem>Test</ListBoxItem> <ListBoxItem>Test2</ListBoxItem> <ListBoxItem>Test3</ListBoxItem> </ListBox.Items> </ListBox> Here's the code for the ListBox that ignores the style: <ListBox x:Name="ColumnsList2" Grid.Column="0" Grid.Row="0" Style="{StaticResource CheckBoxListStyle}" BorderThickness="1" ItemsSource="{Binding Source={StaticResource Test1}, Path=Items}"> </ListBox> Hoping someone can help - I'm pretty new to all this and have tried everything I can think of, but everything I've read leads me to believe that setting ItemsSource should have the same outcome as setting the items manually, so I can't see any reason why this would not work. Thanks, AT

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • NHibernate FetchMode.Lazy

    - by RyanFetz
    I have an object which has a property on it that has then has collections which i would like to not load in a couple situations. 98% of the time i want those collections fetched but in the one instance i do not. Here is the code I have... Why does it not set the fetch mode on the properties collections? [DataContract(Name = "ThemingJob", Namespace = "")] [Serializable] public class ThemingJob : ServiceJob { [DataMember] public virtual Query Query { get; set; } [DataMember] public string Results { get; set; } } [DataContract(Name = "Query", Namespace = "")] [Serializable] public class Query : LookupEntity<Query>, DAC.US.Search.Models.IQueryEntity { [DataMember] public string QueryResult { get; set; } private IList<Asset> _Assets = new List<Asset>(); [IgnoreDataMember] [System.Xml.Serialization.XmlIgnore] public IList<Asset> Assets { get { return _Assets; } set { _Assets = value; } } private IList<Theme> _Themes = new List<Theme>(); [IgnoreDataMember] [System.Xml.Serialization.XmlIgnore] public IList<Theme> Themes { get { return _Themes; } set { _Themes = value; } } private IList<Affinity> _Affinity = new List<Affinity>(); [IgnoreDataMember] [System.Xml.Serialization.XmlIgnore] public IList<Affinity> Affinity { get { return _Affinity; } set { _Affinity = value; } } private IList<Word> _Words = new List<Word>(); [IgnoreDataMember] [System.Xml.Serialization.XmlIgnore] public IList<Word> Words { get { return _Words; } set { _Words = value; } } } using (global::NHibernate.ISession session = NHibernateApplication.GetCurrentSession()) { global::NHibernate.ICriteria criteria = session.CreateCriteria(typeof(ThemingJob)); global::NHibernate.ICriteria countCriteria = session.CreateCriteria(typeof(ThemingJob)); criteria.AddOrder(global::NHibernate.Criterion.Order.Desc("Id")); var qc = criteria.CreateCriteria("Query"); qc.SetFetchMode("Assets", global::NHibernate.FetchMode.Lazy); qc.SetFetchMode("Themes", global::NHibernate.FetchMode.Lazy); qc.SetFetchMode("Affinity", global::NHibernate.FetchMode.Lazy); qc.SetFetchMode("Words", global::NHibernate.FetchMode.Lazy); pageIndex = Convert.ToInt32(pageIndex) - 1; // convert to 0 based paging index criteria.SetMaxResults(pageSize); criteria.SetFirstResult(pageIndex * pageSize); countCriteria.SetProjection(global::NHibernate.Criterion.Projections.RowCount()); int totalRecords = (int)countCriteria.List()[0]; return criteria.List<ThemingJob>().ToPagedList<ThemingJob>(pageIndex, pageSize, totalRecords); }

    Read the article

  • Why is two-way binding in silverlight not working?

    - by Edward Tanguay
    According to how Silverlight TwoWay binding works, when I change the data in the FirstName field, it should change the value in CheckFirstName field. Why is this not the case? ANSWER: Thank you Jeff, that was it, for others: here is the full solution with downloadable code. XAML: <StackPanel> <Grid x:Name="GridCustomerDetails"> <Grid.RowDefinitions> <RowDefinition Height="Auto"/> <RowDefinition Height="Auto"/> <RowDefinition Height="*"/> </Grid.RowDefinitions> <Grid.ColumnDefinitions> <ColumnDefinition Width="Auto"/> <ColumnDefinition Width="300"/> </Grid.ColumnDefinitions> <TextBlock VerticalAlignment="Center" Margin="10" Grid.Row="0" Grid.Column="0">First Name:</TextBlock> <TextBox Margin="10" Grid.Row="0" Grid.Column="1" Text="{Binding FirstName, Mode=TwoWay}"/> <TextBlock VerticalAlignment="Center" Margin="10" Grid.Row="1" Grid.Column="0">Last Name:</TextBlock> <TextBox Margin="10" Grid.Row="1" Grid.Column="1" Text="{Binding LastName}"/> <TextBlock VerticalAlignment="Center" Margin="10" Grid.Row="2" Grid.Column="0">Address:</TextBlock> <TextBox Margin="10" Grid.Row="2" Grid.Column="1" Text="{Binding Address}"/> </Grid> <Border Background="Tan" Margin="10"> <TextBlock x:Name="CheckFirstName"/> </Border> </StackPanel> Code behind: public Page() { InitializeComponent(); Customer customer = new Customer(); customer.FirstName = "Jim"; customer.LastName = "Taylor"; customer.Address = "72384 South Northern Blvd."; GridCustomerDetails.DataContext = customer; Customer customerOutput = (Customer)GridCustomerDetails.DataContext; CheckFirstName.Text = customer.FirstName; }

    Read the article

  • Android listview array adapter selected

    - by João Melo
    i'm trying to add a contextual action mode to a listview, but i'm having some problems with the selection, if i make aList1.setSelection(position) it doesn't select anything, and if i make List1.setItemChecked(position, true) it works but it only changes the font color a little and i want it to change the background or something more notable, is there any way to detect the selection and manually and change the background, or i'm missing something? the list: <RelativeLayout xmlns:android="http://schemas.android.com/apk/res/android" android:layout_width="match_parent" android:layout_height="match_parent" > <ListView android:id="@+id/list1" android:layout_width="match_parent" android:layout_height="match_parent" android:choiceMode="singleChoice" android:drawSelectorOnTop="false"> </ListView> </RelativeLayout> the adapter: public class ServicesRowAdapter extends ArrayAdapter<String[]> { private final Activity context; private final ArrayList<String[]> names; static class ViewHolder { public TextView Id; public TextView Date; public RelativeLayout statusbar,bglayout; } public ServicesRowAdapter(Activity context, ArrayList<String[]> names) { super(context, R.layout.servicesrowlayout, names); this.context = context; this.names = names; } @Override public View getView(int position, View convertView, ViewGroup parent) { View rowView = convertView; if (rowView == null) { LayoutInflater inflater = context.getLayoutInflater(); rowView = inflater.inflate(R.layout.servicesrowlayout, null); ViewHolder viewHolder = new ViewHolder(); viewHolder.Id = (TextView) rowView.findViewById(R.id.idlabel); viewHolder.Date = (TextView) rowView.findViewById(R.id.datelabel); rowView.setTag(viewHolder); } ViewHolder holder = (ViewHolder) rowView.getTag(); holder.Date.setText(names.get(position)[2]); holder.Id.setText(names.get(position)[1]); return rowView; } } with the use of a layout: <RelativeLayout xmlns:android="http://schemas.android.com/apk/res/android" android:layout_width="wrap_content" android:layout_height="wrap_content" > <TextView android:id="@+id/idlabel" android:layout_width="wrap_content" android:layout_height="wrap_content" android:layout_centerVertical="true" android:gravity="right" android:text="@+id/idlabel" android:textSize="20dp" android:width="70dp" > </TextView> <TextView android:id="@+id/datelabel" android:layout_centerVertical="true" android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="@+id/datelabel" android:textSize="20dp" android:layout_marginLeft="90dp" > </TextView> </RelativeLayout

    Read the article

  • ASP.NET 2.0 and 4.0 seem to treat the root url differently in Forms Authentication

    - by Kev
    If have the following web.config: <configuration> <system.web> <authentication mode="Forms"> <forms name="MembershipCookie" loginUrl="Login.aspx" protection="All" timeout="525600" slidingExpiration="true" enableCrossAppRedirects="true" path="/" /> </authentication> <authorization> <deny users="?" /> </authorization> </system.web> <location path="Default.aspx"> <system.web> <authorization> <allow users="*"/> </authorization> </system.web> </location> </configuration> The application is an ASP.NET 2.0 application running on Windows 2008R2/IIS7.5. If the site's application pool is configured to run ASP.NET 2.0 and I browse to http://example.com then Default.aspx is rendered as you'd expect from the rules above. However if the application pool is set to run ASP.NET 4.0 I am redirected to the login page. If I explicitly specify http://example.com/default.aspx then all is good and default.aspx renders. I've tried rewriting / -> /default.aspx (using IIS UrlRewriter 2.0) but the result is still the same, I get kicked to the login page. I've also tried this with an ASP.NET 4.0 application with the same result (which is where the problem initially arose). The reason I tried this with a 2.0 application was to see if there was a change in behaviour, and it seems that / is handled differently in 4.0. So to summarise, using the configuration above the following is observed: ASP.NET Version Url Behaviour ------------------------------------------------------------------------- 2.0 http://example.com Renders Default.aspx 2.0 http://example.com/Default.aspx Renders Default.aspx 4.0 http://example.com Redirects to Login.aspx 4.0 http://example.com/Default.aspx Renders Default.aspx Is this a bug/breaking change or have I missed something glaringly obvious?

    Read the article

  • Invalid character in a Base-64 string when Concatenating and Url encoding a string

    - by Rob
    I’m trying to write some encryption code that is passed through a Url. For the sake of the issue I’ve excluded the actual encryption of the data and just shown the code causing the problem. I take a salt value, convert it to a byte array and then convert that to a base64 string. This string I concatenate to another base64 string (which was previously a byte array). These two base64 strings are then Url encoded. Here’s my code... using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Security.Cryptography; using System.IO; using System.Web; class RHEncryption { private static readonly Encoding ASCII_ENCODING = new System.Text.ASCIIEncoding(); private static readonly string SECRET_KEY = "akey"; private static string md5(string text) { return BitConverter.ToString(new MD5CryptoServiceProvider().ComputeHash(ASCII_ENCODING.GetBytes(text))).Replace("-", "").ToLower(); } public string UrlEncodedData; public RHEncryption() { // encryption object RijndaelManaged aes192 = new RijndaelManaged(); aes192.KeySize = 192; aes192.BlockSize = 192; aes192.Mode = CipherMode.CBC; aes192.Key = ASCII_ENCODING.GetBytes(md5(SECRET_KEY)); aes192.GenerateIV(); // convert Ivector to base64 for sending string base64IV = Convert.ToBase64String(aes192.IV); // salt value string s = "maryhadalittlelamb"; string salt = s.Substring(0, 8); // convert to byte array // and base64 for sending byte[] saltBytes = ASCII_ENCODING.GetBytes(salt.TrimEnd('\0')); string base64Salt = Convert.ToBase64String(saltBytes); //url encode concatenated base64 strings UrlEncodedData = HttpUtility.UrlEncode(base64Salt + base64IV, ASCII_ENCODING); } public string UrlDecodedData() { // decode the url encode string string s = HttpUtility.UrlDecode(UrlEncodedData, ASCII_ENCODING); // convert back from base64 byte[] base64DecodedBytes = null; try { base64DecodedBytes = Convert.FromBase64String(s); } catch (FormatException e) { Console.WriteLine(e.Message.ToString()); Console.ReadLine(); } return s; } } If I then call the UrlDecodedData method I get a “Invalid character in a Base-64 string” exception. This is generated because the base64Salt variable contains an invalid character (I’m guessing a line termination) but I can’t seem to strip it off.

    Read the article

  • Loop append div and repeat

    - by Diego Vieira
    I have this code <div class="round-3-top"> <div class="round-2-top"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> <div class="round-2-bottom"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> </div> <div class="round-3-bottom"> <div class="round-2-top"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> <div class="round-2-bottom"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> </div> But i want generate dynamically, how i do that? Ex.: i have 4 rounds, this would be the generated code <div class="round-4-top"> <div class="round-3-top"> <div class="round-2-top"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> <div class="round-2-bottom"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> </div> <div class="round-3-bottom"> <div class="round-2-top"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> <div class="round-2-bottom"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> </div> </div> <div class="round-4-bottom"> <div class="round-3-top"> <div class="round-2-top"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> <div class="round-2-bottom"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> </div> <div class="round-3-bottom"> <div class="round-2-top"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> <div class="round-2-bottom"> <div class="round-1-top"></div> <div class="round-1-bottom"></div> </div> </div> </div> I try using TagBuilder in MVC C# but I can not do. What should happen is, if you are 3 rounds, adding he should go inside each div is like the example above. Any idea how can I develop it?

    Read the article

  • WCF service under https environment

    - by Budda
    I've created and tested WCF service, everything works fine. When I deployed to TEST environment and tried to open https://my.site/myapp/EnrollmentService.svc I've got the error message: Could not find a base address that matches scheme http for the endpoint with binding MetadataExchangeHttpBinding. Registered base address schemes are [https]. Internet showed me that I need to add some more configuration options: http://www.codeproject.com/KB/WCF/7stepsWCF.aspx I've added some settings to service web.config file. Now it looks like in the following way: <system.serviceModel> <services> <service name="McActivationApp.EnrollmentService" behaviorConfiguration="McActivationApp.EnrollmentServicBehavior"> <endpoint address="https://my.site/myapp/EnrollmentService.svc" binding="basicHttpBinding" bindingConfiguration="TransportSecurity" contract="McActivationApp.IEnrollmentService"/> <endpoint address="mex" binding="mexHttpBinding" contract="McActivationApp.IEnrollmentService" /> </service> </services> <behaviors> <serviceBehaviors> <behavior name="McActivationApp.EnrollmentServicBehavior"> <serviceMetadata httpGetEnabled="True"/> <serviceDebug includeExceptionDetailInFaults="False" /> </behavior> </serviceBehaviors> </behaviors> <bindings> <basicHttpBinding> <binding name="TransportSecurity"> <security mode="Transport"> <transport clientCredentialType="None" /> </security> </binding> </basicHttpBinding> </bindings> <serviceHostingEnvironment aspNetCompatibilityEnabled="true" /> </system.serviceModel> Actually, I've added "bindings" section and specified it for my endpoint. But this changed nothing... Please advise, what I need to do. Thanks a lot! P.S. Are there any differences in WCF service consuming from https and http resources?

    Read the article

  • c++ class member functions selected by traits

    - by Jive Dadson
    I am reluctant to say I can't figure this out, but I can't figure this out. I've googled and searched stackoverflow, and come up empty. The abstract, and possibly overly vague form of the question is, how can I use the traits-pattern to instantiate non-virtual member functions? The question came up while modernizing a set of multivariate function optimizers that I wrote more than 10 years ago. The optimizers all operate by selecting a straight-line path through the parameter space away from the current best point (the "update"), then finding a better point on that line (the "line search"), then testing for the "done" condition, and if not done, iterating. There are different methods for doing the update, the line-search, and conceivably for the done test, and other things. Mix and match. Different update formulae require different state-variable data. For example, the LMQN update requires a vector, and the BFGS update requires a matrix. If evaluating gradients is cheap, the line-search should do so. If not, it should use function evaluations only. Some methods require more accurate line-searches than others. Those are just some examples. The original version instatiates several of the combinations by means of virtual functions. Some traits are selected by setting mode bits. Yuck. It would be trivial to define the traits with #define's and the member functions with #ifdef's and macros. But that's so twenty years ago. It bugs me that I cannot figure out a whiz-bang modern way. If there were only one trait that varied, I could use the curiously recurring template pattern. But I see no way to extend that to arbitrary combinations of traits. I tried doing it using boost::enable_if, etc.. The specialized state info was easy. I managed to get the functions done, but only by resorting to non-friend external functions that have the this-pointer as a parameter. I never even figured out how to make the functions friends, much less member functions. Perhaps tag-dispatch is the key. I haven't gotten very deeply into that. Surely it's possible, right? If so, what is best practice?

    Read the article

  • Dynamic mass hosting using mod_wsgi

    - by Virgil Balibanu
    Hi, I am trying to configure an apache server using mod_wsgi for dynamic mass hosting. Each user will have it's own instance of a python application located in /mnt/data/www/domains/[user_name] and there will be a vhost.map telling me which domain maps to each user's directory (the directory will have the same name as the user). What i do not know is how to write the WSGIScriptAliasMatch line so that it also takes the path from the vhost.map file. What i want to do is something like this: I can have on my server different domains like www.virgilbalibanu.com or virgil.balibanu.com and flaviu.balibanu.com where each domain would belog to another user, the user name having no neccesary connection to the domain name. I want to do this beacuse a user, wehn he makes an acoount receives something like virgil.mydomain.com but if he has his own domain he can change it later to that, for example www.virgilbalibanu.ro, and this way I would only need to chenage the line in the vhost.map file So far I have something like this: Alias /media/ /mnt/data/www/iitcms/media/ #all media is taken from here RewriteEngine on RewriteMap lowercase int:tolower # define the map file RewriteMap vhost txt:/mnt/data/www/domains/vhost.map #this does not work either, can;t say why atm RewriteCond %{REQUEST_URI} ^/uploads/ RewriteCond ${lowercase:%{SERVER_NAME}} ^(.+)$ RewriteCond ${vhost:%1} ^(/.*)$ RewriteRule ^/(.*)$ %1/media/uploads/$1 #---> this I have no ideea how i could do WSGIScriptAliasMatch ^([^/]+) /mnt/data/www/domains/$1/apache/django.wsgi <Directory "/mnt/data/www/domains"> Options Indexes FollowSymLinks MultiViews AllowOverride None Order allow,deny Allow from all </Directory> <DirectoryMatch ^/mnt/data/www/domains/([^/]+)/apache> AllowOverride None Options FollowSymLinks ExecCGI Order deny,allow Allow from all </DirectoryMatch> <Directory /mnt/data/www/iitcms/media> AllowOverride None Options Indexes FollowSymLinks MultiViews Order allow,deny Allow from all </Directory> <DirectoryMatch ^/mnt/data/www/domains/([^/]+)/media/uploads> AllowOverride None Options Indexes FollowSymLinks MultiViews Order allow,deny Allow from all </DirectoryMatch> I know the part i did with mod_rewrite doesn't work, couldn't really say why not but that's not as important so far, I am curious how could i write the WSGIScriptAliasMatch line so that to accomplish my objective. I would be very grateful for any help, or any other ideas related to how i can deal with this. Also it would be great if I'd manage to get each site to run in wsgi daemon mode, thou that is not as important. Thanks, Virgil

    Read the article

  • How can I load a file into a DataBag from within a Yahoo PigLatin UDF?

    - by Cervo
    I have a Pig program where I am trying to compute the minimum center between two bags. In order for it to work, I found I need to COGROUP the bags into a single dataset. The entire operation takes a long time. I want to either open one of the bags from disk within the UDF, or to be able to pass another relation into the UDF without needing to COGROUP...... Code: # **** Load files for iteration **** register myudfs.jar; wordcounts = LOAD 'input/wordcounts.txt' USING PigStorage('\t') AS (PatentNumber:chararray, word:chararray, frequency:double); centerassignments = load 'input/centerassignments/part-*' USING PigStorage('\t') AS (PatentNumber: chararray, oldCenter: chararray, newCenter: chararray); kcenters = LOAD 'input/kcenters/part-*' USING PigStorage('\t') AS (CenterID:chararray, word:chararray, frequency:double); kcentersa1 = CROSS centerassignments, kcenters; kcentersa = FOREACH kcentersa1 GENERATE centerassignments::PatentNumber as PatentNumber, kcenters::CenterID as CenterID, kcenters::word as word, kcenters::frequency as frequency; #***** Assign to nearest k-mean ******* assignpre1 = COGROUP wordcounts by PatentNumber, kcentersa by PatentNumber; assignwork2 = FOREACH assignpre1 GENERATE group as PatentNumber, myudfs.kmeans(wordcounts, kcentersa) as CenterID; basically my issue is that for each patent I need to pass the sub relations (wordcounts, kcenters). In order to do this, I do a cross and then a COGROUP by PatentNumber in order to get the set PatentNumber, {wordcounts}, {kcenters}. If I could figure a way to pass a relation or open up the centers from within the UDF, then I could just GROUP wordcounts by PatentNumber and run myudfs.kmeans(wordcount) which is hopefully much faster without the CROSS/COGROUP. This is an expensive operation. Currently this takes about 20 minutes and appears to tack the CPU/RAM. I was thinking it might be more efficient without the CROSS. I'm not sure it will be faster, so I'd like to experiment. Anyway it looks like calling the Loading functions from within Pig needs a PigContext object which I don't get from an evalfunc. And to use the hadoop file system, I need some initial objects as well, which I don't see how to get. So my question is how can I open a file from the hadoop file system from within a PIG UDF? I also run the UDF via main for debugging. So I need to load from the normal filesystem when in debug mode. Another better idea would be if there was a way to pass a relation into a UDF without needing to CROSS/COGROUP. This would be ideal, particularly if the relation resides in memory.. ie being able to do myudfs.kmeans(wordcounts, kcenters) without needing the CROSS/COGROUP with kcenters... But the basic idea is to trade IO for RAM/CPU cycles. Anyway any help will be much appreciated, the PIG UDFs aren't super well documented beyond the most simple ones, even in the UDF manual.

    Read the article

< Previous Page | 515 516 517 518 519 520 521 522 523 524 525 526  | Next Page >