Search Results

Search found 23645 results on 946 pages for 'oracle berkeley db'.

Page 539/946 | < Previous Page | 535 536 537 538 539 540 541 542 543 544 545 546  | Next Page >

• htaccess not found

  - by clarkk

  I have installed a Apache 2 (from webmin) server on Debian 6.. I have setup a virtual host db.domain.com on the server which works fine, but .htaccess doesn't work if you get access from the ip address and the directory is listed if no index.php is found? db.domain.com -> 403 forbidden xxx.xxx.xxx.xxx -> gets access to the server Why is .htaccess omitted when you get access from the servers ip address? httpd.conf <Directory *> Options -Indexes FollowSymLinks </Directory> <VirtualHost *:80> ServerName db.domain.com DocumentRoot /var/www </VirtualHost> htaccess order deny,allow deny from all

  Read the article

• Solaris 11 installed, no updates?

  - by Paul De Niro

  I was messing around with solaris and decided to give Solaris 11 a try so I downloaded it from the Oracle website. After installing the OS, I went into the package manager and did an update. It told me that there were to available updates! I find this hard to believe considering that it's running a vulnerable version of firefox and java, its own in-house software product! Many of the other software products that came with the default install are also out of date and vulnerable. Is this normal for an Oracle install, or did I do something wrong with the upgrade process? I typed "pkg update" at the prompt, and I noticed that it did call out to pkg.oracle.com looking for updates. I find it bizarre that there are no updates available for an OS that was released a couple months ago with vulnerable software...

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• What IT certification is most valuable without job experience? [closed]

  - by Eric Wilson

  I'm trying to change vocations towards IT. I'm learning JAVA, SQL, and other things, but I have no job experience or formal education (other than a math Ph.D.) I know that certifications only go so far, but I was curious which certifications might be the most valuable for a first IT job? To clarify my question: Oracle certification + Zero Oracle experience = 0% chance of Oracle DBA job. Perhaps, though: [foobar certification] + Zero IT job experience = nonzero chance of entry IT job? Please give specific suggestions of certifications that you would consider relevant towards an entry-level IT job.

  Read the article

• sql server: losing identity column on export/import

  - by Y.G.J

  Recently I started dealing with SQL Server, my previous experience was in MS-Access. When I'm doing an import/export of a db, from the server to my computer or even in the server, all column with primary key loose the key. Identity is set to false and even bit is not set to the default. How can I can I use an import/export job to make an exact copy of the db and its data? I don't want to have to perform a backup and restore every time I want the same db somewhere else, for another project, etc. I have read about "edit mapping" and the checkbox but that did not helped with the identity specification... and what about the primary key of the tables and the rest of the things?

  Read the article

• MS Access 2007 end user access

  - by LtDan

  I need some good advise. I have used Access for many years and I use Sharepoint but never the two combined. My newly created Access db needs to be shared with many users across the organization. The back end is SQL and the old way to distribute the database would be placing the db on a shared drive, connecting their PC ODBC connections to the SQL db and then they would open the database and have at it. This has become the OLD way. What is the best (and simpliest) way to allow the end users to utilize a frontend for data entry/edit reporting etc. Can I create a link through SharePoint and the user just open it from there. Your good advise is greatly approciated.

  Read the article

• minimum required bandwidth for remote database server

  - by user66734

  I want to build a small warehousing application for my company. We have a central warehouse which distributes to 8 sales points across the country. They insist on an in-house solution. I am thinking to setup a central mySQL db Linux server and have the branches connect to it to store sales. Queries to the db from the branches will be minimum, maybe 10 per hour. However I need all the branches to be able to store each sale data ( product ID, customer ID ) in the central db at peak time at most once every five minutes. My question is can I get away with simple 24mbps/768kbps DSL lines? If not what is the bandwith requirement? Can I rely on a load balancing router to combine additional lines if needed? Can you propose some server hardware specs?

  Read the article

• RewriteMap syntax Regex

  - by ienabellamy

  in my .htaccess i've tons of directives, with same syntax: RewriteRule ^(.*)/PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 RewriteRule ^(.*)/PRODUCT_2.aspx http://www.site.com/product.php?id_product=2896 and everything works. Now, i created a RewriteMap in my because i need to increase velocity (20.000 redirect 301 in htaccess no good), so: RewriteEngine On RewriteMap redirects dbm=db:/var/www/html/presta152/prestashop/redirects.db RewriteCond ${redirects:$1} !="" RewriteRule ^(.*)$ ${redirects:$1} [redirect=permanent,last] and my redirects.db is created by redirects.txt, that contains: /PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 /PRODUCT_2.aspx http://www.site.com/product.php?id_product=2896 this works if i try to call for example: www.site.com/PRODUCT_1.aspx i'm redirected... but if i try to call www.site.com/everythingpossibileinside/PRODUCT_1.aspx the redirect doesn't work. So, in my .htaccess this rule: RewriteRule ^(.*)/PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 works, but in my RewriteMap no. I think i must change this directive: RewriteRule ^(.*)$ ${redirects:$1} [redirect=permanent,last] i tried, but unsuccessful. Thanks to all.

  Read the article

• Two way replication

  - by Nidzaaaa

  I have a little problem... I have this case: -2 server instances -2 Databases -1 Table (5 columns) From server 1 I created publication to replicate all columns of table I have in 1. DB From server 2 I created subscription to pull all columns from table which is in server 1 DB But now, I need to publicate one columns of same table from server 2 to server 1 and also it has to be in same DB... I tried with using logic and creating publication for server 2 and subscription on server 1 but there is error appearing "You have selected the Publisher as a Subscriber and entered a subscription database that is the same as the publishing database. Select another subscription database." I hope someone understood my problem and have an answer for me, thanks in advance... p.s. Ask for more info if you need ...

  Read the article

• Passing integer lists in a sql query, best practices

  - by Artiom Chilaru

  I'm currently looking at ways to pass lists of integers in a SQL query, and try to decide which of them is best in which situation, what are the benefots of each, and what are the pitfalls, what should be avoided :) Right now I know of 3 ways that we currently use in our application. 1) Table valued parameter: Create a new Table Valued Parameter in sql server: CREATE TYPE [dbo].[TVP_INT] AS TABLE( [ID] [int] NOT NULL ) Then run the query against it: using (var conn = new SqlConnection(DataContext.GetDefaultConnectionString)) { var comm = conn.CreateCommand(); comm.CommandType = CommandType.Text; comm.CommandText = @" UPDATE DA SET [tsLastImportAttempt] = CURRENT_TIMESTAMP FROM [Account] DA JOIN @values IDs ON DA.ID = IDs.ID"; comm.Parameters.Add(new SqlParameter("values", downloadResults.Select(d => d.ID).ToDataTable()) { TypeName = "TVP_INT" }); conn.Open(); comm.ExecuteScalar(); } The major disadvantages of this method is the fact that Linq doesn't support table valued params (if you create an SP with a TVP param, linq won't be able to run it) :( 2) Convert the list to Binary and use it in Linq! This is a bit better.. Create an SP, and you can run it within linq :) To do this, the SP will have an IMAGE parameter, and we'll be using a user defined function (udf) to convert this to a table.. We currently have implementations of this function written in C++ and in assembly, both have pretty much the same performance :) Basically, each integer is represented by 4 bytes, and passed to the SP. In .NET we have an extension method that convers an IEnumerable to a byte array The extension method: public static Byte[] ToBinary(this IEnumerable intList) { return ToBinaryEnum(intList).ToArray(); } private static IEnumerable<Byte> ToBinaryEnum(IEnumerable<Int32> intList) { IEnumerator<Int32> marker = intList.GetEnumerator(); while (marker.MoveNext()) { Byte[] result = BitConverter.GetBytes(marker.Current); Array.Reverse(result); foreach (byte b in result) yield return b; } } The SP: CREATE PROCEDURE [Accounts-UpdateImportAttempts] @values IMAGE AS BEGIN UPDATE DA SET [tsLastImportAttempt] = CURRENT_TIMESTAMP FROM [Account] DA JOIN dbo.udfIntegerArray(@values, 4) IDs ON DA.ID = IDs.Value4 END And we can use it by running the SP directly, or in any linq query we need using (var db = new DataContext()) { db.Accounts_UpdateImportAttempts(downloadResults.Select(d => d.ID).ToBinary()); // or var accounts = db.Accounts .Where(a => db.udfIntegerArray(downloadResults.Select(d => d.ID).ToBinary(), 4) .Select(i => i.Value4) .Contains(a.ID)); } This method has the benefit of using compiled queries in linq (which will have the same sql definition, and query plan, so will also be cached), and can be used in SPs as well. Both these methods are theoretically unlimited, so you can pass millions of ints at a time :) 3) The simple linq .Contains() It's a more simple approach, and is perfect in simple scenarios. But is of course limited by this. using (var db = new DataContext()) { var accounts = db.Accounts .Where(a => downloadResults.Select(d => d.ID).Contains(a.ID)); } The biggest drawback of this method is that each integer in the downloadResults variable will be passed as a separate int.. In this case, the query is limited by sql (max allowed parameters in a sql query, which is a couple of thousand, if I remember right). So I'd like to ask.. What do you think is the best of these, and what other methods and approaches have I missed?

  Read the article

• Does anyone know how to appropriately deal with user timezones in rails 2.3?

  - by Amazing Jay

  We're building a rails app that needs to display dates (and more importantly, calculate them) in multiple timezones. Can anyone point me towards how to work with user timezones in rails 2.3(.5 or .8) The most inclusive article I've seen detailing how user time zones are supposed to work is here: http://wiki.rubyonrails.org/howtos/time-zones... although it is unclear when this was written or for what version of rails. Specifically it states that: "Time.zone - The time zone that is actually used for display purposes. This may be set manually to override config.time_zone on a per-request basis." Keys terms being "display purposes" and "per-request basis". Locally on my machine, this is true. However on production, neither are true. Setting Time.zone persists past the end of the request (to all subsequent requests) and also affects the way AR saves to the DB (basically treating any date as if it were already in UTC even when its not), thus saving completely inappropriate values. We run Ruby Enterprise Edition on production with passenger. If this is my problem, do we need to switch to JRuby or something else? To illustrate the problem I put the following actions in my ApplicationController right now: def test p_time = Time.now.utc s_time = Time.utc(p_time.year, p_time.month, p_time.day, p_time.hour) logger.error "TIME.ZONE" + Time.zone.inspect logger.error ENV['TZ'].inspect logger.error p_time.inspect logger.error s_time.inspect jl = JunkLead.create! jl.date_at = s_time logger.error s_time.inspect logger.error jl.date_at.inspect jl.save! logger.error s_time.inspect logger.error jl.date_at.inspect render :nothing => true, :status => 200 end def test2 Time.zone = 'Mountain Time (US & Canada)' logger.error "TIME.ZONE" + Time.zone.inspect logger.error ENV['TZ'].inspect render :nothing => true, :status => 200 end def test3 Time.zone = 'UTC' logger.error "TIME.ZONE" + Time.zone.inspect logger.error ENV['TZ'].inspect render :nothing => true, :status => 200 end and they yield the following: Processing ApplicationController#test (for 98.202.196.203 at 2010-12-24 22:15:50) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c57a68 @tzinfo=#<TZInfo::DataTimezone: Etc/UTC>, @name="UTC", @utc_offset=0> nil Fri Dec 24 22:15:50 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 22:00:00 UTC +00:00 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 22:00:00 UTC +00:00 Completed in 21ms (View: 0, DB: 4) | 200 OK [http://www.dealsthatmatter.com/test] Processing ApplicationController#test2 (for 98.202.196.203 at 2010-12-24 22:15:53) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c580a8 @tzinfo=#<TZInfo::DataTimezone: America/Denver>, @name="Mountain Time (US & Canada)", @utc_offset=-25200> nil Completed in 143ms (View: 1, DB: 3) | 200 OK [http://www.dealsthatmatter.com/test2] Processing ApplicationController#test (for 98.202.196.203 at 2010-12-24 22:15:59) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c580a8 @tzinfo=#<TZInfo::DataTimezone: America/Denver>, @name="Mountain Time (US & Canada)", @utc_offset=-25200> nil Fri Dec 24 22:15:59 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 15:00:00 MST -07:00 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 15:00:00 MST -07:00 Completed in 20ms (View: 0, DB: 4) | 200 OK [http://www.dealsthatmatter.com/test] Processing ApplicationController#test3 (for 98.202.196.203 at 2010-12-24 22:16:03) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c57a68 @tzinfo=#<TZInfo::DataTimezone: Etc/UTC>, @name="UTC", @utc_offset=0> nil Completed in 17ms (View: 0, DB: 2) | 200 OK [http://www.dealsthatmatter.com/test3] Processing ApplicationController#test (for 98.202.196.203 at 2010-12-24 22:16:04) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c57a68 @tzinfo=#<TZInfo::DataTimezone: Etc/UTC>, @name="UTC", @utc_offset=0> nil Fri Dec 24 22:16:05 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 22:00:00 UTC +00:00 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 22:00:00 UTC +00:00 Completed in 151ms (View: 0, DB: 4) | 200 OK [http://www.dealsthatmatter.com/test] It should be clear above that the 2nd call to /test shows Time.zone set to Mountain, even though it shouldn't. Additionally, checking the database reveals that the test action when run after test2 saved a JunkLead record with a date of 2010-12-22 15:00:00, which is clearly wrong.

  Read the article

• Dropdownlist post in ASP.NET MVC3 and Entity Framework Model

  - by Josh Blade

  I have 3 tables: RateProfile RateProfileID ProfileName Rate RateID RateProfileID PanelID Other stuff to update Panel PanelID PanelName I have models for each of these. I have an edit page using the RateProfile model. I display the information for RateProfile and also all of the Rates associated with it. This works fine and I can update it fine. However, I also added a dropdown so that I can filter Rates by PanelID. I need it to post back on change so that it can display the filtered rates. I'm using @Html.DropDownList("PanelID", (SelectList)ViewData["PanelDropDown"], new { onchange = "$('#RateForm').submit()" }) for my dropdownlist. Whenever it posts back to my HttpPost Edit method though, it seems to be missing all information about the Rates navigation property. It's weird because I thought it would do exactly what the input/submit button that I have in the form does (which actually passes the entire model back to my HttpPost Edit action and does what I want it to do). The panelID is properly being passed to my HttpPost Edit method and on to the next view, but when I try to query the Model.Rates navigation property is null (only when the post comes from the dropdown. Everything works fine when the post comes from my submit input). Get Edit: public ActionResult Edit(int id, int panelID = 1) { RateProfile rateprofile = db.RateProfiles.Single(r => r.RateProfileID == id); var panels = db.Panels; ViewData["PanelDropDown"] = new SelectList(panels, "PanelID", "PanelName", panelID); ViewBag.PanelID = panelID; return View(rateprofile); } HttpPost Edit: [HttpPost] public ActionResult Edit(RateProfile rateprofile, int panelID) { var panels = db.Panels; ViewData["PanelDropDown"] = new SelectList(panels, "PanelID", "PanelName", panelID); ViewBag.PanelID = panelID; if (ModelState.IsValid) { db.Entry(rateprofile).State = EntityState.Modified; foreach (Rate dimerate in rateprofile.Rates) { db.Entry(dimerate).State = EntityState.Modified; } db.SaveChanges(); return View(rateprofile); } return View(rateprofile); } View: @model PDR.Models.RateProfile @using (Html.BeginForm(null,null,FormMethod.Post, new {id="RateForm"})) { <div> @Html.Label("Panel") @Html.DropDownList("PanelID", (SelectList)ViewData["PanelDropDown"], new { onchange = "$('#RateForm').submit()" }) </div> @{var rates= Model.Rates.Where(a => a.PanelID == ViewBag.PanelID).OrderBy(a => a.minCount).ToList();} @for (int i = 0; i < rates.Count; i++) { <tr> <td> @Html.HiddenFor(modelItem => rates[i].RateProfileID) @Html.HiddenFor(modelItem => rates[i].RateID) @Html.HiddenFor(modelItem => rates[i].PanelID) @Html.EditorFor(modelItem => rates[i].minCount) @Html.ValidationMessageFor(model => rates[i].minCount) </td> <td> @Html.EditorFor(modelItem => rates[i].maxCount) @Html.ValidationMessageFor(model => rates[i].maxCount) </td> <td> @Html.EditorFor(modelItem => rates[i].Amount) @Html.ValidationMessageFor(model => rates[i].Amount) </td> </tr> } <input type="submit" value="Save" /> } To summarize my problem, the below query in my view only works when the post comes from the submit button and not when it comes from my dropdownlist. @{var rates= Model.Rates.Where(a => a.PanelID == ViewBag.PanelID).OrderBy(a => a.minCount).ToList();}

  Read the article

• Can I use `UnlockCommercialFeatures` for developing Java applications without a commercial license?

  - by nondescript1

  As of Java 7 Update 40, Oracle is now including Java Mission Control in the JDK. Being always interested in a new profiling tool, I decided to check it out. However, trying to start Flight Recorder against a process, I get the following error, Now I'm getting cold feet about adding the JVM option -XX:+UnlockCommercialFeatures. I would only use this for profiling in development and not in production. From the article linked above, JMC is available under the Oracle Binary Code License for Java. The license allows you to use JMC for free during development and testing, though a different (paid for) licence is required for production use. I'm still leery about this. From Java SE Products, Flight Recorder certainly is a commercial feature; however, I find it very confusing that it's now included in the standard JDK release. Anyone else have a read on this? Clearly nothing here is legally binding and your legal department should be consulted. Reference: Oracle Binary Code License Agreement for the Java SE Platform Products and JavaFX

  Read the article

• Entity Framework version 1- Brief Synopsis and Tips &ndash; Part 1

  - by Rohit Gupta

  To Do Eager loading use Projections (for e.g. from c in context.Contacts select c, c.Addresses)  or use Include Query Builder Methods (Include(“Addresses”)) If there is multi-level hierarchical Data then to eager load all the relationships use Include Query Builder methods like customers.Include("Order.OrderDetail") to include Order and OrderDetail collections or use customers.Include("Order.OrderDetail.Location") to include all Order, OrderDetail and location collections with a single include statement =========================================================================== If the query uses Joins then Include() Query Builder method will be ignored, use Nested Queries instead If the query does projections then Include() Query Builder method will be ignored Use Address.ContactReference.Load() OR Contact.Addresses.Load() if you need to Deferred Load Specific Entity – This will result in extra round trips to the database ObjectQuery<> cannot return anonymous types... it will return a ObjectQuery<DBDataRecord> Only Include method can be added to Linq Query Methods Any Linq Query method can be added to Query Builder methods. If you need to append a Query Builder Method (other than Include) after a LINQ method  then cast the IQueryable<Contact> to ObjectQuery<Contact> and then append the Query Builder method to it =========================================================================== Query Builder methods are Select, Where, Include Methods which use Entity SQL as parameters e.g. "it.StartDate, it.EndDate" When Query Builder methods do projection then they return ObjectQuery<DBDataRecord>, thus to iterate over this collection use contact.Item[“Name”].ToString() When Linq To Entities methods do projection, they return collection of anonymous types --- thus the collection is strongly typed and supports Intellisense EF Object Context can track changes only on Entities, not on Anonymous types. If you use a Defining Query for a EntitySet then the EntitySet becomes readonly since a Defining Query is the same as a View (which is treated as a ReadOnly by default). However if you want to use this EntitySet for insert/update/deletes then we need to map stored procs (as created in the DB) to the insert/update/delete functions of the Entity in the Designer You can use either Execute method or ToList() method to bind data to datasources/bindingsources If you use the Execute Method then remember that you can traverse through the ObjectResult<> collection (returned by Execute) only ONCE. In WPF use ObservableCollection to bind to data sources , for keeping track of changes and letting EF send updates to the DB automatically. Use Extension Methods to add logic to Entities. For e.g. create extension methods for the EntityObject class. Create a method in ObjectContext Partial class and pass the entity as a parameter, then call this method as desired from within each entity. ================================================================ DefiningQueries and Stored Procedures: For Custom Entities, one can use DefiningQuery or Stored Procedures. Thus the Custom Entity Collection will be populated using the DefiningQuery (of the EntitySet) or the Sproc. If you use Sproc to populate the EntityCollection then the query execution is immediate and this execution happens on the Server side and any filters applied will be applied in the Client App. If we use a DefiningQuery then these queries are composable, meaning the filters (if applied to the entityset) will all be sent together as a single query to the DB, returning only filtered results. If the sproc returns results that cannot be mapped to existing entity, then we first create the Entity/EntitySet in the CSDL using Designer, then create a dummy Entity/EntitySet using XML in the SSDL. When creating a EntitySet in the SSDL for this dummy entity, use a TSQL that does not return any results, but does return the relevant columns e.g. select ContactID, FirstName, LastName from dbo.Contact where 1=2 Also insure that the Entity created in the SSDL uses the SQL DataTypes and not .NET DataTypes. If you are unable to open the EDMX file in the designer then note the Errors ... they will give precise info on what is wrong. The Thrid option is to simply create a Native Query in the SSDL using <Function Name="PaymentsforContact" IsComposable="false">   <CommandText>SELECT ActivityId, Activity AS ActivityName, ImagePath, Category FROM dbo.Activities </CommandText></FuncTion> Then map this Function to a existing Entity. This is a quick way to get a custom Entity which is regular Entity with renamed columns or additional columns (which are computed columns). The disadvantage to using this is that It will return all the rows from the Defining query and any filter (if defined) will be applied only at the Client side (after getting all the rows from DB). If you you DefiningQuery instead then we can use that as a Composable Query. The Fourth option (for mapping a READ stored proc results to a non-existent Entity) is to create a View in the Database which returns all the fields that the sproc also returns, then update the Model so that the model contains this View as a Entity. Then map the Read Sproc to this View Entity. The other option would be to simply create the View and remove the sproc altogether. ================================================================ To Execute a SProc that does not return a entity, use a EntityCommand to execute that proc. You cannot call a sproc FunctionImport that does not return Entities From Code, the only way is to use SSDL function calls using EntityCommand.  This changes with EntityFramework Version 4 where you can return Scalar Types, Complex Types, Entities or NonQuery ================================================================ UDF when created as a Function in SSDL, we need to set the Name & IsComposable properties for the Function element. IsComposable is always false for Sprocs, for UDF's set this to true. You cannot call UDF "Function" from within code since you cannot import a UDF Function into the CSDL Model (with Version 1 of EF). only stored procedures can be imported and then mapped to a entity ================================================================ Entity Framework requires properties that are involved in association mappings to be mapped in all of the function mappings for the entity (Insert, Update and Delete). Because Payment has an association to Reservation... hence we need to pass both the paymentId and reservationId to the Delete sproc even though just the paymentId is the PK on the Payment Table. ================================================================ When mapping insert, update and delete procs to a Entity, insure that all the three or none are mapped. Further if you have a base class and derived class in the CSDL, then you must map (ins, upd, del) sprocs to all parent and child entities in the inheritance relationship. Note that this limitation that base and derived entity methods must all must be mapped does not apply when you are mapping Read Stored Procedures.... ================================================================ You can write stored procedures SQL directly into the SSDL by creating a Function element in the SSDL and then once created, you can map this Function to a CSDL Entity directly in the designer during Function Import ================================================================ You can do Entity Splitting such that One Entity maps to multiple tables in the DB. For e.g. the Customer Entity currently derives from Contact Entity...in addition it also references the ContactPersonalInfo Entity. One can copy all properties from the ContactPersonalInfo Entity into the Customer Entity and then Delete the CustomerPersonalInfo entity, finall one needs to map the copied properties to the ContactPersonalInfo Table in Table Mapping (by adding another table (ContactPersonalInfo) to the Table Mapping... this is called Entity Splitting. Thus now when you insert a Customer record, it will automatically create SQL to insert records into the Contact, Customers and ContactPersonalInfo tables even though you have a Single Entity called Customer in the CSDL =================================================================== There is Table by Type Inheritance where another EDM Entity can derive from another EDM entity and absorb the inherted entities properties, for example in the Break Away Geek Adventures EDM, the Customer entity derives (inherits) from the Contact Entity and absorbs all the properties of Contact entity. Thus when you create a Customer Entity in Code and then call context.SaveChanges the Object Context will first create the TSQL to insert into the Contact Table followed by a TSQL to insert into the Customer table =================================================================== Then there is the Table per Hierarchy Inheritance..... where different types are created based on a condition (similar applying a condition to filter a Entity to contain filtered records)... the diference being that the filter condition populates a new Entity Type (derived from the base Entity). In the BreakAway sample the example is Lodging Entity which is a Abstract Entity and Then Resort and NonResort Entities which derive from Lodging Entity and records are filtered based on the value of the Resort Boolean field =================================================================== Then there is Table per Concrete Type Hierarchy where we create a concrete Entity for each table in the database. In the BreakAway sample there is a entity for the Reservation table and another Entity for the OldReservation table even though both the table contain the same number of fields. The OldReservation Entity can then inherit from the Reservation Entity and configure the OldReservation Entity to remove all Scalar Properties from the Entity (since it inherits the properties from Reservation and filters based on ReservationDate field) =================================================================== Complex Types (Complex Properties) Entities in EF can also contain Complex Properties (in addition to Scalar Properties) and these Complex Properties reference a ComplexType (not a EntityType) DropdownList, ListBox, RadioButtonList, CheckboxList, Bulletedlist are examples of List server controls (not data bound controls) these controls cannot use Complex properties during databinding, they need Scalar Properties. So if a Entity contains Complex properties and you need to bind those to list server controls then use projections to return Scalar properties and bind them to the control (the disadvantage is that projected collections are not tracked by the Object Context and hence cannot persist changes to the projected collections bound to controls) ObjectDataSource and EntityDataSource do account for Complex properties and one can bind entities with Complex Properties to Data Source controls and they will be tracked for changes... with no additional plumbing needed to persist changes to these collections bound to controls So DataBound controls like GridView, FormView need to use EntityDataSource or ObjectDataSource as a datasource for entities that contain Complex properties so that changes to the datasource done using the GridView can be persisted to the DB (enabling the controls for updates)....if you cannot use the EntityDataSource you need to flatten the ComplexType Properties using projections With EF Version 4 ComplexTypes are supported by the Designer and can add/remove/compose Complex Types directly using the Designer =================================================================== Conditional Mapping ... is like Table per Hierarchy Inheritance where Entities inherit from a base class and then used conditions to populate the EntitySet (called conditional Mapping). Conditional Mapping has limitations since you can only use =, is null and IS NOT NULL Conditions to do conditional mapping. If you need more operators for filtering/mapping conditionally then use QueryView(or possibly Defining Query) to create a readonly entity. QueryView are readonly by default... the EntitySet created by the QueryView is enabled for change tracking by the ObjectContext, however the ObjectContext cannot create insert/update/delete TSQL statements for these Entities when SaveChanges is called since it is QueryView. One way to get around this limitation is to map stored procedures for the insert/update/delete operations in the Designer. =================================================================== Difference between QueryView and Defining Query : QueryView is defined in the (MSL) Mapping File/section of the EDM XML, whereas the DefiningQuery is defined in the store schema (SSDL). QueryView is written using Entity SQL and is this database agnostic and can be used against any database/Data Layer. DefiningQuery is written using Database Lanaguage i.e. TSQL or PSQL thus you have more control =================================================================== Performance: Lazy loading is deferred loading done automatically. lazy loading is supported with EF version4 and is on by default. If you need to turn it off then use context.ContextOptions.lazyLoadingEnabled = false To improve Performance consider PreCompiling the ObjectQuery using the CompiledQuery.Compile method

  Read the article

• Latest Security Updates for Java are Available for Download

  - by Akemi Iwaya

  Oracle has released new updates that patch 40 security holes in their Java Runtime Environment software. Anyone who needs or actively uses the Java Runtime Environment for work or gaming should promptly update their Java installation as soon as possible. One thing to keep in mind is that there are limitations placed on updates for older versions of Java as shown in the following excerpt. If you are using an older version, then it is recommended that you update to the Java SE 7 release if possible (depending on your usage circumstances). From the The H Security blog post: Only the current version of Java, Java SE 7, will be updated for free; downloads of the new version, Java SE 7 Update 25, are available and existing installs should auto-update. Mac OS X users will get an updated Java SE 6 for their systems as an automatic update; Java SE 7 on Mac OS X is updated by Oracle. Users of other older versions of Java will only get updates if they have a maintenance contract with Oracle. Affected Product Releases and Versions: JDK and JRE 7 Update 21 and earlier JDK and JRE 6 Update 45 and earlier JDK and JRE 5.0 Update 45 and earlier JavaFX 2.2.21 and earlier Note: If you do not need Java on your system, we recommend uninstalling it entirely or disabling the browser plugin. You can download and read through the details about the latest Java updates by visiting the links shown below.    

  Read the article

• Need help with PHP web app bootstrapping error potentially related to Zend [migrated]

  - by Matt Shepherd

  I am trying to get a program called OpenFISMA running on an Ubuntu AMI in AWS. The app is not really coded on the Ubuntu platform, but I am in my comfort zone there, and have tried both CentOS and OpenSUSE (both are sort of "native" for the app) for getting it working with the same or worse results. So, why not just get it working on Ubuntu? Anyway, the app is found here: www.openfisma.org and an install guide is found here: https://openfisma.atlassian.net/wiki/display/030100/Installation+Guide The install guide kind of sucks. It doesn't list dependencies in any coherent way or provide much of any detail (does not even mention Zend once on the entire page) so I've done a lot of work to divine the information I do have. This page provided some dependency inf (though again, Zend is not mentioned once): https://openfisma.atlassian.net/wiki/display/PUBLIC/RPM+Management#RPMManagement-BasicOverviewofRPMPackages Anyway, I got all the way through the install (so far as I could reconstruct it). I am going to the login page for the first time, and there should be some sort of bootstrapping occurring when I load the page. (I am not a programmer so I have no idea what it is doing there.) Anyway, I get a message on the web page that says: "An exception occurred while bootstrapping the application." So, then I go look in /var/www/data/logs/php.log and find this message: [22-Oct-2013 17:29:18 UTC] PHP Fatal error: Uncaught exception 'Zend_Exception' with message 'No entry is registered for key 'Zend_Log'' in /var/www/library/Zend/Registry.php:147 Stack trace: #0 /var/www/public/index.php(188): Zend_Registry::get('Zend_Log') #1 {main} thrown in /var/www/library/Zend/Registry.php on line 147 This occurs every time I load the page. I gather there is an issue related to registering the Zend_Log variable in the Zend registry, but other than that I really have no idea what to do about it. Am I missing a package that it needs, or is this app not coded to register the variables properly? I have no clue. Any help is greatly appreciated. The application file referenced in the log message (index.php) is included below. <?php /** * Copyright (c) 2008 Endeavor Systems, Inc. * * This file is part of OpenFISMA. * * OpenFISMA is free software: you can redistribute it and/or modify it under the terms of the GNU General Public * License as published by the Free Software Foundation, either version 3 of the License, or (at your option) any later * version. * * OpenFISMA is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied * warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more * details. * * You should have received a copy of the GNU General Public License along with OpenFISMA. If not, see * {@link http://www.gnu.org/licenses/}. */ try { defined('APPLICATION_PATH') || define( 'APPLICATION_PATH', realpath(dirname(__FILE__) . '/../application') ); // Define application environment defined('APPLICATION_ENV') || define( 'APPLICATION_ENV', (getenv('APPLICATION_ENV') ? getenv('APPLICATION_ENV') : 'production') ); set_include_path( APPLICATION_PATH . '/../library/Symfony/Components' . PATH_SEPARATOR . APPLICATION_PATH . '/../library' . PATH_SEPARATOR . get_include_path() ); require_once 'Fisma.php'; require_once 'Zend/Application.php'; $application = new Zend_Application( APPLICATION_ENV, APPLICATION_PATH . '/config/application.ini' ); Fisma::setAppConfig($application->getOptions()); Fisma::initialize(Fisma::RUN_MODE_WEB_APP); $application->bootstrap()->run(); } catch (Zend_Config_Exception $zce) { // A zend config exception indicates that the application may not be installed properly echo '<h1>The application is not installed correctly</h1>'; $zceMsg = $zce->getMessage(); if (stristr($zceMsg, 'parse_ini_file') !== false) { if (stristr($zceMsg, 'application.ini') !== false) { if (stristr($zceMsg, 'No such file or directory') !== false) { echo 'The ' . APPLICATION_PATH . '/config/application.ini file is missing.'; } elseif (stristr($zceMsg, 'Permission denied') !== false) { echo 'The ' . APPLICATION_PATH . '/config/application.ini file does not have the ' . 'appropriate permissions set for the application to read it.'; } else { echo 'An ini-parsing error has occured in ' . APPLICATION_PATH . '/config/application.ini ' . '<br/>Please check this file and make sure everything is setup correctly.'; } } else if (stristr($zceMsg, 'database.ini') !== false) { if (stristr($zceMsg, 'No such file or directory') !== false) { echo 'The ' . APPLICATION_PATH . '/config/database.ini file is missing.<br/>'; echo 'If you find a database.ini.template file in the config directory, edit this file ' . 'appropriately and rename it to database.ini'; } elseif (stristr($zceMsg, 'Permission denied') !== false) { echo 'The ' . APPLICATION_PATH . '/config/database.ini file does not have the appropriate ' . 'permissions set for the application to read it.'; } else { echo 'An ini-parsing error has occured in ' . APPLICATION_PATH . '/config/database.ini ' . '<br/>Please check this file and make sure everything is setup correctly.'; } } else { echo 'An ini-parsing error has occured. <br/>Please check all configuration files and make sure ' . 'everything is setup correctly'; } } elseif (stristr($zceMsg, 'syntax error') !== false) { if (stristr($zceMsg, 'application.ini') !== false) { echo 'There is a syntax error in ' . APPLICATION_PATH . '/config/application.ini ' . '<br/>Please check this file and make sure everything is setup correctly.'; } elseif (stristr($zceMsg, 'database.ini') !== false) { echo 'There is a syntax error in ' . APPLICATION_PATH . '/config/database.ini ' . '<br/>Please check this file and make sure everything is setup correctly.'; } else { echo 'A syntax error has been reached. <br/>Please check all configuration files and make sure ' . 'everything is setup correctly.'; } } else { // Then the exception message says nothing about parse_ini_file nor 'syntax error' echo 'Please check all configuration files, and ensure all settings are valid.'; } echo '<br/>For more information and help on installing OpenFISMA, please refer to the ' . '<a target="_blank" href="http://manual.openfisma.org/display/ADMIN/Installation">' . 'Installation Guide</a>'; } catch (Doctrine_Manager_Exception $dme) { echo '<h1>An exception occurred while bootstrapping the application.</h1>'; // Does database.ini have valid settings? Or is it the same content as database.ini.template? $databaseIniFail = false; $iniData = file(APPLICATION_PATH . '/config/database.ini'); $iniData = str_replace(chr(10), '', $iniData); if (in_array('db.adapter = ##DB_ADAPTER##', $iniData)) { $databaseIniFail = true; } if (in_array('db.host = ##DB_HOST##', $iniData)) { $databaseIniFail = true; } if (in_array('db.port = ##DB_PORT##', $iniData)) { $databaseIniFail = true; } if (in_array('db.username = ##DB_USER##', $iniData)) { $databaseIniFail = true; } if (in_array('db.password = ##DB_PASS##', $iniData)) { $databaseIniFail = true; } if (in_array('db.schema = ##DB_NAME##', $iniData)) { $databaseIniFail = true; } if ($databaseIniFail) { echo 'You have not applied the settings in ' . APPLICATION_PATH . '/config/database.ini appropriately. ' . 'Please review the contents of this file and try again.'; } else { if (Fisma::debug()) { echo '<p>' . get_class($dme) . '</p><p>' . $dme->getMessage() . '</p><p>' . "<p><pre>Stack Trace:\n" . $dme->getTraceAsString() . '</pre></p>'; } else { $logString = get_class($dme) . "\n" . $dme->getMessage() . "\nStack Trace:\n" . $dme->getTraceAsString() . "\n"; Zend_Registry::get('Zend_Log')->err($logString); } } } catch (Exception $exception) { // If a bootstrap exception occurs, that indicates a serious problem, such as a syntax error. // We won't be able to do anything except display an error. echo '<h1>An exception occurred while bootstrapping the application.</h1>'; if (Fisma::debug()) { echo '<p>' . get_class($exception) . '</p><p>' . $exception->getMessage() . '</p><p>' . "<p><pre>Stack Trace:\n" . $exception->getTraceAsString() . '</pre></p>'; } else { $logString = get_class($exception) . "\n" . $exception->getMessage() . "\nStack Trace:\n" . $exception->getTraceAsString() . "\n"; Zend_Registry::get('Zend_Log')->err($logString); } }

  Read the article

• Suggested Web Application Framework and Database for Enterprise, “Big-Data” App?

  - by willOEM

  I have a web application that I have been developing for a small group within my company over the past few years, using Pipeline Pilot (plus jQuery and Python scripting) for web development and back-end computation, and Oracle 10g for my RDBMS. Users upload experimental genomic data, which is parsed into a database, and made available for querying, transformation, and reporting. Experimental data sets are large and have many layers of metadata. A given experimental data record might have a foreign key relationship with a table that describes this data point's assay. Assays can cover multiple genes, which can have multiple transcript, which can have multiple mutations, which can affect multiple signaling pathways, etc. Users need to approach this data from any point in those layers in the metadata. Since all data sets for a given data type can run over a billion rows, this results in some large, dynamic queries that are hard to predict. New data sets are added on a weekly basis (~1GB per set). Experimental data is never updated, but the associated metadata can be updated weekly for a few records and yearly for most others. For every data set insert the system sees, there will be between 10 and 100 selects run against it and associated data. It is okay for updates and inserts to run slow, so long as queries run quick and are as up-to-date as possible. The application continues to grow in size and scope and is already starting to run slower than I like. I am worried that we have about outgrown Pipeline Pilot, and perhaps Oracle (as the sole database). Would a NoSQL database or an OLAP system be appropriate here? What web application frameworks work well with systems like this? I'd like the solution to be something scalable, portable and supportable X-years down the road. Here is the current state of the application: Web Server/Data Processing: Pipeline Pilot on Windows Server + IIS Database: Oracle 10g, ~1TB of data, ~180 tables with several billion-plus row tables Network Storage: Isilon, ~50TB of low-priority raw data

  Read the article

• What should JavaScript be renamed to [closed]

  - by Evan Plaice

  Background: I have been watching Douglas Crockford's series of presentation about JavaScript History (which I highly recommend) lately and a one comment of his specifically piqued my attention. The trademark for 'JavaScript' is owned by Oracle History: Due to time constraints at Netscape, the language was literally written in weeks and released in very buggy form. To make it seem more appealing, Netscape picked JavaScript to appeal to the massively growing population of Java developers. Unfortunately, this pissed off Sun and stirred up a lot of controversy between the two organizations. At some point, they came to an agreement whereby Netscape was given permission to use the name as long as Sun owned the trademark. Some people incorrectly refer to JavaScript as ECMAScript because that's where the standard for the language is registered but, aside from it's current marketing-driven label, it doesn't really have a name. Fast Forward Sun goes down only to be swallowed by Oracle, who has no reservations about litigating for profit, now owns the name. So... If Oracle decides and forces JavaScript to take on a new name, what name would best represent the language?

  Read the article

• New Skool Crosstabbing

  - by Tim Dexter

  A while back I spoke about having to go back to BIP's original crosstabbing solution to achieve a certain layout. Hok Min has provided a 'man' page for the new crosstab/pivot builder for 10.1.3.4.1 users. This will make the documentation drop but for now, get it here! The old, hand method is still available but this new approach, is more efficient and flexible. That said you may need to get into the crosstab code to tweak it where the crosstab dialog can not help. I had to do this, this week but more on that later. The following explains how the crosstab wizard builds the crosstab and what the fields inside the resulting template structure are there for. To create the crosstab a new XDO command "<?crosstab:...?>" has been created. XDO Command: <?crosstab: ctvarname; data-element; rows; columns; measures; aggregation?> Parameter Description Example Ctvarname Crosstab variable name. This is automatically generated by the Add-in. C123 data-element This is the XML data element that contains the data. "//ROW" Rows This contains a list of XML elements for row headers. The ordering information is specified within "{" and "}". The first attribute is the sort element. Leaving it blank means the sort element is the same as the row header element. The attribute "o" means order. Its value can be "a" for ascending, or "d" for descending. The attribute "t" means type. Its value can be "t" for text, and "n" for numeric. There can be more than one sort elements, example: "emp-full-name {emp-lastname,o=a,t=n}{emp-firstname,o=a,t=n}. This will sort employee by last name and first name. "Region{,o=a,t=t}, District{,o=a,t=t}" In the example, the first row header is "Region". It is sort by "Region", order is ascending, and type is text. The second row header is "District". It is sort by "District", order is ascending, and type is text. Columns This contains a list of XML elements for columns headers. The ordering information is specified within "{" and "}". The first attribute is the sort element. Leaving it blank means the sort element is the same as the column header element. The attribute "o" means order. Its value can be "a" for ascending, or "d" for descending. The attribute "t" means type. Its value can be "t" for text, and "n" for numeric. There can be more than one sort elements, example: "emp-full-name {emp-lastname,o=a,t=n}{emp-firstname,o=a,t=n}. This will sort employee by last name and first name. "ProductsBrand{,o=a,t=t}, PeriodYear{,o=a,t=t}" In the example, the first column header is "ProductsBrand". It is sort by "ProductsBrand", order is ascending, and type is text. The second column header is "PeriodYear". It is sort by "District", order is ascending, and type is text. Measures This contains a list of XML elements for measures. "Revenue, PrevRevenue" Aggregation The aggregation function name. Currently, we only support "sum". "sum" Using the Oracle BI Publisher Template Builder for Word add-in, we are able to construct the following Pivot Table: The generated XDO command for this Pivot Table is as follow: <?crosstab:c547; "//ROW";"Region{,o=a,t=t}, District{,o=a,t=t}"; "ProductsBrand{,o=a,t=t},PeriodYear{,o=a,t=t}"; "Revenue, PrevRevenue";"sum"?> Running the command on the give XML data files generates this XML file "cttree.xml". Each XPath in the "cttree.xml" is described in the following table. Element XPath Count Description C0 /cttree/C0 1 This contains elements which are related to column. C1 /cttree/C0/C1 4 The first level column "ProductsBrand". There are four distinct values. They are shown in the label H element. CS /cttree/C0/C1/CS 4 The column-span value. It is used to format the crosstab table. H /cttree/C0/C1/H 4 The column header label. There are four distinct values "Enterprise", "Magicolor", "McCloskey" and "Valspar". T1 /cttree/C0/C1/T1 4 The sum for measure 1, which is Revenue. T2 /cttree/C0/C1/T2 4 The sum for measure 2, which is PrevRevenue. C2 /cttree/C0/C1/C2 8 The first level column "PeriodYear", which is the second group-by key. There are two distinct values "2001" and "2002". H /cttree/C0/C1/C2/H 8 The column header label. There are two distinct values "2001" and "2002". Since it is under C1, therefore the total number of entries is 4 x 2 => 8. T1 /cttree/C0/C1/C2/T1 8 The sum for measure 1 "Revenue". T2 /cttree/C0/C1/C2/T2 8 The sum for measure 2 "PrevRevenue". M0 /cttree/M0 1 This contains elements which are related to measures. M1 /cttree/M0/M1 1 This contains summary for measure 1. H /cttree/M0/M1/H 1 The measure 1 label, which is "Revenue". T /cttree/M0/M1/T 1 The sum of measure 1 for the entire xpath from "//ROW". M2 /cttree/M0/M2 1 This contains summary for measure 2. H /cttree/M0/M2/H 1 The measure 2 label, which is "PrevRevenue". T /cttree/M0/M2/T 1 The sum of measure 2 for the entire xpath from "//ROW". R0 /cttree/R0 1 This contains elements which are related to row. R1 /cttree/R0/R1 4 The first level row "Region". There are four distinct values, they are shown in the label H element. H /cttree/R0/R1/H 4 This is row header label for "Region". There are four distinct values "CENTRAL REGION", "EASTERN REGION", "SOUTHERN REGION" and "WESTERN REGION". RS /cttree/R0/R1/RS 4 The row-span value. It is used to format the crosstab table. T1 /cttree/R0/R1/T1 4 The sum of measure 1 "Revenue" for each distinct "Region" value. T2 /cttree/R0/R1/T2 4 The sum of measure 1 "Revenue" for each distinct "Region" value. R1C1 /cttree/R0/R1/R1C1 16 This contains elements from combining R1 and C1. There are 4 distinct values for "Region", and four distinct values for "ProductsBrand". Therefore, the combination is 4 X 4 è 16. T1 /cttree/R0/R1/R1C1/T1 16 The sum of measure 1 "Revenue" for each combination of "Region" and "ProductsBrand". T2 /cttree/R0/R1/R1C1/T2 16 The sum of measure 2 "PrevRevenue" for each combination of "Region" and "ProductsBrand". R1C2 /cttree/R0/R1/R1C1/R1C2 32 This contains elements from combining R1, C1 and C2. There are 4 distinct values for "Region", and four distinct values for "ProductsBrand", and two distinct values of "PeriodYear". Therefore, the combination is 4 X 4 X 2 è 32. T1 /cttree/R0/R1/R1C1/R1C2/T1 32 The sum of measure 1 "Revenue" for each combination of "Region", "ProductsBrand" and "PeriodYear". T2 /cttree/R0/R1/R1C1/R1C2/T2 32 The sum of measure 2 "PrevRevenue" for each combination of "Region", "ProductsBrand" and "PeriodYear". R2 /cttree/R0/R1/R2 18 This contains elements from combining R1 "Region" and R2 "District". Since the list of values in R2 has dependency on R1, therefore the number of entries is not just a simple multiplication. H /cttree/R0/R1/R2/H 18 The row header label for R2 "District". R1N /cttree/R0/R1/R2/R1N 18 The R2 position number within R1. This is used to check if it is the last row, and draw table border accordingly. T1 /cttree/R0/R1/R2/T1 18 The sum of measure 1 "Revenue" for each combination "Region" and "District". T2 /cttree/R0/R1/R2/T2 18 The sum of measure 2 "PrevRevenue" for each combination of "Region" and "District". R2C1 /cttree/R0/R1/R2/R2C1 72 This contains elements from combining R1, R2 and C1. T1 /cttree/R0/R1/R2/R2C1/T1 72 The sum of measure 1 "Revenue" for each combination of "Region", "District" and "ProductsBrand". T2 /cttree/R0/R1/R2/R2C1/T2 72 The sum of measure 2 "PrevRevenue" for each combination of "Region", "District" and "ProductsBrand". R2C2 /cttree/R0/R1/R2/R2C1/R2C2 144 This contains elements from combining R1, R2, C1 and C2, which gives the finest level of details. M1 /cttree/R0/R1/R2/R2C1/R2C2/M1 144 The sum of measure 1 "Revenue". M2 /cttree/R0/R1/R2/R2C1/R2C2/M2 144 The sum of measure 2 "PrevRevenue". Lots to read and digest I know! Customization One new feature I discovered this week is the ability to show one column and sort by another. I had a data set that was extracting month abbreviations, we wanted to show the months across the top and some row headers to the side. As you may know XSL is not great with dates, especially recognising month names. It just wants to sort them alphabetically, so Apr comes before Jan, etc. A way around this is to generate a month number alongside the month and use that to sort. We can do that in the crosstab, sadly its not exposed in the UI yet but its doable. Go back up and take a look a the initial crosstab command. especially the Rows and Columns entries. In there you will find the sort criteria. "ProductsBrand{,o=a,t=t}, PeriodYear{,o=a,t=t}" Notice those leading commas inside the curly braces? Because there is no field preceding them it means that the crosstab should sort on the column before the brace ie PeriodYear. But you can insert another column in the data set to sort by. To get my sort working how I needed. <?crosstab:c794;"current-group()";"_Fund_Type_._Fund_Type_Display_{_Fund_Type_._Fund_Type_Sort_,o=a,t=n}";"_Fiscal_Period__Amount__._Amt_Fm_Disp_Abbr_{_Fiscal_Period__Amount__._Amt_Fiscal_Month_Sort_,o=a,t=n}";"_Execution_Facts_._Amt_";"sum"?> Excuse the horribly verbose XML tags, good ol BIEE :0) The emboldened columns are not in the crosstab but are in the data set. I just opened up the field, dropped them in and changed the type(t) value to be 'n', for number, instead of the default 'a' and my crosstab started sorting how I wanted it. If you find other tips and tricks, please share in the comments.

  Read the article

• What is ODBC?

  According to Microsoft, ODBC is a specification for a database API.  This API is database and operating system agnostic due to the fact that the primary goal of the ODBC API is to be language-independent. Additionally, the open functions of the API are created by the manufactures of DBMS-specific drivers. Developers can use these exposed functions from within their own custom applications so that they can communicate with DBMS through the language-independent drivers. ODBC Advantages Multiple ODBC drivers for each DBSM Example Oracle’s ODBC Driver Merant’s Oracle Driver Microsoft’s Oracle Driver ODBC Drivers are constantly updated for the latest data types ODBC allows for more control when querying ODBC allows for Isolation Levels ODBC Disadvantages ODBC Requires DSN ODBC is the proxy between an application and a database ODBC is dependent on third party drivers ODBC Transaction Isolation Levels are related to and limited by the transaction management capabilities of the data source. Transaction isolation levels:  READ UNCOMMITTED Data is allowed to be read prior to the committing of a transaction.  READ COMMITTED Data is only accessible after a transaction has completed  REPEATABLE READ The same data value is read during the entire transaction  SERIALIZABLE Transactions have no effect on other transactions

  Read the article

• Social Business Forum Milano: Day 1

  - by me

  div.c50 {font-family: Helvetica;} div.c49 {position: relative; height: 0px; overflow: hidden;} span.c48 {color: #333333; font-size: 14px; line-height: 18px;} div.c47 {background-color: #ffffff; border-left: 1px solid rgba(0, 0, 0, 0.098); border-right: 1px solid rgba(0, 0, 0, 0.098); background-clip: padding-box;} div.c46 {color: #666666; font-family: arial, helvetica, sans-serif; font-weight: normal} span.c45 {line-height: 14px;} div.c44 {border-width: 0px; font-family: arial, helvetica, sans-serif; margin: 0px; outline-width: 0px; padding: 0px 0px 10px; vertical-align: baseline} div.c43 {border-width: 0px; margin: 0px; outline-width: 0px; padding: 0px 0px 10px; vertical-align: baseline;} p.c42 {color: #666666; font-family: arial, helvetica, sans-serif} span.c41 {line-height: 14px; font-size: 11px;} h2.c40 {font-family: arial, helvetica, sans-serif} p.c39 {font-family: arial, helvetica, sans-serif} span.c38 {font-family: arial, helvetica, sans-serif; font-size: 80%; font-weight: bold} div.c37 {color: #999999; font-size: 14px; font-weight: normal; line-height: 18px} div.c36 {background-clip: padding-box; background-color: #ffffff; border-bottom: 1px solid #e8e8e8; border-left: 1px solid rgba(0, 0, 0, 0.098); border-right: 1px solid rgba(0, 0, 0, 0.098); cursor: pointer; margin-left: 58px; min-height: 51px; padding: 9px 12px; position: relative; z-index: auto} div.c35 {background-clip: padding-box; background-color: #ffffff; border-bottom: 1px solid #e8e8e8; border-left: 1px solid rgba(0, 0, 0, 0.098); border-right: 1px solid rgba(0, 0, 0, 0.098); cursor: pointer; margin-left: 58px; min-height: 51px; padding: 9px 12px; position: relative} div.c34 {overflow: hidden; font-size: 12px; padding-top: 1px;} ul.c33 {padding: 0px; margin: 0px; list-style-type: none; opacity: 0;} li.c32 {display: inline;} a.c31 {color: #298500; text-decoration: none; outline-width: 0px; font-size: 12px; margin-left: 8px;} a.c30 {color: #999999; text-decoration: none; outline-width: 0px; font-size: 12px; float: left; margin-right: 2px;} strong.c29 {font-weight: normal; color: #298500;} span.c28 {color: #999999;} div.c27 {font-family: arial, helvetica, sans-serif; margin: 0px; word-wrap: break-word} span.c26 {border-width: 0px; width: 48px; height: 48px; border-radius: 5px 5px 5px 5px; position: absolute; top: 12px; left: 12px;} small.c25 {font-size: 12px; color: #bbbbbb; position: absolute; top: 9px; right: 12px; float: right; margin-top: 1px;} a.c24 {color: #999999; text-decoration: none; outline-width: 0px; font-size: 12px;} h3.c23 {font-family: arial, helvetica, sans-serif} span.c22 {font-family: arial, helvetica, sans-serif} div.c21 {display: inline ! important; font-weight: normal} span.c20 {font-family: arial, helvetica, sans-serif; font-size: 80%} a.c19 {font-weight: normal;} span.c18 {font-weight: normal;} div.c17 {font-weight: normal;} div.c16 {margin: 0px; word-wrap: break-word;} a.c15 {color: #298500; text-decoration: none; outline-width: 0px;} strong.c14 {font-weight: normal; color: inherit;} span.c13 {color: #7eb566; text-decoration: none} span.c12 {color: #333333; font-family: arial, helvetica, sans-serif; font-size: 14px; line-height: 18px} a.c11 {color: #999999; text-decoration: none; outline-width: 0px;} span.c10 {font-size: 12px; color: #999999; direction: ltr; unicode-bidi: embed;} strong.c9 {font-weight: normal;} span.c8 {color: #bbbbbb; text-decoration: none} strong.c7 {font-weight: bold; color: #333333;} div.c6 {font-family: arial, helvetica, sans-serif; font-weight: normal} div.c5 {font-family: arial, helvetica, sans-serif; font-size: 80%; font-weight: normal} p.c4 {font-family: arial, helvetica, sans-serif; font-size: 80%; font-weight: normal} h3.c3 {font-family: arial, helvetica, sans-serif; font-weight: bold} span.c2 {font-size: 80%} span.c1 {font-family: arial,helvetica,sans-serif;} Here are my impressions of the first day of the Social Business Forum in Milano A dialogue on Social Business Manifesto - Emanuele Scotti, Rosario Sica The presentation was focusing on Thesis and Anti-Thesis around Social Business My favorite one is: Peter H. Reiser ?@peterreiser social business manifesto theses #2: organizations are conversations - hello Oracle Social Network #sbf12 Here are the Thesis (auto-translated from italian to english) From Stress to Success - Pragmatic pathways for Social Business - John Hagel John Hagel talked about challenges of deploying new social technologies. Below are some key points participant tweeted during the session. 6hRhiannon Hughes ?@Rhi_Hughes Favourite quote this morning 'We need to strengthen the champions & neutralise the enemies' John Hagel. Not a hard task at all #sbf12 Expand Reply Retweet Favorite 8hElena Torresani ?@ElenaTorresani Minimize the power of the enemies of change. Maximize the power of the champions - John Hagel #sbf12 Expand Reply Retweet Favorite 8hGaetano Mazzanti ?@mgaewsj John Hagel change: minimize the power of the enemies #sbf12 Expand Reply Retweet Favorite 8hGaetano Mazzanti ?@mgaewsj John Hagel social software as band-aid for poor leadtime/waste management? mmm #sbf12 Expand Reply Retweet Favorite 8hElena Torresani ?@ElenaTorresani "information is power. We need access to information to get power"John Hagel, Deloitte &Touche #sbf12http://instagr.am/p/LcjgFqMXrf/ View photo Reply Retweet Favorite 8hItalo Marconi ?@italomarconi Information is power and Knowledge is subversive. John Hagel#sbf12 Expand Reply Retweet Favorite 8hdanielce ?@danielce #sbf12 john Hagel: innovation is not rational. from Milano, Milano Reply Retweet Favorite 8hGaetano Mazzanti ?@mgaewsj John Hagel: change is a political (not rational) process #sbf12 Expand Reply Retweet Favorite Enterprise gamification to drive engagement - Ray Wang Ray Wang did an excellent speech around engagement strategies and gamification More details can be found on the Harvard Business Review blog Panel Discussion: Does technology matter? Understanding how software enables or prevents participation Christian Finn, Ram Menon, Mike Gotta, moderated by Paolo Calderari Below are the highlights of the panel discussions as live tweets: 2hPeter H. Reiser ?@peterreiser @cfinn Q: social silos: mega trend social suites - do we create social silos + apps silos + org silos ... #sbf12 Expand Reply Delete Favorite 2hPeter H. Reiser ?@peterreiser @cfinn A: Social will be less siloed - more integrated into application design. Analyatics is key to make intelligent decisions #sbf12 Expand Reply Delete Favorite 2hPeter H. Reiser ?@peterreiser @MikeGotta - A: its more social be design then social by layer - Better work experience using social design. #sbf12 Expand Reply Delete Favorite 2hPeter H. Reiser ?@peterreiser Ram Menon: A: Social + Mobile + consumeration is coming together#sbf12 Expand Reply Delete Favorite 2hPeter H. Reiser ?@peterreiser Q: What is the evolution for social business solution in the next 4-5 years? #sbf12 Expand Reply Delete Favorite 2hPeter H. Reiser ?@peterreiser @cfinn Adoption: A: User experience is king - no training needed - We let you participate into a conversation via mobile and email#sbf12 Expand Reply Delete Favorite 2hPeter H. Reiser ?@peterreiser @MikeGotta A:Adoption - how can we measure quality? Literacy - Are people get confident to talk to a invisible audience ? #sbf12 Expand Reply Delete Favorite 2hPeter H. Reiser ?@peterreiser Ram Meno: A:Adoption - What should I measure ? Depend on business goal you want to active? #sbf12 Expand Reply Delete Favorite 2hPeter H. Reiser ?@peterreiser Q: How can technology facilitate adoption #sbf12 Expand Reply Delete Favorite 2hPeter H. Reiser ?@peterreiser #sbf12 @cfinn @mgotta Ram Menon at panel discussion about social technology @oraclewebcenter http://pic.twitter.com/Pquz73jO View photo Reply Delete Favorite 2hPeter H. Reiser ?@peterreiser Ram Menon: 100% of data is in a system somewhere. 100% of collective intelligence is with people. Social System bridge both worlds Expand Reply Delete Favorite 2hPeter H. Reiser ?@peterreiser #sbf12 @MikeGotta Adoption is specific to the culture of the company Expand Reply Delete Favorite 2hPeter H. Reiser ?@peterreiser @cfinn - drive adoption is important @MikeGotta - activity stream + watch list is most important feature in a social system #sbf12 Expand Reply Delete Favorite 2hPeter H. Reiser ?@peterreiser @MikeGotta Why just adoption? email as 100% adoption? #sbf12 Expand Reply Delete Favorite 2hPeter H. Reiser ?@peterreiser @MikeGotta Ram Menon respond: there is only 1 questions to ask: What is the adoption? #sbf12 @socialadoption you like this ? #sbf12 Expand Reply Delete Favorite 3hPeter H. Reiser ?@peterreiser @MikeGotta - just replacing old technology (e.g. email) with new technology does not help. we need to change model/attitude #sbf12 Expand Reply Delete Favorite 3hPeter H. Reiser ?@peterreiser Ram Menon: CEO mandated to replace 6500 email aliases with Social Networking Software #sbf12 Expand Reply Delete Favorite 3hPeter H. Reiser ?@peterreiser @MikeGotta A: How to bring interface together #sbf12 . Going from point tools to platform, UI, Architecture + Eco-system is important Expand Reply Delete Favorite 3hPeter H. Reiser ?@peterreiser Q: How is technology important in Social Business #sbf12 A:@cfinn - technology is enabler , user experience -easy of use is important Expand Reply Delete Favorite 3hPeter H. Reiser ?@peterreiser @cfinn particiapte in panel "Does technology matter? Understanding how software enables or prevents participation" #sbf #webcenter

  Read the article

• How do I resolve a plugin conflict in Eclipse?

  - by Jason Thompson

  I'd like to upgrade my Helios installation of Eclipse to Indigo. When I do, I get the following message: Cannot complete the install because of a conflicting dependency. Software being installed: Eclipse IDE for Java EE Developers 1.4.2.20120213-0813 (epp.package.jee 1.4.2.20120213-0813) Software currently installed: Oracle GlassFish Server Tools 1.6.1.201009290929 (oracle.eclipse.tools.helios.glassfish.feature.group 1.6.1.201009290929) So my first thought was to simply uninstall GlassFish. For the life of me, I can't figure out how and where to go to do this. I went to Help-About Eclipse...-Installation Details. The only place that it looks like I can uninstall stuff is in the "Installed Software" tab. I do not see the Oracle Glassfish package anywhere. If I go to "Feature" or "Plug-ins", I can find it just fine, but there is no option to uninstall. So my next thought was to upgrade Glassfish. So I put the indigo repo in there, but I still get the same message when trying to update. Any ideas?

  Read the article

• SQL SERVER – Migration Assistant Upgraded to Support SQL Server 2014

  - by Pinal Dave

  We all start somewhere when it is about database. There are different reasons, why we go for one database over another database. Usually the reason is cost and convenience. After a period of time when business is successful and traffic is growing, the same two reasons of cost and convenience start to become secondary goals. I have seen quite a lot of companies starting with free databases and after a while switching to another database as they want stability and service from the product company. Microsoft has an excellent product which lets you migrate your database from the alternate database to SQL Server. It is called SQL Server Migration Assistant (SSMA) and earlier this week, it has been upgraded to support SQL Server 2014. Now you can migrate from your database to to all editions of SQL Server 2005, SQL Server 2008, SQL Server 2008 R2, SQL Server 2012 and SQL Server 2014. SQL Server Migration Assistant (SSMA) is a free supported tool from Microsoft. Here is where you can download SSMA v5.3 for various databases. Microsoft SQL Server Migration Assistant v5.3 for Access Microsoft SQL Server Migration Assistant (SSMA) for Access is a tool to automate migration from Microsoft Access database(s) to SQL Server Microsoft SQL Server Migration Assistant v5.3 for Oracle Microsoft SQL Server Migration Assistant (SSMA) for Oracle is a tool to automate migration from Oracle database to SQL Server. Microsoft SQL Server Migration Assistant v5.3 for Sybase Microsoft SQL Server Migration Assistant (SSMA) for Sybase is a tool to automate migration from Sybase ASE database to SQL Server. Microsoft SQL Server Migration Assistant v5.3 for MySQL Microsoft SQL Server Migration Assistant (SSMA) for MySQL is a tool to automate migration from MySQL database to SQL Server. Reference: Pinal Dave (http://blog.sqlauthority.com)Filed under: MySQL, PostADay, SQL, SQL Authority, SQL Documentation, SQL Download, SQL Query, SQL Server, SQL Tips and Tricks, T SQL

  Read the article

• Entity Framework &amp; Transactions

  - by Sudheer Kumar

  There are many instances we might have to use transactions to maintain data consistency. With Entity Framework, it is a little different conceptually. Case 1 – Transaction b/w multiple SaveChanges(): here if you just use a transaction scope, then Entity Framework (EF) will use distributed transactions instead of local transactions. The reason is that, EF closes and opens the connection when ever required only, which means, it used 2 different connections for different SaveChanges() calls. To resolve this, use the following method. Here we are opening a connection explicitly so as not to span across multipel connections.   using (TransactionScope ts = new TransactionScope()) {     context.Connection.Open();     //Operation1 : context.SaveChanges();     //Operation2 :  context.SaveChanges()     //At the end close the connection     ts.Complete(); } catch (Exception ex) {       //Handle Exception } finally {       if (context.Connection.State == ConnectionState.Open)       {            context.Connection.Close();       } }   Case 2 – Transaction between DB & Non-DB operations: For example, assume that you have a table that keeps track of Emails to be sent. Here you want to update certain details like DataSent once if the mail was successfully sent by the e-mail client. Email eml = GetEmailToSend(); eml.DateSent = DateTime.Now; using (TransactionScope ts = new TransactionScope()) {    //Update DB    context.saveChanges();   //if update is successful, send the email using smtp client   smtpClient.Send();   //if send was successful, then commit   ts.Complete(); }   Here since you are dealing with a single context.SaveChanges(), you just need to use the TransactionScope, just before saving the context only.   Hope this was helpful!

  Read the article

• Top 5 Developer Enabling Nuggets in MySQL 5.6

  - by Rob Young

  MySQL 5.6 is truly a better MySQL and reflects Oracle's commitment to the evolution of the most popular and widelyused open source database on the planet.  The feature-complete 5.6 release candidate was announced at MySQL Connect in late September and the production-ready, generally available ("GA") product should be available in early 2013.  While the message around 5.6 has been focused mainly on mass appeal, advanced topics like performance/scale, high availability, and self-healing replication clusters, MySQL 5.6 also provides many developer-friendly nuggets that are designed to enable those who are building the next generation of web-based and embedded applications and services. Boiling down the 5.6 feature set into a smaller set, of simple, easy to use goodies designed with developer agility in mind, these things deserve a quick look:Subquery Optimizations Using semi-JOINs and late materialization, the MySQL 5.6 Optimizer delivers greatly improved subquery performance. Specifically, the optimizer is now more efficient in handling subqueries in the FROM clause; materialization of subqueries in the FROM clause is now postponed until their contents are needed during execution. Additionally, the optimizer may add an index to derived tables during execution to speed up row retrieval. Internal tests run using the DBT-3 benchmark Query #13, shown below, demonstrate an order of magnitude improvement in execution times (from days to seconds) over previous versions. select c_name, c_custkey, o_orderkey, o_orderdate, o_totalprice, sum(l_quantity)from customer, orders, lineitemwhere o_orderkey in (                select l_orderkey                from lineitem                group by l_orderkey                having sum(l_quantity) > 313  )  and c_custkey = o_custkey  and o_orderkey = l_orderkeygroup by c_name, c_custkey, o_orderkey, o_orderdate, o_totalpriceorder by o_totalprice desc, o_orderdateLIMIT 100;What does this mean for developers?  For starters, simplified subqueries can now be coded instead of complex joins for cross table lookups: SELECT title FROM film WHERE film_id IN (SELECT film_id FROM film_actor GROUP BY film_id HAVING count(*) > 12); And even more importantly subqueries embedded in packaged applications no longer need to be re-written into joins.  This is good news for both ISVs and their customers who have access to the underlying queries and who have spent development cycles writing, testing and maintaining their own versions of re-written queries across updated versions of a packaged app.The details are in the MySQL 5.6 docs. Online DDL OperationsToday's web-based applications are designed to rapidly evolve and adapt to meet business and revenue-generationrequirements. As a result, development SLAs are now most often measured in minutes vs days or weeks. For example, when an application must quickly support new product lines or new products within existing product lines, the backend database schema must adapt in kind, and most commonly while the application remains available for normal business operations.  MySQL 5.6 supports this level of online schema flexibility and agility by providing the following new ALTER TABLE online DDL syntax additions:  CREATE INDEX DROP INDEX Change AUTO_INCREMENT value for a column ADD/DROP FOREIGN KEY Rename COLUMN Change ROW FORMAT, KEY_BLOCK_SIZE for a table Change COLUMN NULL, NOT_NULL Add, drop, reorder COLUMN Again, the details are in the MySQL 5.6 docs. Key-value access to InnoDB via Memcached APIMany of the next generation of web, cloud, social and mobile applications require fast operations against simple Key/Value pairs. At the same time, they must retain the ability to run complex queries against the same data, as well as ensure the data is protected with ACID guarantees. With the new NoSQL API for InnoDB, developers have allthe benefits of a transactional RDBMS, coupled with the performance capabilities of Key/Value store.MySQL 5.6 provides simple, key-value interaction with InnoDB data via the familiar Memcached API.  Implemented via a new Memcached daemon plug-in to mysqld, the new Memcached protocol is mapped directly to the native InnoDB API and enables developers to use existing Memcached clients to bypass the expense of query parsing and go directly to InnoDB data for lookups and transactional compliant updates.  The API makes it possible to re-use standard Memcached libraries and clients, while extending Memcached functionality by integrating a persistent, crash-safe, transactional database back-end.  The implementation is shown here:So does this option provide a performance benefit over SQL?  Internal performance benchmarks using a customized Java application and test harness show some very promising results with a 9X improvement in overall throughput for SET/INSERT operations:You can follow the InnoDB team blog for the methodology, implementation and internal test cases that generated these results here. How to get started with Memcached API to InnoDB is here. New Instrumentation in Performance SchemaThe MySQL Performance Schema was introduced in MySQL 5.5 and is designed to provide point in time metrics for key performance indicators.  MySQL 5.6 improves the Performance Schema in answer to the most common DBA and Developer problems.  New instrumentations include: Statements/Stages What are my most resource intensive queries? Where do they spend time? Table/Index I/O, Table Locks Which application tables/indexes cause the most load or contention? Users/Hosts/Accounts Which application users, hosts, accounts are consuming the most resources? Network I/O What is the network load like? How long do sessions idle? Summaries Aggregated statistics grouped by statement, thread, user, host, account or object. The MySQL 5.6 Performance Schema is now enabled by default in the my.cnf file with optimized and auto-tune settings that minimize overhead (< 5%, but mileage will vary), so using the Performance Schema ona production server to monitor the most common application use cases is less of an issue.  In addition, new atomic levels of instrumentation enable the capture of granular levels of resource consumption by users, hosts, accounts, applications, etc. for billing and chargeback purposes in cloud computing environments.The MySQL docs are an excellent resource for all that is available and that can be done with the 5.6 Performance Schema. Better Condition Handling - GET DIAGNOSTICSMySQL 5.6 enables developers to easily check for error conditions and code for exceptions by introducing the new MySQL Diagnostics Area and corresponding GET DIAGNOSTICS interface command. The Diagnostic Area can be populated via multiple options and provides 2 kinds of information:Statement - which provides affected row count and number of conditions that occurredCondition - which provides error codes and messages for all conditions that were returned by a previous operation The addressable items for each are: The new GET DIAGNOSTICS command provides a standard interface into the Diagnostics Area and can be used via the CLI or from within application code to easily retrieve and handle the results of the most recent statement execution.  An example of how it is used might be:mysql> DROP TABLE test.no_such_table; ERROR 1051 (42S02): Unknown table 'test.no_such_table' mysql> GET DIAGNOSTICS CONDITION 1 -> @p1 = RETURNED_SQLSTATE, @p2 = MESSAGE_TEXT; mysql> SELECT @p1, @p2; +-------+------------------------------------+| @p1   | @p2                                | +-------+------------------------------------+| 42S02 | Unknown table 'test.no_such_table' | +-------+------------------------------------+ Options for leveraging the MySQL Diagnotics Area and GET DIAGNOSTICS are detailed in the MySQL Docs.While the above is a summary of some of the key developer enabling 5.6 features, it is by no means exhaustive. You can dig deeper into what MySQL 5.6 has to offer by reading this developer zone article or checking out "What's New in MySQL 5.6" in the MySQL docs.BONUS ALERT!  If you are developing on Windows or are considering MySQL as an alternative to SQL Server for your next project, application or shipping product, you should check out the MySQL Installer for Windows.  The installer includes the MySQL 5.6 RC database, all drivers, Visual Studio and Excel plugins, tray monitor and development tools all a single download and GUI installer.   So what are your next steps? Register for Dec. 13 "MySQL 5.6: Building the Next Generation of Web-Based Applications and Services" live web event.  Hurry!  Seats are limited. Download the MySQL 5.6 Release Candidate (look under the Development Releases tab) Provide Feedback <link to http://bugs.mysql.com/> Join the Developer discussion on the MySQL Forums Explore all MySQL Products and Developer Tools As always, thanks for your continued support of MySQL!

  Read the article

< Previous Page | 535 536 537 538 539 540 541 542 543 544 545 546  | Next Page >