Search Results

Search found 21298 results on 852 pages for 'www mechanize'.

Page 540/852 | < Previous Page | 536 537 538 539 540 541 542 543 544 545 546 547  | Next Page >

  • Will we be penalized for having multiple external links to the same site?

    - by merk
    There seem to be conflicting answers on this question. The most relevant ones seem to be at least a year or two old, so I thought it would be worth re-asking this question. My gut says it's ok, because there are plenty of sites out there that do this already. Every major retailer site usually has links to the manufacturer of whatever item they are selling. go to www.newegg.com and they have hundreds of links to the same site since they sell multiple items from the same brand. Our site allows people to list a specific genre of items for sale (not porn - i'm just keeping it generic since I'm not trying to advertise) and on each item listing page, we have a link back to their website if they want. Our SEO guy is saying this is really bad and google is going to treat us as a link farm. My gut says when we have to start limiting user useful features to our site to boost our ranking, then something is wrong. Or start jumping through hoops by trying to hide text using javascript etc Some clients are only selling 1 to a handful of items, while a couple of our bigger clients have hundreds of items listed so will have hundreds of pages that link back to their site. I should also mention, there will be a handful of pages with the bigger clients where it may appear they have duplicate pages, because they will be selling 2 or 3 of the same item, and the only difference in the content of the page might just be a stock #. The majority of the pages though will have unique content. So - will we be penalized in some way for having anywhere from a handful to a few hundred pages that all point to the same link? If we are penalized, what's the suggested way to handle this? We still want to give users the option to go to the clients site, and we would still like to give a link back to the clients site to help their own SE rankings.

    Read the article

  • What would cause a single working website to not work on 1 out of 5 devices on a network?

    - by th3dude
    There is a specific website that loads up without problem on all machines on my network (both wired and wireless) except one laptop. This laptop is a Windows 7 machine that was just recovered using the recovery partition, so it is fresh. The site will not load in Firefox 3.6 or IE 8. The website is http://www.weightwacthers.com The site loads fine on my desktop, iPhone, and Droid, but not the laptop. In all my years in this business I've honestly never seen this happen. Also, 'Is it down for me or everyone' reports that it is indeed only me. What would cause this to happen?

    Read the article

  • Which metric/list should be used to evaluate whole software development team?

    - by adt
    Title might be seem vague, so let me tell you a little bit history what i am trying to clarify question. I have been hired as a consultant for a corporate's small developement divison ( The company also owns a couple of software dev. companies) My ex manager runs a BI team, with reportes, analyts and developers. He asked me to evaluate overall design, software developement process and code quality . Here what i found, Lots of copy/paste code everywhere ( no reuse ) Even though they have everything TFS, VS Ultimate etc, No Build process , No Cruise Control.net / team city... No unit tests Web Pages with 3700 lines of code, Lots of huge functions ( which can be divided into smaller one's ) No naming convention both db and c# code No 3r party or open source project No IoC No Seperation Of Concerns No Code Quality Check ( NDepend or FxCope or nothing ) No Code Review No Communication within the team They claim they wrote an application framework ( 6 months 3 persons), but I would hardly call a framework ( of course no unit test, there are some but all commented out). Framework contains 14 projects but there are some projects with 1 file 20 lines of code . Honestly, what people are doing fixing bug all thr day( which will provide more bugs eventually), they are kind of isolated from community, some team members even dont know github or stackoverflow they probably went there with google but they dont know about it. So here is question, Is This list ok ? Or am i being picky? Since I dont have any grudge against them, I just want to be fair, honest and I would like to hear you suggestions, before I would submit this list. And since this list also will be review by software division's manager, I dont want any heart break or something like this. http://www.hanselman.com/altnetgeekcode/ For example I would love to such lists, i cant make references. Thanks in advance.

    Read the article

  • Run a specific command from a directory

    - by Cameron Kilgore
    I have a bash script where I need to run an init utility within a directory with a configuration file defined. I don't think it's possible to explicitly tell the utility to run the file as an argument, so what I need to do is go to the directory with the config file, and then run the command. I have some logic in place, but its not working -- the utility never runs. Is there any way I can tell the script to go to this directory, and then run the script? cd /var/www/testing-dev.example.co eval "standardprofile"

    Read the article

  • Allow Internet Access with Default Gateway on Windows 7 VPN Server

    - by Hakoda
    I have a Windows 7 box at home (which I'll refer to as Home-VPN) that runs a simple PPTP VPN server. I have a range of 2 IP address (192.168.1.10-192.168.1.11) to give out, although the server is only able to give out one concurrent connection. Ports 1723 & 47 are correctly forwarded to the server. IPv6 is disabled on both Home-VPN and the client. I setup Home-VPN just like this Youtube video: http://www.youtube.com/watch?v=1s5JxMG06L4 I can connect to it just fine but I can't access the Internet when connected to Home-VPN, all outside web servers (eg. google.com, mozilla.org, apple.com) are unreachable. I know I can uncheck "Use Default Gateway on Remote Servers" on the client side under IPv4 settings but that will route all my traffic through my current connection, rather than through the VPN, defeating the purpose of said VPN. Any ideas on how I can fix this?

    Read the article

  • Apache deny access to images folder, but still able to display via <img> on site

    - by jeffery_the_wind
    I have an images folder on my site, let's call it /images/ where I keep a lot of images. I don't want anyone to have direct access to the images via the web, so I put a new directive in my Apache config that achieves this: <Directory "/var/www/images/"> Options Includes AllowOverride All Order allow,deny Deny from All </Directory> This is working, but it is blocking out ALL ACCESS, and I can't show the images anymore through my web pages. I guess this makes sense. So how do I selectively control access to these images? Basically I only want to display certain images through certain webpages and to certain users. What is best way to do this? Do I need to save the images to the database? Tim

    Read the article

  • Ideal permissions scheme for multiple Apache/PHP sites...

    - by Omega
    I'm hosting multiple sites from one server where each site has it's own user and www directory in their home dir. Currently our web server runs as user nobody(99). We're noticing that to run several popular scripts and engines, they require write access to their own files. As the home directory is owned by the user, not nobody(99), what is the best policy or change in hosting configuration that would: ...make it so that all the various engines and platforms work? ...still allow us to work with files and edit them without having to diddle with permissions as root? Thanks for the advice!

    Read the article

  • How to write to Samba folder?

    - by Darren
    Hi all, I created a Samba share on my CentOS machine and I can connect to the share and read the contents but I cannot write files to it or delete them. In Samba I have set readable to yes and writeable to yes, as well as made the folder I want to access apart of the wheel group of which I added the user that is accessing it from Samba. The folder in quesiton is /var/www/. I have set that folder and all folders under it to the wheel group which can read and write to it. What am I doing wrong here?

    Read the article

  • The Freemium-Premium Puzzle

    The more time I spend thinking about the value of information, the more I found that digitalizing information significantly changed the 'information markets', potentially in an irreversible manner. The graph at the bottom outlines my current view. The existing business models tend to be the same in the digital and analogue information world, i.e. revenue is derived from a combination of consumers' payments and advertisement. Even monetizing 'meta-information' such as search engines isn't new. Just think of the once popular 'Who'sWho'. What really changed is the price-value ratio. The curve is pushed down, closer to the axis. You pay less for the same, or often even get more for less. If you recall the capabilities I described in relevance of information you will see that there are many additional features available for digital content compared to analogue content. I think this is a good 'blue ocean strategy' by combining existing capabilities in a new way. (Kim W.C. & Mauborgne, R. (2005) Blue Ocean Strategies. Boston: Harvard Business School Publishing.). In addition the different channels of digital information distribution significantly change the value of information. I will touch on this in one of my next blogs. Right now, many information providers started to offer 'freemium' content through digital channels, hoping to get a premium for the 'full' content. No freemium seems to take them out of business, because they are apparently no longer visible in today's most relevant channels of information consumption. But, the more freemium is provided, the lower the premium gets; a truly puzzling situation. To make it worse, channel providers increasingly regard information as a value adding and differentiating activity. Maybe new types of exclusive, strategic alliances will solve the puzzle, introducing new types of 'gate-keepers', which - to me - somehow does not match the spirit of the WWW and the generation Y's perception of information consumption and exchange.

    Read the article

  • Poll on Entity Framework 4 &ndash; one year on

    - by Eric Nelson
    12 months back (today is March 15th 2010) on the 16th of  March 2009 I created a poll on Entity Framework v1 – the marmite of ORMs? A quick poll…. Entity Framework v1 was getting a mixed reception at the time – I met developers who genuinely hated it and I met developers who were loving the productivity improvements they were seeing. There were definitely issues with v1, too many IMHO. Which is why the product team placed a huge effort on listening to the community to drive the feature set for v2 (which ultimately was named Entity Framework 4 as it ships with .NET 4). I think overall the team have done a great job. It isn’t perfect in .NET 4 (which is why the team are busy on post .NET 4 improvements) but I would happily use it and recommend it for a wide variety of projects – much wider than I would have with v1. I am speaking on EF 4 at www.devweek.com this Wednesday and I thought it would be fun to put a new version of the poll out and see how v4 is being received. Obviously the big difference is we have not yet shipped EF4 vs when I did the original poll on EF1. March 2010 poll – please vote Summary of March 2009 poll – it was a tie between positive and negative Total votes 150 Positive about EF v1 42 (15 + 19 + 8) Negative about EF v1  43 (34 + 9)

    Read the article

  • All email directed to 3rd party vendor except for one specific domain. How?

    - by jherlitz
    So we setup a site to site vpn tunnel with another company. We then proceeded to setup a DNS zone on each others dns servers and entered in each others Mail server name and IP, MX record and WWW record. This allowed us to send emails to each others mail servers through the site to site vpn. Now recently the other company started using MX Logic to scan all outbound and incoming mail. So all outbound email is directed to MX Logic. However we still want email between us to travel across the the Site to Site VPN tunnel. How can we specify that to happen for just one domain not to be directed to MX Logic? Stump on both ends and looking for help.

    Read the article

  • Resources started with slash .htaccess redirection

    - by Pawka
    I have moved old version of webpage to some subdirectory: http://www.smth.com/old/. But all resources (images, css, etc.) in HTML are linked with slash symbol at the start. So browser still tries to load them from root path. For example old/test.html contains: <img src="/images/lma_logo.ico" /> <!-- not working !--> <img src="images/lma_logo.ico" /> <!-- working !--> How can I rewrite ulrs to load resources from the "old" dir if urls still starts with "/"?

    Read the article

  • Open mail-links with gmail in Chrome 9

    - by moose
    it happens quite often, that I click a link over a persons name, just to see that it launches the default mail client of my system. I thought it would be a normal link, but it was a "mailto:"-link. I would like Chrome to start gmail, not my default email client. For Firefox, I had only to paste this in the URL-Bar: javascript:window.navigator.registerProtocolHandler("mailto","https://mail.google.com/mail/?extsrc=mailto&url=%s","GMail") Unfortunately, it doesn't work in Chrome 9. I have found this tutorial for Ubuntu, but I would like a solution in Chome. If it is only in Chrome, I can sync the settings. (So How do I make mailto: links open gmail in Ubuntu? doesn't fit) http://www.google.com/support/forum/p/Chrome/thread?tid=2aad08042607a4eb&hl=en could be related to my problem, but there is no answer. Gnome: $ gnome-default-applications-properties set Email-Client to gnome-open https://mail.google.com/mail/?extsrc=mailto&url=%s

    Read the article

  • Apress Deal of the Day - 17/March/2011

    - by TATWORTH
    v\:* {behavior:url(#default#VML);} o\:* {behavior:url(#default#VML);} w\:* {behavior:url(#default#VML);} .shape {behavior:url(#default#VML);} Normal 0 false false false false EN-GB X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} Today’s $10 Deal of the day at http://www.apress.com/info/dailydeal  is  Beginning SQL Server Modeling: Model-Driven Application Development in SQL Server 2008 Get ready for model-driven application development with SQL Server Modeling! This book covers Microsoft's SQL Server Modeling (formerly known under the code name "Oslo") in detail and contains the information you need to be successful with designing and implementing workflow modeling.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Apache: Serve http traffic over https

    - by Gatsys
    Using apache. I have a demo of a webapp that usually uses https. However, for the demo, I want all traffic to be on http even if a user hits https. I have added the following entry and it works if you go to http:// AAAA.com:443, but doesn't work if you go to https:// AAAA.com. It gives you this error: SSL received a record that exceeded the maximum permissible length. (Error code: ssl_error_rx_record_too_long) Here is my current setup: <VirtualHost 111.111.111.1:443> ServerName test.AAAA.com DocumentRoot /var/www/AAAA.com </VirtualHost> How do you redirect the https-http without encountering the SSL error. In other words, turn off ssl for https://

    Read the article

  • stop apache from asking for SSL password each restart

    - by acidzombie24
    Using instructions from this site but varying them just a little i created a CA using -newca, i copied cacert.pem to my comp and imported as trusted issuer in IE. I then did -newreq and -sign (note: i do /full/path/CA.sh -cmd and not sh CA.sh -cmd) and moved the cert and key to apache. I visited the site in IE and using .NET code and it appears trusted, great (unless i write www. in front which is expected). But every time i restart apache i need to type in my password for the site(s?). How can i make it so i DO NOT need to type in the password?

    Read the article

  • which user is the website host

    - by Kossel
    I m learning about server, and I'm configuring nginx mysql php wordpress. the server distro is debian 6. I created a new user and I wish each user is the owner of the site folder /var/www/site.one so I chown -R kossel:kossel site.one my problem is, my wordpress only work if I chmod 644 wp-config.php, which all can read wordpress site suggest that file should be 640. and my question is: when someone open mydomain.com, wordpress has to access wp-config.php file, but which user is it actually using to "read" that file? root? user kossel? anyone else? how can I properly give it permission or owner??

    Read the article

  • Is possible to arbitrarily register names to the same public IP?

    - by Alex. S.
    I registered a domain, lets say mysite.com (for example), then, results that somebody else has an A record from anotheraddress.com pointing to the same IP address of mine (in a VPS in linode.com) What can I do to avoid this???, I mean, I would prefer reject accesses from anotheraddress.com to my site. I just know only by casualty putting my genuine domain name on this http://www.domaintools.com/reverse-ip/ My DNS server is name.com, and the DNS server pointing to the my public IP is from GoDaddy. Is possible to register arbitrarily names to the same public IP? Can I use my DNS record with mysite.com to point to 209.85.133.147 (google.com), for example?

    Read the article

  • Can we use both Google Analytics (Asynchronous) and Google Analytics with Display Advertising code in same page

    - by Gadde
    I have Google Analytics (Asynchronous) script <script type=”text/javascript”> _gaq.push(['_setAccount', 'UA-XXXXX-X']); _gaq.push(['_trackPageview']); (function() { var ga = document.createElement('script'); ga.type = 'text/javascript'; ga.async = true; ga.src = ('https:' == document.location.protocol ? 'https://ssl' : 'http://www') + '.google-analytics.com/ga.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(ga, s); })(); </script> and Google Analytics with Display Advertising Script <script type="text/javascript"> var _gaq = _gaq || []; _gaq.push(['_setAccount', 'UA-XXXXX-X-yz']); _gaq.push(['_trackPageview']); (function() { var ga = document.createElement('script'); ga.type = 'text/javascript'; ga.async = true; ga.src = ('https:' == document.location.protocol ? 'https://' : 'http://') + 'stats.g.doubleclick.net/dc.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(ga, s); })(); </script> The UA - codes are different can i use both the codes ? I've read some where that Universal Analytics will not interfere with previous versions of Google Analytics. If i have upgraded to Universal Analytics, If the UA - codes are different should i use only the Universal Analytics script or should i use both Universal Analytics script and Universal Analytics script. please advise.....

    Read the article

  • Load balanced proxies to avoid an API request limit

    - by ClickClickClick
    There is a certain API out there which limits the number of requests per day per IP. My plan is to create a bunch of EC2 instances with elastic IPs to sidestep the limitation. I'm familiar with EC2 and am just interested in the configuration of the proxies and a software load balancer. I think I want to run a simple TCP Proxy on each instance and a software load balancer on the machine I will be requesting from. Something that allows the following to return a response from a different IP (round robin, availability, doesn't really matter..) eg. curl http://www.bbc.co.uk -x http://myproxyloadbalancer:port Could anyone recommend a combination of software or even a link to an article that details a pleasing way to pull it off? (My client won't be curl but is proxy aware.. I'll be making the requests from a Ruby script..)

    Read the article

  • Accessing SVN Repository on external drive

    - by Stephen
    I've installed SVN on my Raspberry PI and configured it to access the repository on an external hard drive. In /etc/fstab, I've have the following: //192.168.1.12/SHARE/repos /media/repos cifs sec=ntlm,username=Guest,password=,_netdev,dir_mode=0777,file_mode=0777 0 0 This mounts with no issues. When I go to add a project to the repository using the following command: sudo svn import mywebsite/ file://media/repos/mainrepository/mywebsite/ -m "Initial Upload" I get the following error: svn: E170000: Unable to connect to a repository at URL 'file://media/repos/mainrepository/mywebsite' svn: E170000: Unable to open an ra_local session to URL svn: E170000: Local URL 'file://media/repos/mainrepository/mywebsite' contains unsupported hostname The only thing I think maybe causing the issue is the file settings: drwxrwxrwx 2 root root 0 Jun 11 2009 repos As you can see the owner is root, I think it needs to be www-data, but for some reason I can't change it. Any help appreciated.

    Read the article

  • iTunes is not updating my podcast [closed]

    - by user22589
    I update my Podcast every week. But iTunes is not updating my last episode for more than a week. Strangely, those who subscribe my podcast can see the updated episode. But if you're not a subscriber, you can't see the last episode. It's here: http://www.aladinusa.com/podcast/rss.xml I checked it with the W3C validator and it says it's valid (with minor suggestion). Do you have any idea why it's not updated on iTunes? Thanks. Sam Kong

    Read the article

  • iptables redirect single website traffic to port 8080

    - by Luke John Southard
    My goal is to be able to make a connection to one, and only one, website through a proxy. Everything else should be dropped. I have been able to do this successfully without a proxy with this code: ./iptables -I INPUT 1 -i lo -j ACCEPT ./iptabels -A OUTPUT -p udp --dport 53 -j ACCEPT ./iptables -A OUTPUT -p tcp -d www.website.com --dport 80 -j ACCEPT ./iptables -A INPUT -m conntrack --cstate ESTABLISHED,RELATED -j ACCEPT ./iptables -P INPUT DROP ./iptables -P OUTPUT DROP How could I do the same thing except redirect the traffic to port 8080 somewhere? I've been trying to redirect in the PREROUTING chain in the nat table. I'm unsure if this is the proper place to do that tho. Thanks for your help!

    Read the article

  • HTTP Subdomain Redirect to HTTPS automatically. Why?

    - by user139062
    I have 2 websites deployed in IIS 7.5 Express. The first website is the PRODUCTION website and the second is the TEST website. In the PRODUCTION website, I added an HTTPS binding and Require SSL so it is normal that it will force to redirect from HTTP to HTTPS. In the TEST website, I didn't add HTTPS binding and the Require SSL is disabled but I wonder why it still force to redirect from HTTP to HTTPS. Any idea why this happen? By the way, the PRODUCTION site uses the main domain (www.maindomain.com) and the TEST site uses only sub-domain (test.maindomain.com). I don't want the sub-domain to only use HTTP, not HTTPS. Thank you in advance.

    Read the article

< Previous Page | 536 537 538 539 540 541 542 543 544 545 546 547  | Next Page >