Search Results

Search found 15004 results on 601 pages for 'date parsing'.

Page 564/601 | < Previous Page | 560 561 562 563 564 565 566 567 568 569 570 571  | Next Page >

  • .NET: Avoidance of custom exceptions by utilising existing types, but which?

    - by Mr. Disappointment
    Consider the following code (ASP.NET/C#): private void Application_Start(object sender, EventArgs e) { if (!SetupHelper.SetUp()) { throw new ShitHitFanException(); } } I've never been too hesitant to simply roll my own exception type, basically because I have found (bad practice, or not) that mostly a reasonable descriptive type name gives us enough as developers to go by in order to know what happened and why something might have happened. Sometimes the existing .NET exception types even accommodate these needs - regardless of the message. In this particular scenario, for demonstration purposes only, the application should die a horrible, disgraceful death should SetUp not complete properly (as dictated by its return value), but I can't find an already existing exception type in .NET which would seem to suffice; though, I'm sure one will be there and I simply don't know about it. Brad Abrams posted this article that lists some of the available exception types. I say some because the article is from 2005, and, although I try to keep up to date, it's a more than plausible assumption that more have been added to future framework versions that I am still unaware of. Of course, Visual Studio gives you a nicely formatted, scrollable list of exceptions via Intellisense - but even on analysing those, I find none which would seem to suffice for this situation... ApplicationException: ...when a non-fatal application error occurs The name seems reasonable, but the error is very definitely fatal - the app is dead. ExecutionEngineException: ...when there is an internal error in the execution engine of the CLR Again, sounds reasonable, superficially; but this has a very definite purpose and to help me out here certainly isn't it. HttpApplicationException: ...when there is an error processing an HTTP request Well, we're running an ASP.NET application! But we're also just pulling at straws here. InvalidOperationException: ...when a call is invalid for the current state of an instance This isn't right but I'm adding it to the list of 'possible should you put a gun to my head, yes'. OperationCanceledException: ...upon cancellation of an operation the thread was executing Maybe I wouldn't feel so bad using this one, but I'd still be hijacking the damn thing with little right. You might even ask why on earth I would want to raise an exception here but the idea is to find out that if I were to do so then do you know of an appropriate exception for such a scenario? And basically, to what extent can we piggy-back on .NET while keeping in line with rationality?

    Read the article

  • HttpSendRequest not getting latest file from server

    - by Doug Kavendek
    I am having an issue with my HTTP requests in my app, such that if the remote file is the same size as the local file (even though its modified time is different, as its contents have been changed), attempts to download it return quickly and the newer file is not downloaded. In short, the process I am following is: Setting up an HTTP connection with the INTERNET_FLAG_RESYNCHRONIZE flag and calling HttpSendRequest(); then checking the HTTP status code and finding it to be "200". If the remote file is updated, but remains the same size as the local copy: The local file is unchanged after running the app. If I call HttpQueryInfo() with HTTP_QUERY_LAST_MODIFIED after sending the request, it gives me the actual last modified time of the server's file, which I can see is different from the local file I am trying to have it overwrite. If the remote file is updated, and the file size becomes different from the local copy: It is downloaded and overwrites the local copy as expected. Here's a fairly abridged version of the code, to cut out helpers and error checking: // szAppName = our app name HINTERNET hInternetHandle = InternetOpen( szAppName, INTERNET_OPEN_TYPE_PRECONFIG, NULL, NULL, 0 ); // szServerName = our server name hInternetHandle = InternetConnect( hInternetHandle, szServerName, INTERNET_DEFAULT_HTTP_PORT, NULL, NULL, INTERNET_SERVICE_HTTP, NULL, 0 ); // szPath = the file to download LPCSTR aszDefault[2] = { "*/*", NULL }; DWORD dwFlags = 0 | INTERNET_FLAG_IGNORE_REDIRECT_TO_HTTP | INTERNET_FLAG_IGNORE_REDIRECT_TO_HTTPS | INTERNET_FLAG_KEEP_CONNECTION | INTERNET_FLAG_NO_AUTH | INTERNET_FLAG_NO_AUTO_REDIRECT | INTERNET_FLAG_NO_COOKIES | INTERNET_FLAG_NO_UI | INTERNET_FLAG_RESYNCHRONIZE; HINTERNET hHandle = HttpOpenRequest( hInternetHandle, "GET", szPath, NULL, NULL, aszDefault, dwFlags, 0 ); DWORD dwTimeOut = 10 * 1000; // In milliseconds InternetSetOption( hInternetHandle, INTERNET_OPTION_CONNECT_TIMEOUT, &dwTimeOut, sizeof( dwTimeOut ) ); InternetSetOption( hInternetHandle, INTERNET_OPTION_RECEIVE_TIMEOUT, &dwTimeOut, sizeof( dwTimeOut ) ); InternetSetOption( hInternetHandle, INTERNET_OPTION_SEND_TIMEOUT, &dwTimeOut, sizeof( dwTimeOut ) ); DWORD dwRetries = 5; InternetSetOption( hInternetHandle, INTERNET_OPTION_CONNECT_RETRIES, &dwRetries, sizeof( dwRetries ) ); HttpSendRequest( hInternetHandle, NULL, 0, NULL, 0 ); Since I have found I can query the remote file's last modified time, and find it to be accurate, I know it's actually getting to the server. I thought that specifying INTERNET_FLAG_RESYNCHRONIZE would force the file to resynch if it's out of date. Do I have it all wrong? Is this just how it's supposed to work?

    Read the article

  • Advice on software / database design to avoid using cursors when updating database

    - by Remnant
    I have a database that logs when an employee has attended a course and when they are next due to attend the course (courses tend to be annual). As an example, the following employee attended course '1' on 1st Jan 2010 and, as the course is annual, is due to attend next on the 1st Jan 2011. As today is 20th May 2010 the course status reads as 'Complete' i.e. they have done the course and do not need to do it again until next year: EmployeeID CourseID AttendanceDate DueDate Status 123456 1 01/01/2010 01/01/2011 Complete In terms of the DueDate I calculate this in SQL when I update the employee's record e.g. DueDate = AttendanceDate + CourseFrequency (I pull course frequency this from a separate table). In my web based app (asp.net mvc) I pull back this data for all employees and display it in a grid like format for HR managers to review. This allows HR to work out who needs to go on courses. The issue I have is as follows. Taking the example above, suppose today is 2nd Jan 2011. In this case, employee 123456 is now overdue for the course and I would like to set the Status to Incomplete so that the HR manager can see that they need to action this i.e. get employee on the course. I could build a trigger in the database to run overnight to update the Status field for all employees based on the current date. From what I have read I would need to use cursors to loop over each row to amend the status and this is considered bad practice / inefficient or at least something to avoid if you can??? Alternatively, I could compute the Status in my C# code after I have pulled back the data from the database and before I display it on screen. The issue with this is that the Status in the database would not necessarily match what is shown on screen which just feels plain wrong to me. Does anybody have any advice on the best practice approach to such an issue? It helps, if I did use a cursor I doubt I would be looping over more than 1000 records at any given time. Maybe this is such small volume that using cursors is okay?

    Read the article

  • merge cells in one

    - by alkitbi
    $query1 = "select * from linkat_link where emailuser='$email2' or linkname='$domain_name2' ORDER BY date desc LIMIT $From,$PageNO"; now sample show : <table border="1" width="100%"> <tr> <td>linkid</td> <td>catid</td> <td>linkdes</td> <td>price</td> </tr> <tr> <td>1</td> <td>1</td> <td>&nbsp;domain name</td> <td>100</td> </tr> <tr> <td>2</td> <td>1</td> <td>&nbsp;hosting&nbsp; plan one</td> <td>40</td> </tr> <tr> <td>3</td> <td>2</td> <td>&nbsp;domain name</td> <td>20</td> </tr> </table> How do I merge two or more  When there are numbers of cells same on the Table in this way sample? <table border="1" width="100%"> <tr> <td>catid</td> <td>linkdes</td> <td>price</td> </tr> <tr> <td>1</td> <td>linkid(1)- domain namelinkid(2)- hosting&nbsp; plan one</td> <td>10040</td> </tr> <tr> <td>2</td> <td>&nbsp;domain name</td> <td>20</td> </tr> </table>

    Read the article

  • Advantage of creating a generic repository vs. specific repository for each object?

    - by LuckyLindy
    We are developing an ASP.NET MVC application, and are now building the repository/service classes. I'm wondering if there are any major advantages to creating a generic IRepository interface that all repositories implement, vs. each Repository having its own unique interface and set of methods. For example: a generic IRepository interface might look like (taken from this answer): public interface IRepository : IDisposable { T[] GetAll<T>(); T[] GetAll<T>(Expression<Func<T, bool>> filter); T GetSingle<T>(Expression<Func<T, bool>> filter); T GetSingle<T>(Expression<Func<T, bool>> filter, List<Expression<Func<T, object>>> subSelectors); void Delete<T>(T entity); void Add<T>(T entity); int SaveChanges(); DbTransaction BeginTransaction(); } Each Repository would implement this interface (e.g. CustomerRepository:IRepository, ProductRepository:IRepository, etc). The alternate that we've followed in prior projects would be: public interface IInvoiceRepository : IDisposable { EntityCollection<InvoiceEntity> GetAllInvoices(int accountId); EntityCollection<InvoiceEntity> GetAllInvoices(DateTime theDate); InvoiceEntity GetSingleInvoice(int id, bool doFetchRelated); InvoiceEntity GetSingleInvoice(DateTime invoiceDate, int accountId); //unique InvoiceEntity CreateInvoice(); InvoiceLineEntity CreateInvoiceLine(); void SaveChanges(InvoiceEntity); //handles inserts or updates void DeleteInvoice(InvoiceEntity); void DeleteInvoiceLine(InvoiceLineEntity); } In the second case, the expressions (LINQ or otherwise) would be entirely contained in the Repository implementation, whoever is implementing the service just needs to know which repository function to call. I guess I don't see the advantage of writing all the expression syntax in the service class and passing to the repository. Wouldn't this mean easy-to-messup LINQ code is being duplicated in many cases? For example, in our old invoicing system, we call InvoiceRepository.GetSingleInvoice(DateTime invoiceDate, int accountId) from a few different services (Customer, Invoice, Account, etc). That seems much cleaner than writing the following in multiple places: rep.GetSingle(x => x.AccountId = someId && x.InvoiceDate = someDate.Date); The only disadvantage I see to using the specific approach is that we could end up with many permutations of Get* functions, but this still seems preferable to pushing the expression logic up into the Service classes. What am I missing?

    Read the article

  • How do I add a column that displays the number of distinct rows to this query?

    - by Fake Code Monkey Rashid
    Hello good people! I don't know how to ask my question clearly so I'll just show you the money. To start with, here's a sample table: CREATE TABLE sandbox ( id integer NOT NULL, callsign text NOT NULL, this text NOT NULL, that text NOT NULL, "timestamp" timestamp with time zone DEFAULT now() NOT NULL ); CREATE SEQUENCE sandbox_id_seq START WITH 1 INCREMENT BY 1 NO MINVALUE NO MAXVALUE CACHE 1; ALTER SEQUENCE sandbox_id_seq OWNED BY sandbox.id; SELECT pg_catalog.setval('sandbox_id_seq', 14, true); ALTER TABLE sandbox ALTER COLUMN id SET DEFAULT nextval('sandbox_id_seq'::regclass); INSERT INTO sandbox VALUES (1, 'alpha', 'foo', 'qux', '2010-12-29 16:51:09.897579+00'); INSERT INTO sandbox VALUES (2, 'alpha', 'foo', 'qux', '2010-12-29 16:51:36.108867+00'); INSERT INTO sandbox VALUES (3, 'bravo', 'bar', 'quxx', '2010-12-29 16:52:36.370507+00'); INSERT INTO sandbox VALUES (4, 'bravo', 'foo', 'quxx', '2010-12-29 16:52:47.584663+00'); INSERT INTO sandbox VALUES (5, 'charlie', 'foo', 'corge', '2010-12-29 16:53:00.742356+00'); INSERT INTO sandbox VALUES (6, 'delta', 'foo', 'qux', '2010-12-29 16:53:10.884721+00'); INSERT INTO sandbox VALUES (7, 'alpha', 'foo', 'corge', '2010-12-29 16:53:21.242904+00'); INSERT INTO sandbox VALUES (8, 'alpha', 'bar', 'corge', '2010-12-29 16:54:33.318907+00'); INSERT INTO sandbox VALUES (9, 'alpha', 'baz', 'quxx', '2010-12-29 16:54:38.727095+00'); INSERT INTO sandbox VALUES (10, 'alpha', 'bar', 'qux', '2010-12-29 16:54:46.237294+00'); INSERT INTO sandbox VALUES (11, 'alpha', 'baz', 'qux', '2010-12-29 16:54:53.891606+00'); INSERT INTO sandbox VALUES (12, 'alpha', 'baz', 'corge', '2010-12-29 16:55:39.596076+00'); INSERT INTO sandbox VALUES (13, 'alpha', 'baz', 'corge', '2010-12-29 16:55:44.834019+00'); INSERT INTO sandbox VALUES (14, 'alpha', 'foo', 'qux', '2010-12-29 16:55:52.848792+00'); ALTER TABLE ONLY sandbox ADD CONSTRAINT sandbox_pkey PRIMARY KEY (id); Here's the current SQL query I have: SELECT * FROM ( SELECT DISTINCT ON (this, that) id, this, that, timestamp FROM sandbox WHERE callsign = 'alpha' AND CAST(timestamp AS date) = '2010-12-29' ) playground ORDER BY timestamp DESC This is the result it gives me: id this that timestamp ----------------------------------------------------- 14 foo qux 2010-12-29 16:55:52.848792+00 13 baz corge 2010-12-29 16:55:44.834019+00 11 baz qux 2010-12-29 16:54:53.891606+00 10 bar qux 2010-12-29 16:54:46.237294+00 9 baz quxx 2010-12-29 16:54:38.727095+00 8 bar corge 2010-12-29 16:54:33.318907+00 7 foo corge 2010-12-29 16:53:21.242904+00 This is what I want to see: id this that timestamp count ------------------------------------------------------------- 14 foo qux 2010-12-29 16:55:52.848792+00 3 13 baz corge 2010-12-29 16:55:44.834019+00 2 11 baz qux 2010-12-29 16:54:53.891606+00 1 10 bar qux 2010-12-29 16:54:46.237294+00 1 9 baz quxx 2010-12-29 16:54:38.727095+00 1 8 bar corge 2010-12-29 16:54:33.318907+00 1 7 foo corge 2010-12-29 16:53:21.242904+00 1 EDIT: I'm using PostgreSQL 9.0.* (if that helps any).

    Read the article

  • Form value not passed to Seam bean after a4j reRender

    - by Casper
    I'm making a webapp in Seam but ran into a problem I can't seem to fix. I have a JSF form where the customer can select a reservation type through a combobox. Based on the selected value, other form components gets rendered. For example: the customer selects Hours as reservation type, a panelGroup gets rendered where the customer can select a start- and an end hour. But if the customer would select 'part of the day' as reservation type, a selectOneMenu gets rendered where the customer can select a part of the day (morning, afternoon, evening) The rerendering well but the values of the components with a rendered conditional won't get passed to the bean. They stay null values. This is the code i'm talking about: <h:panelGrid columns="2"> <h:outputText value="Reservation Type" /> <h:selectOneMenu value="#{selectedPeriodPart}"> <s:selectItems value="#{productManager.getAvailableDayPartsSpot()}" var="daypart" label="#{daypart.label}"></s:selectItems> <s:convertEnum /> <a4j:support ajaxSingle="true" event="onchange" action="#" reRender="spot"></a4j:support> </h:selectOneMenu> <h:outputText id="date_spot" value="Date" /> <a4j:outputPanel id="calendar_spot" layout="block"> <rich:calendar value="#{reservation.reservationPeriod.startDate}" locale="en" cellWidth="24px" cellHeight="22px" style="width:200px" /> </a4j:outputPanel> <h:outputText rendered="#{selectedPeriodPart eq 'DAY_PART'}" value="Daypart" /> <h:selectOneMenu value="#{selectedDaypart}" rendered="#{selectedPeriodPart eq 'DAY_PART'}"> <f:selectItem id="si_morning" itemLabel="Morning (6:00 - 12:00)" itemValue="morning" /> <f:selectItem id="si_afternoon" itemLabel="Afternoon (12:00 - 18:00)" itemValue="afternoon" /> <f:selectItem id="si_evening" itemLabel="Evening (18:00 - 00:00)" itemValue="evening" /> </h:selectOneMenu> <h:outputText rendered="#{selectedPeriodPart eq 'HOURS'}" value="Hours" /> <h:panelGroup id="hours_spot" rendered="#{selectedPeriodPart eq 'HOURS'}"> <ui:include src="/includes/reservation/select_hours.xhtml" /> </h:panelGroup> </h:panelGrid> </s:div></code> Note: The calendar value do get passed back to the bean but the value of this piece of code doesn't (it does if you remove the rendered conditional):

    Read the article

  • iPhone - database reading method and memory leaks

    - by Do8821
    Hi, in my application, a RSS reader, I get memory leaks that I can't fix because I can't understand from where they come from. Here is the code pointed out by Instruments. -(void) readArticlesFromDatabase { [self setDatabaseInfo]; sqlite3 *database; articles = [[NSMutableArray alloc] init]; if(sqlite3_open([databasePath UTF8String], &database) == SQLITE_OK) { const char *sqlStatement = "select * from articles"; if(sqlite3_prepare_v2(database, sqlStatement, -1, &compiledStatement, NULL) == SQLITE_OK) { while(sqlite3_step(compiledStatement) == SQLITE_ROW) { NSString *aName = [NSString stringWithUTF8String:(char *)sqlite3_column_text(compiledStatement, 1)]; NSString *aDate = [NSString stringWithUTF8String:(char *)sqlite3_column_text(compiledStatement, 2)]; NSString *aUrl = [NSString stringWithUTF8String:(char *)sqlite3_column_text(compiledStatement, 3)]; NSString *aCategory = [NSString stringWithUTF8String:(char *)sqlite3_column_text(compiledStatement, 4)]; NSString *aAuthor = [NSString stringWithUTF8String:(char *)sqlite3_column_text(compiledStatement, 5)]; NSString *aSummary = [NSString stringWithUTF8String:(char *)sqlite3_column_text(compiledStatement, 6)]; NSMutableString *aContent = [NSMutableString stringWithUTF8String:(char *)sqlite3_column_text(compiledStatement, 7)]; NSString *aNbrComments = [NSString stringWithUTF8String:(char *)sqlite3_column_text(compiledStatement, 8)]; NSString *aCommentsLink = [NSString stringWithUTF8String:(char *)sqlite3_column_text(compiledStatement, 9)]; NSString *aPermalink = [NSString stringWithUTF8String:(char *)sqlite3_column_text(compiledStatement, 11)]; [aContent replaceCharactersInRange: [aContent rangeOfString: @"http://www.mywebsite.com/img/action-on.gif"] withString: @"hellocoton-action-on.gif"]; [aContent replaceCharactersInRange: [aContent rangeOfString: @"hhttp://www.mywebsite.com/img/action-on-h.gif"] withString: @"hellocoton-action-on-h.gif"]; [aContent replaceCharactersInRange: [aContent rangeOfString: @"hthttp://www.mywebsite.com/img/hellocoton.gif"] withString: @"hellocoton-hellocoton.gif"]; NSString *imageURLBrut = [self parseArticleForImages:aContent]; NSString *imageURLCache = [imageURLBrut stringByReplacingOccurrencesOfString:@":" withString:@"_"]; imageURLCache = [imageURLCache stringByReplacingOccurrencesOfString:@"/" withString:@"_"]; imageURLCache = [imageURLCache stringByReplacingOccurrencesOfString:@" " withString:@"_"]; NSString *uniquePath = [tmp stringByAppendingPathComponent: imageURLCache]; if([[NSFileManager defaultManager] fileExistsAtPath: uniquePath]) { imageURLCache = [@"../tmp/" stringByAppendingString: imageURLCache]; [aContent replaceCharactersInRange: [aContent rangeOfString: imageURLBrut ] withString: imageURLCache]; } Article *article = [[Article alloc] initWithName:aName date:aDate url:aUrl category:aCategory author:aAuthor summary:aSummary content:aContent commentsNbr:aNbrComments commentsLink:aCommentsLink commentsRSS:@"" enclosure:aPermalink enclosure2:@"" enclosure3:@""]; [articles addObject:article]; article = nil; [article release]; } } sqlite3_finalize(compiledStatement); } sqlite3_close(database); } ` I have a lot of "Article" leaked and NSString matching with these using : [NSString stringWithUTF8String:(char *)sqlite3_column_text(compiledStatement, X)]; I tried a lot of different code I always have these leaks. Anyone has got an idea to help me?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Multiple Cookie Generation Issue

    - by Shannon
    Hi all, jQuery newbie here. I need to be able to set multiple cookies within the code without have to change out this variable each and every time. Is there any way to make this code generate unique cookies for different pages? As it is now, I'm having to rename that variable for each page that the jQuery animations exist on. (sbbcookiename) Background on the issue: We are having issues with the sliders not autoplaying once one has already been triggered, due to it the cookie having been cached. Thanks for your help. (function(){ jQuery.noConflict(); var _TIMEOUT= 1000, initTimer= 0, sbLoaded= false, _re= null ; initTimer= setTimeout(initSlider, _TIMEOUT); jQuery(document).ready(initSlider); function initSlider(){ if(sbLoaded) return; if (jQuery('#campaign_name').length > 0) { var sbbcookiename = jQuery('#campaign_name').attr('class'); } else { var sbbcookiename = "slider728x90"; } var slideTimeout //timer ,sbTrigger = jQuery('#slidebartrigger') //convenience ,sbFirstSlide = (document.cookie.indexOf(sbbcookiename) == -1) //check cookie for 'already seen today' ; clearTimeout(initTimer); sbLoaded= true; function toggleSlideboxes(){ if(slideTimeout) clearTimeout(slideTimeout); var isDown = sbTrigger.is('.closeSlide'); jQuery('#slidebar')['slide' + (isDown ? 'Up' : 'Down')]((isDown ? 1000 : 1000), function(){ if(sbFirstSlide){ //if 'first time today' then clear for click-to-replay sbTrigger.removeClass('firstSlide'); sbFirstSlide = false; } sbTrigger[(isDown ? 'remove' : 'add') + 'Class']('closeSlide').one('click', toggleSlideboxes); if(!isDown) slideTimeout = setTimeout(toggleSlideboxes, 4000); }); } if(sbFirstSlide){ //not seen yet today so set a cookie for expire tomorrow, then toggle the slide boxes... var oneDay = new Date(); oneDay.setUTCDate(oneDay.getUTCDate()+1); oneDay.setUTCHours(0, 0, 0, 0); //set to literally day-by-day, rather than 24 hours document.cookie=sbbcookiename+"=true;path=/;expires="+oneDay.toUTCString(); toggleSlideboxes(); }else{ //already seen today so show the trigger and set a click event on it... sbTrigger.removeClass('firstSlide').one('click', toggleSlideboxes); } } })();

    Read the article

  • Parallel.For maintain input list order on output list

    - by romeozor
    I'd like some input on keeping the order of a list during heavy-duty operations that I decided to try to do in a parallel manner to see if it boosts performance. (It did!) I came up with a solution, but since this was my first attempt at anything parallel, I'd need someone to slap my hands if I did something very stupid. There's a query that returns a list of card owners, sorted by name, then by date of birth. This needs to be rendered in a table on a web page (ASP.Net WebForms). The original coder decided he would construct the table cell-by-cell (TableCell), add them to rows (TableRow), then each row to the table. So no GridView, allegedly its performance is bad, but the performance was very poor regardless :). The database query returns in no time, the most time is spent on looping through the results and adding table cells etc. I made the following method to maintain the original order of the list: private TableRow[] ComposeRows(List<CardHolder> queryResult) { int queryElementsCount = queryResult.Count(); // array with the query's size var rowArray = new TableRow[queryElementsCount]; Parallel.For(0, queryElementsCount, i => { var row = new TableRow(); var cell = new TableCell(); // various operations, including simple ones such as: cell.Text = queryResult[i].Name; row.Cells.Add(cell); // here I'm adding the current item to it's original index // to maintain order in the output list rowArray[i] = row; }); return rowArray; } So as you can see, because I'm returning a very different type of data (List<CardHolder> -> TableRow[]), I can't just simply omit the ordering from the original query to do it after the operations. Also, I also thought it would be a good idea to Dispose() the objects at the end of each loop, because the query can return a huge list and letting cell and row objects pile up in the heap could impact performance.(?) How badly did I do? Does anyone have a better solution in case mine is flawed?

    Read the article

  • Can't insert a record in a oracle database using C#

    - by Gya
    try { int val4 = Convert.ToInt32(tbGrupa.Text); string MyConString = "Data Source=**;User ID=******;Password=*****"; OracleConnection conexiune = new OracleConnection(MyConString); OracleCommand comanda = new OracleCommand(); comanda.Connection = conexiune; conexiune.Open(); comanda.Transaction = conexiune.BeginTransaction(); int id_stud = Convert.ToInt16(tbCodStud.Text); string nume = tbNume.Text; string prenume = tbPrenume.Text; string initiala_tatalui = tbInitiala.Text; string email = tbEmail.Text; string facultate = tbFac.Text; int grupa = Convert.ToInt16(tbGrupa.Text); string serie = tbSeria.Text; string forma_de_inv = tbFormaInvatamant.Text; DateTime data_acceptare_coordonare = dateTimePicker1.Value; DateTime data_sustinere_licenta = dateTimePicker2.Value; string sustinere = tbSustinereLicenta.Text; string parola_acces = tbParola.Text; try { comanda.Parameters.AddWithValue("id_stud", id_stud); comanda.Parameters.AddWithValue("nume", nume); comanda.Parameters.AddWithValue("prenume", prenume); comanda.Parameters.AddWithValue("initiala_tatalui", initiala_tatalui); comanda.Parameters.AddWithValue("facultate", facultate); comanda.Parameters.AddWithValue("email", email); comanda.Parameters.AddWithValue("seria", serie); comanda.Parameters.AddWithValue("grupa", grupa); comanda.Parameters.AddWithValue("forma_de_inv", forma_de_inv); comanda.Parameters.AddWithValue("data_acceptare_coordonare", data_acceptare_coordonare); comanda.Parameters.AddWithValue("data_sustinere_licenta", data_sustinere_licenta); comanda.Parameters.AddWithValue("sustinere_licenta", sustinere); comanda.Parameters.AddWithValue("parola_acces", parola_acces); comanda.Transaction.Commit(); MessageBox.Show("Studentul " + tbNume.Text + " " + tbPrenume.Text + " a fost adaugat în baza de date!"); } catch (Exception er) { comanda.Transaction.Rollback(); MessageBox.Show("ER1.1:" + er.Message); MessageBox.Show("ER1.2:" + er.StackTrace); } finally { conexiune.Close(); } } catch (Exception ex) { MessageBox.Show("ER2.1:"+ex.Message); MessageBox.Show("ER2.2:"+ex.StackTrace); }

    Read the article

  • Problem with XML parser

    - by zp26
    Hi, I have a problem with parsing XML. I have created a program which write a file xml in the project directory. The file XML are correct. (i checked). When i try to read this XML the program crash and return 1 status. I have controlled my 2 path and they are equals. Can you help me please? Thanks so much. #import "PositionIdentifierViewController.h" #import "WriterXML.h" @implementation PositionIdentifierViewController - (void)parser:(NSXMLParser *)parser foundCharacters:(NSString *)string { NSString *stringa = [NSString stringWithFormat:@"%@",string]; textArea.text = [textArea.text stringByAppendingString:@"\n"]; textArea.text = [textArea.text stringByAppendingString:stringa]; } -(IBAction)startParsing { NSURL *xmlURL = [NSURL fileURLWithPath:path]; NSXMLParser *parser = [[NSXMLParser alloc] initWithContentsOfURL:xmlURL]; [parser setDelegate:self]; BOOL success = [parser parse]; if(success == YES){ // } [parser release]; } // Implement viewDidLoad to do additional setup after loading the view, typically from a nib. - (void)viewDidLoad { [super viewDidLoad]; NSArray *tempPaths = NSSearchPathForDirectoriesInDomains(NSDocumentDirectory, NSUserDomainMask, YES); NSString *documentsDirectoryPath = [tempPaths objectAtIndex:0]; path = [documentsDirectoryPath stringByAppendingPathComponent:@"filePosizioni.xml"]; WriterXML *newWriter; newWriter = [[WriterXML alloc]init]; [newWriter saveXML:(NSString*)@"ciao":(float)10:(float)40:(float)70]; [newWriter saveXML:(NSString*)@"pippo":(float)20:(float)50:(float)80]; [newWriter saveXML:(NSString*)@"pluto":(float)30:(float)60:(float)90]; NSLog(path); } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } - (void)dealloc { [super dealloc]; } @end #import "WriterXML.h" @implementation WriterXML -(void)saveXML:(NSString*)name:(float)x:(float)y:(float)z{ NSArray *paths = NSSearchPathForDirectoriesInDomains(NSDocumentDirectory, NSUserDomainMask, YES); NSString *documentsDirectoryPath = [paths objectAtIndex:0]; NSString *filePath = [documentsDirectoryPath stringByAppendingPathComponent:@"filePosizioni.xml"]; NSFileHandle *myHandle; NSFileManager *fileManager = [NSFileManager defaultManager]; NSString *titoloXML = [NSString stringWithFormat:@"<?xml version=1.0 encoding=UTF-8 ?>"]; NSString *inizioTag = [NSString stringWithFormat:@"\n\n\n<position>"]; NSString *tagName = [NSString stringWithFormat:@"\n <name>%@</name>", name]; NSString *tagX = [NSString stringWithFormat:@"\n <x>%f</x>", x]; NSString *tagY = [NSString stringWithFormat:@"\n <y>%f</y>", y]; NSString *tagZ = [NSString stringWithFormat:@"\n <z>%f</z>", z]; NSString *fineTag= [NSString stringWithFormat:@"\n</position>"]; NSData* dataTitoloXML = [titoloXML dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataInizioTag = [inizioTag dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataName = [tagName dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataX = [tagX dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataY = [tagY dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataZ = [tagZ dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataFineTag = [fineTag dataUsingEncoding: NSASCIIStringEncoding]; if(![fileManager fileExistsAtPath:filePath]) [fileManager createFileAtPath:filePath contents:dataTitoloXML attributes:nil]; myHandle = [NSFileHandle fileHandleForUpdatingAtPath:filePath]; [myHandle seekToEndOfFile]; [myHandle writeData:dataInizioTag]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataName]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataX]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataY]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataZ]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataFineTag]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; NSLog(@"zp26 %@",filePath); } @end

    Read the article

  • How to view ASMX SOAP using Fiddler2?

    - by outer join
    Does anyone know if Fiddler can display the raw SOAP messages for ASMX web services? I'm testing a simple web service using both Fiddler2 and Storm and the results vary (Fiddler shows plain xml while Storm shows the SOAP messages). See sample request/responses below: Fiddler2 Request: POST /webservice1.asmx/Test HTTP/1.1 Accept: */* Referer: http://localhost.:4164/webservice1.asmx?op=Test Accept-Language: en-us User-Agent: Mozilla/4.0 (compatible; MSIE 8.0; Windows NT 5.1; Trident/4.0; .NET CLR 1.1.4322; .NET CLR 2.0.50727; .NET CLR 3.0.04506.30; .NET CLR 3.0.04506.648; .NET CLR 3.5.21022; .NET CLR 3.0.4506.2152; .NET CLR 3.5.30729; InfoPath.2; MS-RTC LM 8) Content-Type: application/x-www-form-urlencoded Accept-Encoding: gzip, deflate Host: localhost.:4164 Content-Length: 0 Connection: Keep-Alive Pragma: no-cache Fiddler2 Response: HTTP/1.1 200 OK Server: ASP.NET Development Server/9.0.0.0 Date: Thu, 21 Jan 2010 14:21:50 GMT X-AspNet-Version: 2.0.50727 Cache-Control: private, max-age=0 Content-Type: text/xml; charset=utf-8 Content-Length: 96 Connection: Close <?xml version="1.0" encoding="utf-8"?> <string xmlns="http://tempuri.org/">Hello World</string> Storm Request (body only): <?xml version="1.0" encoding="utf-8"?> <soap:Envelope xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:soap="http://schemas.xmlsoap.org/soap/envelope/"> <soap:Body> <Test xmlns="http://tempuri.org/" /> </soap:Body> </soap:Envelope> Storm Response: Status Code: 200 Content Length : 339 Content Type: text/xml; charset=utf-8 Server: ASP.NET Development Server/9.0.0.0 Status Description: OK <?xml version="1.0" encoding="utf-8"?> <soap:Envelope xmlns:soap="http://schemas.xmlsoap.org/soap/envelope/" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <soap:Body> <TestResponse xmlns="http://tempuri.org/"> <TestResult>Hello World</TestResult> </TestResponse> </soap:Body> </soap:Envelope> Thanks for any help.

    Read the article

  • FluentNHibernate Many-To-One References where Foreign Key is not to Primary Key and column names are

    - by Todd Langdon
    I've been sitting here for an hour trying to figure this out... I've got 2 tables (abbreviated): CREATE TABLE TRUST ( TRUSTID NUMBER NOT NULL, ACCTNBR VARCHAR(25) NOT NULL ) CONSTRAINT TRUST_PK PRIMARY KEY (TRUSTID) CREATE TABLE ACCOUNTHISTORY ( ID NUMBER NOT NULL, ACCOUNTNUMBER VARCHAR(25) NOT NULL, TRANSAMT NUMBER(38,2) NOT NULL POSTINGDATE DATE NOT NULL ) CONSTRAINT ACCOUNTHISTORY_PK PRIMARY KEY (ID) I have 2 classes that essentially mirror these: public class Trust { public virtual int Id {get; set;} public virtual string AccountNumber { get; set; } } public class AccountHistory { public virtual int Id { get; set; } public virtual Trust Trust {get; set;} public virtual DateTime PostingDate { get; set; } public virtual decimal IncomeAmount { get; set; } } How do I do the many-to-one mapping in FluentNHibernate to get the AccountHistory to have a Trust? Specifically, since it is related on a different column than the Trust primary key of TRUSTID and the column it is referencing is also named differently (ACCTNBR vs. ACCOUNTNUMBER)???? Here's what I have so far - how do I do the References on the AccountHistoryMap to Trust??? public class TrustMap : ClassMap<Trust> { public TrustMap() { Table("TRUST"); Id(x => x.Id).Column("TRUSTID"); Map(x => x.AccountNumber).Column("ACCTNBR"); } } public class AccountHistoryMap : ClassMap<AccountHistory> { public AccountHistoryMap() { Table("TRUSTACCTGHISTORY"); Id (x=>x.Id).Column("ID"); References<Trust>(x => x.Trust).Column("ACCOUNTNUMBER").ForeignKey("ACCTNBR").Fetch.Join(); Map(x => x.PostingDate).Column("POSTINGDATE"); ); I've tried a few different variations of the above line but can't get anything to work - it pulls back AccountHistory data and a proxy for the Trust; however it says no Trust row with given identifier. This has to be something simple. Anyone? Thanks in advance.

    Read the article

  • NHibernate GenericADO Exception

    - by Ris90
    Hi, I'm trying to make simple many-to-one association, using NHibernate.. I have class Recruit with this mapping: <class name="Recruit" table="Recruits"> <id name="ID"> <generator class="native"/> </id> <property name="Lastname" column="lastname"/> <property name="Name" column="name"/> <property name="MedicalReport" column="medicalReport"/> <property name="DateOfBirth" column ="dateOfBirth" type="Date"/> <many-to-one name="AssignedOnRecruitmentOffice" column="assignedOnRecruitmentOffice" class="RecruitmentOffice"/> which is many-to-one connected to RecruitmentOffices: <class name="RecruitmentOffice" table="RecruitmentOffices"> <id name="ID" column="ID"> <generator class="native"/> </id> <property name="Chief" column="chief"/> <property name="Name" column="name"/> <property name ="Address" column="address"/> <set name="Recruits" cascade="save-update" inverse="true" lazy="true"> <key> <column name="AssignedOnRecruitmentOffice"/> </key> <one-to-many class="Recruit"/> </set> And create Repository class with method Insert: public void Insert(Recruit recruit) { using (ITransaction transaction = session.BeginTransaction()) { session.Save(recruit); transaction.Commit(); } } then I try to save new recrui to base: Recruit test = new Recruit(); RecruitmentOffice office = new RecruitmentOffice(); ofice.Name = "test"; office.Chief = "test"; test.AssignedOnRecruitmentOffice = office; test.Name = "test"; test.DateOfBirth = DateTime.Now; RecruitRepository testing = new RecruitRepository(); testing.Insert(test); And have this error GenericADOException could not insert: [OSiUBD.Models.DAO.Recruit][SQL: INSERT INTO Recruits (lastname, name, medicalReport, dateOfBirth, assignedOnRecruitmentOffice) VALUES (?, ?, ?, ?, ?); select SCOPE_IDENTITY()] on session.Save

    Read the article

  • How can I refactor out needing so many for-loops in rails?

    - by Angela
    I need help refactoring this multi-loop thing. Here is what I have: Campaign has_many Contacts Campaign also has many templates for EVent (Email, Call, and Letter). I need a list of all the Emails, Calls and Letters that are "overdue" for every Contact that belongs to a Campaign. Overdue is determined by a from_today method which looks at the date the Contact was entered in the system and the number of days that needs to pass for any given Event. from_today() outputs the number of days from today that the Event should be done for a given Contact. Here is what I've done, it works for all Emails in a Campaign across all contacts. I was going to try to create another each do loop to change the class names. Wasn't sure where to begin: named_scope, push some things into a method, etcetera, or -- minimum to be able to dynamically change the class names so at least it loops three timees across the different events rather than repeating the code three times: <% @campaigns.each do |campaign| %> <h2><%= link_to campaign.name, campaign %></h2> <% @events.each do |event| %> <%= event %> <% for email in campaign.emails %> <h4><%= link_to email.title, email %> <%= email.days %> days</h4> <% for contact in campaign.contacts.find(:all, :order => "date_entered ASC" ) %> <% if (from_today(contact, email.days) < 0) %> <% if show_status(contact, email) == 'no status'%> <p> <%= full_name(contact) %> is <%= from_today(contact,email.days).abs%> days overdue: <%= do_event(contact, email) %> </p> <% end %> <% end %> <% end %> <% end %> <% end %> <% end %>

    Read the article

  • How can I remove rows with unique values? As in only keeping rows with duplicate values?

    - by user1456405
    Here's the conundrum, I'm a complete and utter noob when it comes to programming. I understand the basics, but am still learning javascript. I have a spreadsheet of surveys, in which I need to see how particular users have varied over time. As such, I need to disregard all rows with unique values in a particular column. The data looks like this: Response Date Response_ID Account_ID Q.1 10/20/2011 12:03:43 PM 23655956 1168161 8 10/20/2011 03:52:57 PM 23660161 1168152 0 10/21/2011 10:55:54 AM 23672903 1166121 7 10/23/2011 04:28:16 PM 23694471 1144756 9 10/25/2011 06:30:52 AM 23732674 1167449 7 10/25/2011 07:52:28 AM 23734597 1087618 5 I've found a way to do so in VBA, which sucks as I have to use excel, per below: Sub Del_Unique() Application.ScreenUpdating = False Columns("B:B").Insert Shift:=xlToRight Columns("A:A").Copy Destination:=Columns("B:B") i = Application.CountIf(Range("A:A"), "<>") + 50 If i > 65536 Then i = 65536 Do If Application.CountIf(Range("B:B"), Range("A" & i)) = 1 Then Rows(i).Delete End If i = i - 1 Loop Until i = 0 Columns("B:B").Delete Application.ScreenUpdating = True End Sub But that requires mucking about. I'd really like to do it in Google Spreadsheets with a script that won't have to be changed. Closest I can get is retrieving all duplicate user ids from the range, but can't associate that with the row. That code follows: function findDuplicatesInSelection() { var activeRange = SpreadsheetApp.getActiveRange(); var values = activeRange.getValues(); // values that appear at least once var once = {}; // values that appear at least twice var twice = {}; // values that appear at least twice, stored in a pretty fashion! var final = []; for (var i = 0; i < values.length; i++) { var inner = values[i]; for (var j = 0; j < inner.length; j++) { var cell = inner[j]; if (cell == "") continue; if (once.hasOwnProperty(cell)) { if (!twice.hasOwnProperty(cell)) { final.push(cell); } twice[cell] = 1; } else { once[cell] = 1; } } } if (final.length == 0) { Browser.msgBox("No duplicates found"); } else { Browser.msgBox("Duplicates are: " + final); } } Anyhow, sorry if this is the wrong place or format, but half of what I've found so far has been from stack, I thought it was a good place to start. Thanks!

    Read the article

  • Can't find method in the activity

    - by Synesso
    I'm starting with Scala + Android. I'm trying to wire a button action to a button without the activity implementing View.OnClickListener. The button click fails at runtime because the method cannot be found. The document I'm working through says that I need only declare a public void method taking a View on the action, and use that method name in the layout. What have I done wrong? MainActivity.scala package net.badgerhunt.hwa import android.app.Activity import android.os.Bundle import android.widget.Button import android.view.View import java.util.Date class MainActivity extends Activity { override def onCreate(savedInstanceState: Bundle) = { super.onCreate(savedInstanceState) setContentView(R.layout.main) } def calculate(button: View): Unit = println("calculating with %s ...".format(button)) } res/layout/main.xml <?xml version="1.0" encoding="utf-8"?> <Button xmlns:android="http://schemas.android.com/apk/res/android" android:id="@+id/button" android:text="" android:onClick="calculate" android:layout_width="fill_parent" android:layout_height="fill_parent"/> the failure onclick D/AndroidRuntime( 362): Shutting down VM W/dalvikvm( 362): threadid=3: thread exiting with uncaught exception (group=0x4001b188) E/AndroidRuntime( 362): Uncaught handler: thread main exiting due to uncaught exception E/AndroidRuntime( 362): java.lang.IllegalStateException: Could not find a method calculate(View) in the activity E/AndroidRuntime( 362): at android.view.View$1.onClick(View.java:2020) E/AndroidRuntime( 362): at android.view.View.performClick(View.java:2364) E/AndroidRuntime( 362): at android.view.View.onTouchEvent(View.java:4179) E/AndroidRuntime( 362): at android.widget.TextView.onTouchEvent(TextView.java:6540) E/AndroidRuntime( 362): at android.view.View.dispatchTouchEvent(View.java:3709) E/AndroidRuntime( 362): at android.view.ViewGroup.dispatchTouchEvent(ViewGroup.java:884) E/AndroidRuntime( 362): at android.view.ViewGroup.dispatchTouchEvent(ViewGroup.java:884) E/AndroidRuntime( 362): at android.view.ViewGroup.dispatchTouchEvent(ViewGroup.java:884) E/AndroidRuntime( 362): at com.android.internal.policy.impl.PhoneWindow$DecorView.superDispatchTouchEvent(PhoneWindow.java:1659) E/AndroidRuntime( 362): at com.android.internal.policy.impl.PhoneWindow.superDispatchTouchEvent(PhoneWindow.java:1107) E/AndroidRuntime( 362): at android.app.Activity.dispatchTouchEvent(Activity.java:2061) E/AndroidRuntime( 362): at com.android.internal.policy.impl.PhoneWindow$DecorView.dispatchTouchEvent(PhoneWindow.java:1643) E/AndroidRuntime( 362): at android.view.ViewRoot.handleMessage(ViewRoot.java:1691) E/AndroidRuntime( 362): at android.os.Handler.dispatchMessage(Handler.java:99) E/AndroidRuntime( 362): at android.os.Looper.loop(Looper.java:123) E/AndroidRuntime( 362): at android.app.ActivityThread.main(ActivityThread.java:4363) E/AndroidRuntime( 362): at java.lang.reflect.Method.invokeNative(Native Method) E/AndroidRuntime( 362): at java.lang.reflect.Method.invoke(Method.java:521) E/AndroidRuntime( 362): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) E/AndroidRuntime( 362): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) E/AndroidRuntime( 362): at dalvik.system.NativeStart.main(Native Method) E/AndroidRuntime( 362): Caused by: java.lang.NoSuchMethodException: calculate E/AndroidRuntime( 362): at java.lang.ClassCache.findMethodByName(ClassCache.java:308) E/AndroidRuntime( 362): at java.lang.Class.getMethod(Class.java:1014) E/AndroidRuntime( 362): at android.view.View$1.onClick(View.java:2017) E/AndroidRuntime( 362): ... 20 more

    Read the article

  • Various GPS Android Functionality Questions..

    - by Tyler
    Hello - I have a few questions (so far) with the the LocationManager on Android and GPS in general.. Feel free to answer any number of the questions below, and I appreciate your help in advance! (I noticed this stuff doesn't appear to be documented very well, so hopefully these questions will help others out too!) 1) I am using the following code, but I think there may be extra fluff in here that I do not need. Can you tell me if I can delete any of this? LocationManager lm = (LocationManager) getSystemService(Context.LOCATION_SERVICE); LocationListener locationListener = new MyLocationListener(); lm.requestLocationUpdates(LocationManager.GPS_PROVIDER, 0, 0, locationListener); LocationProvider locationProvider = lm.getProvider("gps"); Location currentLocation = lm.getLastKnownLocation(locationProvider.getName()); 2) Is there a way to hold off on the last step (accessing "getLastKnownLocation" until after I am sure I have a GPS lock? What happens if this is called and GPS is still looking for signal? 3) MOST importantly, I want to ensure I have a GPS lock before I proceed to my next method, so is there a way to check to see if GPS is locked on and getLastKnownLocation is up to date? 4) Is there a way to 'shut down' the GPS listener once it does receive a lock and getLastKnownLocation is updated? I don't see a need to keep this running for my application once I have obtained a lock.. 5) Can you please confirm my assumption that "getLastKnownLocation" is updated frequently as the receiver moves? 6) In my code, I also have a class called "MyLocationListener" (code below) that I honestly just took from another example.. Is this actually needed? I assume this updates my location manager whenever the location changes, but it sure doesn't appear that there is much to the class itself! private class MyLocationListener implements LocationListener { @Override public void onLocationChanged(Location loc) { if (loc != null) { //Toast.makeText(getBaseContext(), "Location changed : Lat: " + loc.getLatitude() + " Lng: " + loc.getLongitude(), Toast.LENGTH_SHORT).show(); } } @Override public void onProviderDisabled(String provider) { // TODO Auto-generated method stub } @Override public void onProviderEnabled(String provider) { // TODO Auto-generated method stub } @Override public void onStatusChanged(String provider, int status, Bundle extras) { // TODO Auto-generated method stub } }

    Read the article

  • How do I use QXmlQuery properly? (Qt XQuery/XPath)

    - by Steven Jackson
    I'm using the following code to load in an XML file (actually an NZB): QXmlQuery query; query.bindVariable("path", QVariant(path)); query.setQuery("doc($path)/nzb/file/segments/segment/string()"); if(!query.isValid()) throw QString("Invalid query."); QStringList segments; if(!query.evaluateTo(&segments)) throw QString("Unable to evaluate..."); QString string; foreach(string, segments) qDebug() << "String: " << string; With the following input, it works as expected: <?xml version="1.0" encoding="iso-8859-1" ?> <!DOCTYPE nzb PUBLIC "-//newzBin//DTD NZB 1.0//EN" "http://www.newzbin.com/DTD/nzb/nzb-1.0.dtd"> <nzb> <file> <groups> <group>alt.binaries.cd.image</group> </groups> <segments> <segment>[email protected]</segment> </segments> </file> </nzb> However, with the following input no results are returned. This is how the input should be formatted, with attributes: <?xml version="1.0" encoding="iso-8859-1" ?> <!DOCTYPE nzb PUBLIC "-//newzBin//DTD NZB 1.0//EN" "http://www.newzbin.com/DTD/nzb/nzb-1.0.dtd"> <nzb xmlns="http://www.newzbin.com/DTD/2003/nzb"> <file poster="[email protected]" date="1225385180" subject="ubuntu-8.10-desktop-i386 - ubuntu-8.10-desktop-i386.par2 (1/1)"> <groups> <group>alt.binaries.cd.image</group> </groups> <segments> <segment bytes="66196" number="1">[email protected]</segment> <segment bytes="661967" number="1">[email protected]</segment> </segments> </file> </nzb> Please can someone tell me what I'm doing wrong?

    Read the article

  • c#: Design advice. Using DataTable or List<MyObject> for a generic rule checker

    - by Andrew White
    Hi, I have about 100,000 lines of generic data. Columns/Properties of this data are user definable and are of the usual data types (string, int, double, date). There will be about 50 columns/properties. I have 2 needs: To be able to calculate new columns/properties using an expression e.g. Column3 = Column1 * Column2. Ultimately I would like to be able to use external data using a callback, e.g. Column3 = Column1 * GetTemperature The expression is relatively simple, maths operations, sum, count & IF are the only necessary functions. To be able to filter/group the data and perform aggregations e.g. Sum(Data.Column1) Where(Data.Column2 == "blah") As far as I can see I have two options: 1. Using a DataTable. = Point 1 above is achieved by using DataColumn.Expression = Point 2 above is acheived by using DataTable.DefaultView.RowFilter & C# code 2. Using a List of generic Objects each with a Dictionary< string, object to store the values. = Point 1 could be achieved by something like NCalc = Point 2 is achieved using LINQ DataTable: Pros: DataColumn.Expression is inbuilt Cons: RowFilter & coding c# is not as "nice" as LINQ, DataColumn.Expression does not support callbacks(?) = workaround could be to get & replace external value when creating the calculated column GenericList: Pros: LINQ syntax, NCalc supports callbacks Cons: Implementing NCalc/generic calc engine Based on the above I would think a GenericList approach would win, but something I have not factored in is the performance which for some reason I think would be better with a datatable. Does anyone have a gut feeling / experience with LINQ vs. DataTable performance? How about NCalc? As I said there are about 100,000 rows of data, with 50 columns, of which maybe 20 are calculated. In total about 50 rules will be run against the data, so in total there will be 5 million row/object scans. Would really appreciate any insights. Thx. ps. Of course using a database + SQL & Views etc. would be the easiest solution, but for various reasons can't be implemented.

    Read the article

  • Stored procedure error when use computed column for ID

    - by Hari
    I got the error: Procedure or function usp_User_Info3 has too many arguments specified When I run the program. I don't know the error in SP or in C# code. I have to display the Vendor_ID after the user clicks the submit button. Where the thing going wrong here ? Table structure : CREATE TABLE User_Info3 ( SNo int Identity (2000,1) , Vendor_ID AS 'VEN' + CAST(SNo as varchar(16)) PERSISTED PRIMARY KEY, UserName VARCHAR(16) NOT NULL, User_Password VARCHAR(12) NOT NULL, User_ConPassword VARCHAR(12) NOT NULL, User_FirstName VARCHAR(25) NOT NULL, User_LastName VARCHAR(25) SPARSE NULL, User_Title VARCHAR(35) NOT NULL, User_EMail VARCHAR(35) NOT NULL, User_PhoneNo VARCHAR(14) NOT NULL, User_MobileNo VARCHAR(14)NOT NULL, User_FaxNo VARCHAR(14)NOT NULL, UserReg_Date DATE DEFAULT GETDATE() ) Stored Procedure : ALTER PROCEDURE [dbo].[usp_User_Info3] @SNo INT OUTPUT, @Vendor_ID VARCHAR(10) OUTPUT, @UserName VARCHAR(30), @User_Password VARCHAR(12), @User_ConPassword VARCHAR(12), @User_FirstName VARCHAR(25), @User_LastName VARCHAR(25), @User_Title VARCHAR(35), @User_OtherEmail VARCHAR(30), @User_PhoneNo VARCHAR(14), @User_MobileNo VARCHAR(14), @User_FaxNo VARCHAR(14) AS BEGIN SET NOCOUNT ON; INSERT INTO User_Info3 (UserName,User_Password,User_ConPassword,User_FirstName, User_LastName,User_Title,User_OtherEmail,User_PhoneNo,User_MobileNo,User_FaxNo) VALUES (@UserName,@User_Password,@User_ConPassword,@User_FirstName,@User_LastName, @User_Title,@User_OtherEmail,@User_PhoneNo,@User_MobileNo,@User_FaxNo) SET @SNo = Scope_Identity() SELECT Vendor_ID From User_Info3 WHERE SNo = @SNo END C# Code : protected void BtnUserNext_Click(object sender, EventArgs e) { cmd.CommandType = CommandType.StoredProcedure; cmd.CommandText = "usp_User_Info3"; System.Data.SqlClient.SqlParameter SNo=cmd.Parameters.Add("@SNo",System.Data.SqlDbType.Int); System.Data.SqlClient.SqlParameter Vendor_ID=cmd.Parameters.Add("@Vendor_ID", System.Data.SqlDbType.VarChar,10); cmd.Parameters.Add("@UserName", SqlDbType.VarChar).Value = txtUserName.Text; cmd.Parameters.Add("@User_Password", SqlDbType.VarChar).Value = txtRegPassword.Text; cmd.Parameters.Add("@User_ConPassword", SqlDbType.VarChar).Value = txtRegConPassword.Text; cmd.Parameters.Add("@User_FirstName", SqlDbType.VarChar).Value = txtRegFName.Text; cmd.Parameters.Add("@User_LastName", SqlDbType.VarChar).Value = txtRegLName.Text; cmd.Parameters.Add("@User_Title", SqlDbType.VarChar).Value = txtRegTitle.Text; cmd.Parameters.Add("@User_OtherEmail", SqlDbType.VarChar).Value = txtOtherEmail.Text; cmd.Parameters.Add("@User_PhoneNo", SqlDbType.VarChar).Value =txtRegTelephone.Text; cmd.Parameters.Add("@User_MobileNo", SqlDbType.VarChar).Value =txtRegMobile.Text; cmd.Parameters.Add("@User_FaxNo", SqlDbType.VarChar).Value =txtRegFax.Text; cmd.Connection = SqlCon; try { Vendor_ID.Direction = System.Data.ParameterDirection.Output; SqlCon.Open(); cmd.ExecuteNonQuery(); string VendorID = cmd.ExecuteScalar() as string; } catch (Exception ex) { throw new Exception(ex.Message); } finally { string url = "../CompanyBasicInfo.aspx?Parameter=" + Server.UrlEncode(" + VendorID + "); SqlCon.Close(); } }

    Read the article

  • How can call a jQuery function when it is inside the formview (asp.net control)?

    - by ricky roy
    Hi, All I have a Span in side the Form view. I wanted to Call a Jquery Fucntion when the from load how can i do this? Thanks Waiting for your reply here is my code <asp:FormView ID="FormView1" runat="server" OnItemCommand="FormView1_ItemCommand"> <ItemTemplate> <asp:HiddenField ID="hidProductID" Value='<%#Eval("ProductID") %>' runat="server" /> <asp:HiddenField ID="hidCustomerID" Value='<%#Eval("CustomerID") %>' runat="server" /> <a href='<%=WinToSave.SettingsConstants.SiteURL%>WintoSave/AuctionProduct.aspx?id=<%#Eval("ProductID") %>'> <%#Eval("ProductName")%> </a> <br /> <img src='<%#Eval("ImagePath")%>' alt="Image No available" /> <br /> <asp:Label ID="lblTime" runat="server" Text='<%#Convert.ToDateTime(Eval("ModifiedOn")).ToString("hh:mm:ss") %>'></asp:Label> <span id='Countdown_<%#Eval("ProductID") %>' onload="GetTimeOnLoad('<%#Eval("ModifiedOn")%>','Countdown_<%#Eval("ProductID") %>');"></span> <br /> <asp:Label ID="lblFinalPrice" runat="server" Text='<%#Convert.ToDouble(Eval("FinalPrice")).ToString("#.00")%>'></asp:Label> <br /> <asp:Label ID="lblFullName" runat="server" Text='<%#Eval("FullName") %>'></asp:Label> <br /> <asp:Button ID="btnAddbid" Text="Bid" CommandName="AddBid" CommandArgument='<%#Eval("ID")%>' runat="server" /> </ItemTemplate> </asp:FormView> and following is my jquery code function GetTimeOnLoad(shortly,DivID) { var dt = new Date(shortly); alert(dt); alert(shortly); alert(DivID); var ProductDivID = "#" +DivID; alert(ProductDivID); $(ProductDivID).countdown({ until: dt, onExpiry: liftOff, onTick: watchCountdown, format: 'HMS', layout: '{hnn}{sep}{mnn}{sep}{snn}' }); } function liftOff(){}; function watchCountdown(){}; In above code I Used ' onload="GetTimeOnLoad('<%#Eval("ModifiedOn")%','Countdown_<%#Eval("ProductID") %');" but is not working

    Read the article

  • UTF-8 GET using Indy 10.5.8.0 and Delphi XE2

    - by Bogdan Botezatu
    I'm writing my first Unicode application with Delphi XE2 and I've stumbled upon an issue with GET requests to an Unicode URL. Shortly put, it's a routine in a MP3 tagging application that takes a track title and an artist and queries Last.FM for the corresponding album, track no and genre. I have the following code: function GetMP3Info(artist, track: string) : TMP3Data //<---(This is a record) var TrackTitle, ArtistTitle : WideString; webquery : WideString; [....] WebQuery := UTF8Encode('http://ws.audioscrobbler.com/2.0/?method=track.getcorrection&api_key=' + apikey + '&artist=' + artist + '&track=' + track); //[processing the result in the web query, getting the correction for the artist and title] // eg: for artist := Bucovina and track := Mestecanis, the corrected values are //ArtistTitle := Bucovina; // TrackTitle := Mestecani?; //Now here is the tricky part: webquery := UTF8Encode('http://ws.audioscrobbler.com/2.0/?method=track.getInfo&api_key=' + apikey + '&artist=' + unescape(ArtistTitle) + '&track=' + unescape(TrackTitle)); //the unescape function replaces spaces (' ') with '+' to comply with the last.fm requests [some more processing] end; The webquery looks in a TMemo just right (http://ws.audioscrobbler.com/2.0/?method=track.getInfo&api_key=e5565002840xxxxxxxxxxxxxx23b98ad&artist=Bucovina&track=Mestecani?) Yet, when I try to send a GET() to the webquery using IdHTTP (with the ContentEncoding property set to 'UTF-8'), I see in Wireshark that the component is GET-ing the data to the ANSI value '/2.0/?method=track.getInfo&api_key=e5565002840xxxxxxxxxxxxxx23b98ad&artist=Bucovina&track=Mestec?ni?' Here is the full headers for the GET requests and responses: GET /2.0/?method=track.getInfo&api_key=e5565002840xxxxxxxxxxxxxx23b98ad&artist=Bucovina&track=Mestec?ni? HTTP/1.1 Content-Encoding: UTF-8 Host: ws.audioscrobbler.com Accept: text/html, */* Accept-Encoding: identity User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.23) Gecko/20110920 Firefox/3.6.23 SearchToolbar/1.22011-10-16 20:20:07 HTTP/1.0 400 Bad Request Date: Tue, 09 Oct 2012 20:46:31 GMT Server: Apache/2.2.22 (Unix) X-Web-Node: www204 Access-Control-Allow-Origin: * Access-Control-Allow-Methods: POST, GET, OPTIONS Access-Control-Max-Age: 86400 Cache-Control: max-age=10 Expires: Tue, 09 Oct 2012 20:46:42 GMT Content-Length: 114 Connection: close Content-Type: text/xml; charset=utf-8; <?xml version="1.0" encoding="utf-8"?> <lfm status="failed"> <error code="6"> Track not found </error> </lfm> The question that puzzles me is am I overseeing anything related to setting the property of the tidhttp control? How can I stop the well-formated URL i'm composing in the application from getting wrongfully sent to the server? Thanks.

    Read the article

< Previous Page | 560 561 562 563 564 565 566 567 568 569 570 571  | Next Page >