Search Results

Search found 85288 results on 3412 pages for 'new bie'.

Page 567/3412 | < Previous Page | 563 564 565 566 567 568 569 570 571 572 573 574  | Next Page >

  • How do I remotely run a Powershell workflow that uses a custom module?

    - by drawsmcgraw
    I have a custom Powershell module that I wrote for various tasks. Now I want to craft a workflow whose activities will use commands from the module. Here's my test workflow: workflow New-TestWorkflow{ InlineScript { Import-Module custom.ps1 New-CommandFromTheModule } } Then I run the workflow with: New-TestWorkflow -PSComputerName remoteComputer When I do this, the import fails because it can't find the module. I imagine this is because the workflow is executing on the remote machine, where my module does not exist. I can see myself running this across many machines so I'd really rather not have to install this module and maintain it on all of the machines. Is there some way to have my module in a central place and use it in workflows?

    Read the article

  • safari 5 doesnt work on my computer.

    - by Amairani409
    I just got the new version of safari y downloaded because my mac tell me there was new version that I should be getting. but when I try to run my this new version of the aplication .nothing happends¡ I mean the program seems to be working but nothing apears in the screen and so when I try to see my top sites a little window show up but it just dont show anything. then 3 seconds later the program shut down¡ I dont know why is happening this Im not so a expert in computers but this really is away of all I see on safari and on mac I got Mac OS X version 10.5.8 2.66ghz intel core 2 duo 4gb 1067 MHz DDR3

    Read the article

  • Applescript won't open applications on my external monitor

    - by jpadvo
    I'm trying to open a new MacVim window with Applescript, and have found partial success with this: do shell script "cd \"~/code/application\"; ~/bin/mvim > /dev/null 2>&1" This works fine, and opens a new MacVim window with it's working directory set to ~/code/application. BUT it always opens on the screen of my laptop, not on the external monitor with the currently active space where I am working. Is there a way to get MacVim to open in the current space? Edit: same problem with opening a finder window: tell application "Finder" to make new Finder window

    Read the article

  • How to handle knowledge handover effectively?

    - by Zizzencs
    Let's say a large enterprise opens a new office in (insert random location here) and want the new colleges up to speed as fast as possible. Let's also say this enterprise is a very typical one with a complex environment, lots of history and almost full lack of documentation. What's already been decided is that the new colleges will receive howto-style documentation for the most typical tasks and will get seme architecture documentation for some of the more complicated systems. Any ideas about improving this process? And more specifically, how should such a howto document look like to be helpful?

    Read the article

  • .htaccess redirect root directory and subpages with parameters

    - by wali
    I am having difficulty trying to redirect a root directory while at the same time redirect pages in a sub directory to a different URL. For example: http://test.example.com/olddir/sub/page.php?v=one to http://test.example.com/new/one while also redirecting the any request to the root of the olddir folder. I have tried RewriteCond %{QUERY_STRING} v=one RewriteRule ^/olddir/sub/page.php /new/? [R=301] and RedirectMatch /oldir "test.example.com" RedirectMatch /olddir/sub/page.php?v=one "test.example.com/new/one" Any help at this point will be extremely appreciated...Thanks!

    Read the article

  • Re-cased my computer now the power plug keeps shorting

    - by dunc
    I've just re-cased my computer. I got the new case free and thought I'd be able to swap everything over myself but apparently I've done something wrong. I'm OK with components generally but wasn't totally confident about doing this. So, my question is, when setting up a new PC or moving old components into a new case, what could I have done which causes the power cable plug to short/fuse when I plug it in?. Is this likely to be an issue with the cables from my PSU, or could it be the internal case connectors? What steps would you take to diagnose the problem? I'd rather not start again if I don't have to...! Thanks in advance,

    Read the article

  • Migrating Magento Concern

    - by Pankaj Upadhyay
    We have a Magento 1.5.0.1 store running at a hosting provider. Now, we need to migrate the same from that server to a new hosting provider. I had talk with a technical guy from the new hosting provider who told me to do following things. Go into the cPanel Backup Wizard . Make a FULL BACKUP and download the zip file Then upload that zip file on their server in my root folder. Then tell them and they will do the restore. My Concern :- Will everything work as expected. What about the connectionstrings and database and all. Will database be automatically created and work the same. Also, somewhere I read that ver 1.5.0.1 used older type of database which might not work on new MySQLs. Can this too have any impact. Should i proceed in the same manner or I need to take care of some additional things to ensure smooth running.

    Read the article

  • How to change the computer name on a server configured by Puppet

    - by David Sulpy
    I am new to Puppet and I'm trying to get Puppet to configure my EC2 instances after they're started from a Cloud Formation Template in AWS. The problem is that all the nodes that get started from the Cloud Formation Template all have the same name (the name from the AMI that the new nodes derive from). I would love to find a way to have puppet rename the nodes when the nodes start up. (although, as far as I know, a Computer Name change requires reboot, a separate issue...) If you can point me to some documentation that can help me figure this out or if you have any ideas that would be great. My ultimate goal is to have each EC2 start with a unique name so that I can use New Relic server monitoring to report the different servers.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • SharePoint Session Management - which SQL Server option?

    - by frumious
    We're developing some custom web parts for our WSS 3 intranet, and have just run into something we'd like to use ASP.NET sessions for. This isn't currently enabled on the development server. We'd like to use SQL Server as the storage mechanism, because the production environment is a web farm with very simple load-balancing. There are 3 options you can choose from to set up the SQL Server session storage, tempdb, default separate DB, named DB. Both tempdb and default separate DB create a new DB to store certain information in; tempdb stores the actual session info in tempdb, which doesn't survive a reboot, and default separate DB stores everything in the new DB. Since you've got to create the new DB either way, my question is this: why would you ever choose to store the session info in tempdb? The only thing I can think of is if you'd like to have the ability to wipe the session by rebooting the server, but that seems quite apocalyptic!

    Read the article

  • A Duplicate name exists on the network

    - by Adam
    Recently we changed out office IT structure from having a dedicated server to be the DC, a dedicated server for the exchange etc... (Each running Windows Server 2003 R2) Now we have a single server running Windows SBS 2008 and created a new domain (with a different domain name) We then changed every PC so it connected to the new domain and renamed every PC with a new naming structure. After I had done this, we were getting several PCs that would get the following message just before the login screen (Alt+Ctrl+Del Screen) A Duplicate name exists on the network I have checked the ADUC and have removed the trouble PCs from the list and renamed each PC and changed the SID before connecting back onto the domain but still getting this message. I have tried everything that i can think of but still getting the problem. Any help would be greatly appreticated.

    Read the article

  • What are the pros of switching DNS names with a database server hardware upgrade?

    - by wilbbe01
    When we upgrade to new hardware at work we usually increment a number in the DNS name. For example. We have a server called database-2, that is slated to become database-3 in the coming days. I haven't been able to find a good reason why this is good behavior. To me the work of trying to catch all end user machines, as well as all servers dependent on the database server is far riskier than simply moving the database and ip/name with it to the new hardware. A little over a year ago we spent several months of requests coming in, as infrequent users began using software that needed to be updated to point to a new DNS name. I am struggling to find answers as to why this is a good practice. So the question. Why is using DNS names as a "server hardware version identifier" a good idea? What am I overlooking? Thanks much.

    Read the article

  • Do I have a bad SD card?

    - by User1
    I'm trying to copy data from my computer to an SD card. After a few hundred megs, I keep getting the following errors in dmesg: [34542.836192] end_request: I/O error, dev mmcblk0, sector 855936 [34542.836284] FAT: unable to read inode block for updating (i_pos 13694981) [34542.836306] MMC: killing requests for dead queue [34542.836310] end_request: I/O error, dev mmcblk0, sector 9280 [34542.837035] FAT: unable to read inode block for updating (i_pos 148486) [34542.837062] MMC: killing requests for dead queue [34542.837066] end_request: I/O error, dev mmcblk0, sector 1 [34542.837074] FAT: bread failed in fat_clusters_flush [34542.837085] MMC: killing requests for dead queue These were all files I copied from a smaller SD card. I just want to transfer them to my new, larger card for my phone. I tried the same experiment with different files on a different machine and the card failed again. Reading data from the old card went fine. My systems are older and the new SD card is new (16GB Class 4). Could this be that my computers are too old? Is there a definitive test to verify if my SD card is bad?

    Read the article

  • Permission denied in Ubuntu

    - by gcc
    I have a file which includes new icons for my system. Anyway, How can I change my old icons down with new ones? The name of the new icon pack is "myFAV-TUX" and it's sitting on my desktop. The problem is, I can't copy them into the usr/share/icons/ folder. It says, permission denied. I also tried ls -l .... But i couldn't do it. How can I change the icon theme? Please help.

    Read the article

  • AS2 Server Software Costs

    - by CandyCo
    We're currently using Cleo LexiCom as our server software for receiving EDI transmissions via the AS2 protocol. We have 7 trading partners per year, and this runs us about $800/year for support from Cleo. We need to expand from 7 trading partners to 10 or so, and Cleo charges roughly $600 per new host, plus an expanded yearly support fee. My question(s) are: Does anyone know of a cheaper developer of AS2 server software, and perhaps one that doesn't charge per new host? Does anyone have any clue why we are being charged an upfront fee for new hosts, and if this is a standard practice for AS2 software providers? It seems really odd that we are required to pay upfront costs for this. I could completely understand an increase in the yearly support, however.

    Read the article

  • DVI monitor detected only on computer startup

    - by kamil
    I've recently connected a new monitor, LG M2252D-PZ, to a rather outdated computer with Windows XP and Radeon 9600. XP has SP3 installed, video drivers are the latest version back from the times the video card was still supported. My problem is that the monitor works fine only as long as I don't turn it off or switch it to a different input. When I turn it back on, it says "no signal". The key to the problem must be the DVI port, to which the new monitor is connected. The previous monitor was connected to the VGA output, and I've tested that the new one also works fine when connected to the analogue port. Apparently, the computer tests for the presence of a monitor on the DVI port only on startup. The question is, how do I change this?

    Read the article

  • HP Virtual Connect and VLAN Tagging

    - by JaapL
    We have a c7000 chasis with the ability to have 8 uplinks per ESX host. Only 6 are currenlty active. I have a Virtual Switch with multiple vlan port groups and all the VMs are working fine. Recently we've been asked to setup network load balancing for one of our VMs, so we had our Virtual Connect engineer activate the last two uplinks. We then created a new vSwitch and added the two new uplinks to this vSwitch. We then moved the VM to this new vSwitch, but we get no connectivity. What could be the issue? We also added the appropriate VLAN ID. The VConnect engineer says everything is configured correctly and networking TEAM says the appropriate trunking is setup, so we are at a loss...

    Read the article

  • Vacant thumbnail spot persists on Chrome homepage, want to set it specific to a site

    - by 9dan
    I have a vacant thumbnail place in Google Chrome that I would like to set for a particular site. In this case, it's Facebook. When I visit a new website a new thumbnail is created for that site in the sixth spot. Wanting to place Facebook at the sixth location I deleted the new thumbnail and visited Facebook again. But the sixth place remains vacant no matter how often I visit Facebook. What can I do to set a specific thumbnail position a particular site?

    Read the article

  • Transfer disk image to larger/smaller disk

    - by forthrin
    I need to switch the hard drive on a 2006 iMac to a new SSD. I don't have the original installation CDs. I know I can order CDs from Apple, but this costs money. Someone told me it's possible to rip the image of the old drive and transfer to the new drive. If so, does the size of the new drive have to be exactly the same as the old? If not, my questions are: Is it possible to "stretch" the image from 120 MB disk to a 256 MB disk (numbers are examples)? If so, what is the command line for this? Likewise, is it possible to "shrink" an image from a larger disk (eg. 256 MB) to a smaller disk (eg. 120 MB), provided that the actual space used on the disk does not exceed 120 MB? How do you do this on the command line?

    Read the article

  • SQL server could not connect: Lacked Sufficient Buffer Space...

    - by chumad
    I recently moved my app to a new server - the app is written in c# against the 3.5 framework. The hardware is faster but the OS is the same (Win Server 2003). No new software is running. On the prior hardware the app would run for months with no problems. Now, in this new install, I get the following error after about 3 days, and the only way to fix it is to reboot: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - An operation on a socket could not be performed because the system lacked sufficient buffer space or because a queue was full.) I have yet to find a service I can even shut down to make it work. Anyone had this before and know a solution?

    Read the article

  • Move and clone VirtualBox machines with filesystem commands

    - by mit
    I know of 2 ways to clone a VirtualBox machine on a linux host, one is by using the VirtualBox gui and exporting and re-importing as Appliance (in the file menu of VirtualBox). The other is by cloning only the virtual disk containers: VBoxManage clonevdi source.vdi target.vdi (Taken from http://forums.virtualbox.org/viewtopic.php?p=853#p858 ) I would have to create a new VM afterwards and use the cloned virtual disk. Is there a way I can just copy a virtual disk and the and do the rest by hand? I'd have to manually edit the ~/VirtualBox/VirtualBox.xml and insert a new disk and a new machine: Can I just make up UUIDs or how would this work? I would very much prefer this hardcore method of doing things as it allows me to freely and rapdily backup, restore, move or clone machines. Or ist there a better way to do this?

    Read the article

  • Apply rewrite rule for all but all the files (recursive) in a subdirectory?

    - by user784637
    I have an .htaccess file in the root of the website that looks like this RewriteRule ^some-blog-post-title/ http://website/read/flowers/a-new-title-for-this-post/ [R=301,L] RewriteRule ^some-blog-post-title2/ http://website/read/flowers/a-new-title-for-this-post2/ [R=301,L] <IfModule mod_rewrite.c> RewriteEngine On ## Redirects for all pages except for files in wp-content to website/read RewriteCond %{REQUEST_FILENAME} !-f RewriteCond %{REQUEST_FILENAME} !-d RewriteCond %{REQUEST_URI} !/wp-content RewriteRule ^(.*)$ http://website/read/$1 [L,QSA] #RewriteRule ^http://website/read [R=301,L] RewriteBase / RewriteRule ^index\.php$ - [L] RewriteCond %{REQUEST_FILENAME} !-f RewriteCond %{REQUEST_FILENAME} !-d RewriteRule . /index.php [L] </IfModule> My intent is to redirect people to the new blog post location if they propose one of those special blog posts. If that's not the case then they should be redirected to http://website.com/read. Nothing from http://website.com/wp-content/* should be redirected. So far conditions 1 and 3 are being met. How can I meet condition 2?

    Read the article

  • Migrate servers without losing any data / time-limited MySQL dump?

    - by inac
    Is there a way to migrate from an old dedicated server to a new one without losing any data in-between - and with no downtime? In the past, I've had to lose MySQL data between the time when the new server goes up (i.e., all files transferred, system up and ready), and when I take the old server down (data still transferred to old until new one takes over). There is also a short period where both are down for DNS, etc., to refresh. Is there a way for MySQL/root to easily transfer all data that was updated/inserted between a certain time frame?

    Read the article

  • App Pool crashes before loading mscorsvr. How to troubleshoot?

    - by codepoke
    I have an app pool that recycles every 29 hours, per default. It recycles smoothly 9 times out of 10, and I'm pretty sure the recycle itself is good for the app. Once every couple weeks the recycle does not work. The old worker process dies cleanly and the new worker process starts, but will not serve up content. Recycling the app pool again manually works like a charm. The failed worker process stops and dies cleanly and a second new worker process fires up and serves content perfectly. I took a crash dump against the failed worker process prior to recycling it, and DebugDiag found nothing to complain about. I tried to dig a little deeper using WinDBG, but mscorsvr/mscorwks is not loaded yet 15 minutes after the new process started. There are 14 threads running (4 async) and 20 pending client connections, but .NET is not even loaded into the process yet. Any suggestions where to poke and prod to find a root cause on this?

    Read the article

  • Enable group policy for everything but the SBS?

    - by Jerry Dodge
    I have created a new group policy to disable IPv6 on all machines. There is only the one default OU, no special configuration. However, this policy shall not apply to the SBS its self (nor the other DC at another location on a different subnet) because those machines do depend on IPv6. All the rest do not. I did see a recommendation to create a new OU and put that machine under it, but many other comments say that is extremely messy and not recommended - makes it high maintenance when it comes to changing other group policies. How can I apply this single group policy to every machine except for the domain controllers? PS - Yes, I understand IPv6 will soon be the new standard, but until then, we have no intention to implement it, and it in fact is causing us many issues when enabled.

    Read the article

< Previous Page | 563 564 565 566 567 568 569 570 571 572 573 574  | Next Page >