Search Results

Search found 3865 results on 155 pages for 'removing whitespace'.

Page 57/155 | < Previous Page | 53 54 55 56 57 58 59 60 61 62 63 64  | Next Page >

  • Paren-free PHP? [on hold]

    - by Ivan Curdinjakovic
    I stumbled upon the idea for paren-free ecmascript (https://brendaneich.com/2010/11/paren-free/), which is inspired by Go language. And it's simple, clean and cool - if you make braces required instead of recommended (and they are recommended everywhere anyway: http://www.php-fig.org/psr/psr-2/), then parenthesis are unneeded around control structure “heads”. It would work exactly the same in PHP. So, a piece of PHP code could look like this: if $someVar == 42 { doSomething(); } or: foreach $someArray as $key => $value { echo "$key: $value"; } It's a small, but nice step towards a nicer, cleaner syntax and removing unnecessary parts. The question is - would PHP community be willing to see the languange move in that direction? Would it be considered an improvement by majority, or are we too used to typing those parenthesis and unwilling to see any change in PHP syntax?

    Read the article

  • Anyone can suggest some Game Frameworks for GNU/Linux? [closed]

    - by dysoco
    So I've been developing a little bit with XNA + C# in Windows, not really much: just some 2D stuff, but I've found that XNA is a really good framework. I'm a GNU/Linux user, and I'm definitely migrating my desktop to Gentoo Linux (I've been using Arch in my laptop for a while now). But, of course, I need a C# + XNA alternative... I'm not really an expert in any language, so I can really pick up anything (except, maybe, Functional ones), I prefer C-Like languages like Java or Ruby, I tried Python but found the Whitespace syntax confusing. I would like to hear some of you'r suggestions, I'm not asking for "the best", but for "some suggestions", so I think this is objective enough. Probably you're going to suggest C++ + SDL, but I would prefer something more "High Level" like XNA, but I'm open to discuss anything. So... any ideas ? Note: I think this questions meets the guidelines for this site, if it doesn't: please not only downvote this question, but comment on what can I do to improve it. Thanks. PS: 2D Games, not 3D

    Read the article

  • Context-specific remap

    - by dotancohen
    I have the following handy VIM map: inoremap ( ()<Left> However, sometimes I will enter Insert mode to add a function call around a variable, like so: Was: $sql = "SELECT * FROM " . $someTable; To: $sql = "SELECT * FROM " . mysql_real_escape_string($someTable); The mapping makes a redundant ) after mysql_real_escape_string(. Is there any way to refactor the mapping so that if there exists a character after the cursor, and the character after the cursor is not whitespace, then )<left> is not appended to (? Thanks.

    Read the article

  • I've totally missed the point of distributed vcs [closed]

    - by NimChimpsky
    I thought the major benefit of it was that each developers code gets stored within each others repository. My impression was that each developer has their working directory, their own repository, and then a copy of the other developers repository. Removing the need for central server, as you have as many backups as you have developers/repositories Turns out this is nto the case, and your code is only backed up (somewhere other than locally) when you push, the same as a commit in subversions. I am bit disappointed ... hopefully I will be pleasantly surprised when it handles merges better and there are less conflicts ?

    Read the article

  • Mic not working when vga connector removed

    - by yygyt
    I have a computer that should run continuously without any connection to a monitor. For developmental purposes I have been keeping the vga connection with the monitor and experienced no problem until now. When I start the machine removing the vga connection beforehand, external microphone does not work. At first I didn't know anywhere to look and see the problem, but after a google search I saw that there is a command as alsamixer I ssh the machine end type alsamixer when it is connected to the monitor, here is the result If I remove monitor connection and reboot again, and then type alsamixer, I see the error, $ alsamixer cannot open mixer: No such file or directory I suspect that this error is related to X somehow. I really don't know anything about what goes beyond. This machine needs to work without any connection to a monitor. I would deeply appreciate any suggestions.

    Read the article

  • How can you remove Unity?

    - by Brad
    In previous versions of Netbook Remix I was able to disable the netbook-launcher and just have a blank desktop. I liked the speed of the Netbook version but not the interface, this worked well for me. However, now with 10.10 and Unity I'm having trouble doing a similar thing. I tried removing netbook-launcher from the startup and tried uninstalling unity. The best result I got was a black desktop with a panel and a non configurable blank white background. Is Unity soo integrated into this version that I will have to just go with the default ubuntu installation?? In the past the default version has been slower then the Netbook version without the interface. Thanks.

    Read the article

  • How to recover partially removed components of ubuntu-desktop?

    - by Rick_2047
    So I was messing around with tasksel to install LAMP. Foolishly I unchecked the ubuntu-desktop item. About 25% through the process I realized it is removing my desktop components. So I closed the terminal window, but now maybe something went wrong. Many default applications are gone and I can't even boot into the desktop. I have a separate home folder so I don't really have to worry about data, but I did install a lot of other software which would be gone if I take reformat and reinstall. So is there a way to recover the desktop from a live CD?

    Read the article

  • Drive By Download Issue

    - by mprototype
    I'm getting a drive by download issue reported on www.cottonsandwichquiltshop.com/catalog/index.php?manufacturers_id=19&sort=2a&filterid=61 reported from safeweb.norton.com when I scan the root url. I have dug through the entire site architecture, and code base and removed a few files that were malicious, i upgraded the site's framework and fixed the security holes (mostly sql injection concerns)..... However this one threat still exists and I can't locate it for the life of me, or find any valid research or information on removing this type of threat at the server level, mostly just a bunch of anti-virus software wanting to sell you on their ability to manage it on the client end. PLEASE HELP Thanks.

    Read the article

  • Can all code be represented as a series of Map / Filter / Reduce operations?

    - by Mongus Pong
    I have recently been refactoring large chunks of code and replacing them with Linq queries. Removing the language bias - Linq is essentially a set of Map / Filter and Reduce operations that operate on a sequence of data. This got me thinking, how far would I theoretically be able to take this. Would I be able to rewrite the whole code base into a series (or even a single) of Map / Filter and Reduce operations. Unfortunately I get paid to do useful stuff, so I haven't been able to experiment much further, but I can't think of any code structure that couldn't be re structured as such. Side effected code can be dealt with via monads.. Even output is essentially mapping memory addresses to screen addresses. Is there anything that couldn't be (theoretically) rewritten as a Linq query?

    Read the article

  • Need to run `nvidia-xconfig` before booting

    - by RobinJ
    I formatted my whole hard drive, and installed Elementary OS (Ubuntu 10.10) on it in an attempt to get rid of all the problems. It failed. Every since I installed the nvidia-current drivers I first need to boot into recovery mode, and run sudo nvidia-xconfig before booting the system in the normal way. If I don't do this, it will just stop at a black screen after the boot screen, responding to nothing but CTRL+ALT+DELETE and the power button. When I boot the system after running the nvidia-xconfig command I can just start working as usual. Update I suspect it's got something to do with Plymouth. I shall have to try it again before I can confirm it, but removing the quiet and splash parameters from the kernel line in /boot/grub/grub.cfg seems to help. But still, I like my Plymouth screen. A black screen with text rolling over it (or without the text) doesn't attract me much.

    Read the article

  • Why did I have to remove resolvconf to get dnsmasq to work again?

    - by lightxx
    Yesterday I upgraded to Precise and dnsmasq stopped working. That is, DNS queries to localhost were dnsmasq is listening (127.0.0.1) were refused. Removing resolvconf (apt-get remove resolvconf) and rebooting solved the issue (found that suggestion somewhere on Google). /etc/resolv.conf looked fine with and without resolvconf in place. No difference at all. Why would I use resolvconf? Are there any benefits? The Wikipedia article covering resolvconf sucks. Why did resolvconf interfere with dnsmasq? Is this a known issue?

    Read the article

  • Dell Inspiron N5110 Battery lasts only for 1.5 hours as opposed to 4 hours on Windows 7

    - by ubuntufan
    I've a Dell Inspiron N5110 laptop with the following specs: i5 processor 4 GB RAM NVIDIA GeForce GT540M Ubuntu 12.04LTS My laptop is overheating and the battery is lasting for only about 1.5 hours. I had checked if the battery indicator was problematic but it turned out it wasn't. I drained the battery to it's least possible value and that came to around 1 hr 40 minutes. In fact, I've the same problem with Debian and Xubuntu as well. I would like to get some proper solution for this. FYI: I've been having this problem since Ubuntu 11.04 but I'm not able to solve this in spite of trying various fixes like reducing brightness, Removing startup apps, Updating kernel and what not?. I'm a big fan of Ubuntu but this problem is stopping me from using Ubuntu and I'm using Win7 for 90% of the time.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Has the Appindicator or GtkMenu API changed in Saucy?

    - by marxjohnson
    I've written a custom application indicator, which isn't working properly on saucy. The menu is initialised with a few items, then updates regularly, adding or removing menu items. This worked fine <13.10, but on 13.10, the line that adds the menu to the indicator produces the following warning: Warning: /build/buildd/glib2.0-2.38.0/./gobject/gsignal.c:2475: signal 'child-added' is invalid for instance '0x24390e0' of type 'GtkMenu' self.ind.set_menu(self.menu) And the items added to the menu subsequently dont appear. A bug has been filed against several indicators for the same problem, but it's not clear to me whether this is a problem with the indicators as a result of an API change, or a bug in the GTK or Appindicator libraries. Does anyone know?

    Read the article

  • In Sublime Text 2, how can I indent out to a straight column with multiple cursors on a ragged edge?

    - by mtoast
    Suppose I've got multiple cursors along several lines, like this: foo| barr| foobar| baz| How can I automatically push the whitespace at the end of each line out to a flat edge, like this?: foo | barr | foobar | baz | (In these examples, | is supposed to be my cursor.) EDIT #1 When you just Tab or Space from the initial arrangement, you get this: # Useful, but not what I'm looking for foo | barr | foobar | baz | That's useful, but not what I'm looking for. I'm looking for some kind of keyboard shortcut that will let me indent from a ragged multi-cursor insert out to a straight column.

    Read the article

  • Steam not opening or responding at all

    - by user109409
    The steam client won't open nor does it display any error message. I have tried right click > Games. I ran steam steam://open/games command, but the client just does not respond. Removing it with apt-get remove steam, deleting the Steam directory & the .deb file and reinstalling it, did not work either. This problem only occurred after I used killall steam.sh to force quit it, it was working fine before. I'm running 12.10 on a 64bit laptop with no additional drivers installed. Anyone else have this problem and a possible workaround? Thank you

    Read the article

  • Is there any diff tool for XML files?

    - by qedi
    Are there any good (Linux) tools for diffing two XML files? Ideally, I would like to be able configure it to some things strict, or loosen some things, like whitespace, or attribute order. I'll often care that the files are functionally the same, but diff by itself, would be annoying to use, especially if the XML file doesn't have a lot of linebreaks. For example, the following should really be okay to me: <tag att1="one" att2="two"> content </tag> <tag att2="two" att1="one"> content </tag>

    Read the article

  • How can I disable update checking on boot?

    - by Chauncellor
    I'm running off of a thumb drive with very average read/write speeds and automatic update checks makes the bootup far less pleasant. Since I manually update via apt there's truly no need to notify me like on a normal desktop. In older versions of Ubuntu there was an item to disable this behavior. On 12.04 this is no longer the case. would it be the 'unattended-upgrades' item in /etc/init.d? If yes, would simply removing the init script would solve my problem?

    Read the article

  • Change from static HTML file to meta tag for Google Webmaster verification

    - by Wilfred Springer
    I started verifying the server by putting a couple of static HTMLs in place. Then I noticed that Google wants you to keep these files in place. I didn't want to keep the static HTMLs in, so I want to switch to an alternative verification mechanism, and include the meta tags on the home page. Unfortunately, once your site is verified, you never seem to be able to change to an alternative way of verification. I tried removing the HTML pages. No luck whatsoever. Google still considers the site to be 'verified'. Does anybody know how to undo this? All I want to do is switch to the meta tag based method of site ownership verification.

    Read the article

  • No analog audio in 13.10

    - by danepowell
    I've installed 13.10 on a machine that was previously running Windows 8, and audio output isn't working out of the box. It worked fine in Windows, and the speakers work fine when hooked up to a laptop, so it must an incompatibility between Ubuntu and the motherboard. If I go to sound settings, "Built-in Audio" is selected (SPDIF is also available). This is an Intel Z77 motherboard with an integrated Creative CA0132 sound chipset. I've tried booting a live image of 13.10 (to check for a corrupt install), and the same problem exists. If I boot a live image of 13.04, the only audio output listed in sound settings is a "dummy" card. I've already tried basic troubleshooting steps, such as removing pulseaudio config directories, force-restarting alsa, and making sure the speakers aren't muted in the alsa mixer. At this point, I'm totally stumped :(

    Read the article

  • Compiz plugin (Grid) does not update in CCSM

    - by pileofrocks
    I upgraded to 13.10. Compiz itself has been updated properly to 0.9.10.2, but in CCSM, one* plugin (Grid) shows up as the old version. I know it has been changed and I can actually see the updated version when I log in with another user. This hints of some kind of a problem with per-user settings? (* Actually I'd expect this to involve other if not all other plugins too, but I have simply not yet noticed others.) So far I have tried: resetting Compiz settings to defaults (GUI-way) does not help completely removing & reinstalling compizconfig-settings-manager and compiz-plugins packages does not help In 13.04, I had a patched/old version of the plugin, but I doubt it is about that since everything is fine with the other user (that user account existed already in 13.04). What configuration files I should try deleting?

    Read the article

  • WiFi, No ping, other works fine

    - by Linux Mom
    I installed Ubuntu 12.04 LTS for my mom, this runs OK. However recently, I switched back and forth between encryptions on our WiFi Router from WPA-PSK to WEP and back again to WPA-PSK, same password. Now this old laptop won't even ping the gateway on the router, although the nm-applet shows connected. I tried re-adding the network and putting in the BSSID. I did this over again sometimes just to verify. I tried with my 3G Tethering on my phone, it works fine, can go online too. My other Linux laptop can go on the same wifi as well as my phone. And this laptop used to been online on the same network, same password, same encryption (WPA-PSK) What can be wrong ? Does it need a serious kick in the butt or removing some cached authorisation somewhere?

    Read the article

  • How do I remove the Skype icon from the system panel?

    - by superjudge3
    I have been trying for some time to remove the Skype icon in the upper panel in Ubuntu 11.10, but to no avail. I have went into dconf, went to desktop - unity - panel, and I looked to delete 'Skype' from the whitelist. But Skype isn't in the whitelist! And it's showing up on the panel! Something smells fishy here, and I was wondering if anyone had an answer as to a) how I can actually remove the Skype icon from the gnome panel and b) why an icon still show up there if it isn't in the whitelist? Also, if it's relevant, I use Unity. EDIT: So, the only solution for this issue is the scorched earth strategy of removing sni-qt?

    Read the article

  • What Does It Usually Mean for a Feature to be "Supported"?

    - by joshin4colours
    I'm currently working some testing for a particular area of an application. I had to write some automated tests for a particular feature but due to the circumstances, this was not easy to do. When I asked one of the other testers about it, he mentioned that the same features exist in a sister application our company produces but isn't documented anywhere (end-user documentation or otherwise). He also said that the feature doesn't typically get tested at all in the sister application and isn't usually tested in the application I work on. Apparently this feature isn't heavily used but removing it would require a fair bit of work so the benefit-cost ratio doesn't work out. All of this has left me with some questions. Other than "The documentation says so" or "We told the client it is", what usually makes a feature "supported" versus an unsupported feature?

    Read the article

  • Shutdown issues on my Dell XPS M1530

    - by CppLearner
    On my Dell XPS M1530 lapttop, I am facing issues with shut-down option after upgrading to 12.04 LTS from 11.10. Sometimes it shutdowns "cleanly". But other times everything goes down but I can still see the power LED glowing (even after removing the power cord). If I keep it like that laptop temperature increases. So finally I opt for "hard shut-down" (i.e. pressing the power button on). Any thoughts what is happening here?. Edit: I just found this link to already reported bug https://bugs.launchpad.net/ubuntu/+source/linux/+bug/987933

    Read the article

< Previous Page | 53 54 55 56 57 58 59 60 61 62 63 64  | Next Page >