Search Results

Search found 273 results on 11 pages for 'ajeet singh'.

Page 6/11 | < Previous Page | 2 3 4 5 6 7 8 9 10 11  | Next Page >

  • how to keep same header on starting of next page in pdf

    - by Santosh Singh
    Here is My Code. private void getActionItems(Document document, Chapter chapter, Section section, Paragraph pas) { List drbRefList = null; try { _actionService = new ActionItemImpl(); _aiBean = new ActionItemData(); if (_aiBean != null) { _actionList = new ArrayList(); LOG.info("business passed here is" + _business); _actionList = _actionService.getActionItemsForPDF(_userSSOID, _business, _reviewID, _connection); } LOG.info(" after calling getActionItemsForPDF"); LOG.info("_actionList" + _actionList); Table tablesh1 = new Table(1, 1); float[] widthsh1 = new float[1]; widthsh1[0] = ReviewConstants.MAGIC_DOTTWELVE; tablesh1.setTableFitsPage(true); tablesh1.setPadding(2); tablesh1.setSpacing(0); tablesh1.setWidth(ReviewConstants.MAGIC_ONEZEROZERO); tablesh1.setWidths(widthsh1); tablesh1.setBorderColor(Color.WHITE); Cell hcell = new Cell(new Paragraph(ReviewConstants.S_ACTIONHEADING, new Font(Font.HELVETICA, fontSize, Font.BOLD, Color.BLUE))); hcell.setHeader(true); tablesh1.addCell(hcell); section.add(tablesh1); Table actionTable = null; String businessUnit = reviewData.getBusinessUnit(); float[] widthac = null; //Updated for Nuclear Energy Engineering Business Unit Requirement by Naveen if(!"Nuclear Energy Engineering".equalsIgnoreCase(businessUnit)){ actionTable = new Table(ReviewConstants.NINE,ReviewConstants.THREE); widthac = new float[ReviewConstants.NINE]; widthac[0] = ReviewConstants.MAGIC_DOTONE; widthac[1] = ReviewConstants.MAGIC_DOTONEZERO; widthac[2] = ReviewConstants.MAGIC_DOTTWOZERO; widthac[ReviewConstants.THREE] = ReviewConstants.MAGIC_DOTTWOZERO; widthac[ReviewConstants.FOUR] = ReviewConstants.MAGIC_DOTONEZERO; widthac[ReviewConstants.FIVE] = ReviewConstants.MAGIC_DOTONEZERO; widthac[ReviewConstants.SIX] = ReviewConstants.MAGIC_DOTONEZERO; widthac[ReviewConstants.SEVEN] = ReviewConstants.MAGIC_DOTONEZERO; widthac[ReviewConstants.EIGHT] = ReviewConstants.MAGIC_DOTONEZERO; }else{ actionTable = new Table(ReviewConstants.SIX,ReviewConstants.THREE); widthac = new float[ReviewConstants.SIX]; widthac[0] = ReviewConstants.MAGIC_DOTONE; widthac[1] = ReviewConstants.MAGIC_THREEZERO; widthac[2] = ReviewConstants.MAGIC_THREEZERO; widthac[ReviewConstants.THREE] = ReviewConstants.MAGIC_THREEZERO; widthac[ReviewConstants.FOUR] = ReviewConstants.MAGIC_DOTONEZERO; widthac[ReviewConstants.FIVE] = ReviewConstants.MAGIC_DOTONEZERO; } actionTable.setTableFitsPage(true); actionTable.setPadding(2); actionTable.setSpacing(0); actionTable.setWidth(ReviewConstants.MAGIC_ONEZEROZERO); actionTable.setWidths(widthac); actionTable.setBorderWidth(1); Cell accell = new Cell(new Paragraph(ReviewConstants.S_ACTIONID, new Font(Font.HELVETICA, fontSize, Font.BOLD))); accell.setHeader(true); actionTable.addCell(accell); if(!"Nuclear Energy Engineering".equalsIgnoreCase(businessUnit)){ accell = new Cell(new Paragraph(ReviewConstants.PDF_RT, new Font(Font.HELVETICA, fontSize, Font.BOLD))); accell.setHeader(true); actionTable.addCell(accell); } accell = new Cell(new Paragraph(ReviewConstants.S_REQA, new Font(Font.HELVETICA, fontSize, Font.BOLD))); accell.setHeader(true); actionTable.addCell(accell); accell = new Cell(new Paragraph(ReviewConstants.S_CLOSURE, new Font(Font.HELVETICA, fontSize, Font.BOLD))); accell.setHeader(true); actionTable.addCell(accell); accell = new Cell(new Paragraph(ReviewConstants.S_DISPOSITION, new Font(Font.HELVETICA, fontSize, Font.BOLD))); accell.setHeader(true); actionTable.addCell(accell); //added by santosh on 18 june actionTable.endHeaders(); document.add(actionTable); if(!"Nuclear Energy Engineering".equalsIgnoreCase(businessUnit)){ accell = new Cell(new Paragraph(ReviewConstants.S_DRB_REFERENCE, new Font( Font.HELVETICA, fontSize, Font.BOLD))); accell.setHeader(true); actionTable.addCell(accell); accell = new Cell(new Paragraph(ReviewConstants.S_DEADLINE, new Font( Font.HELVETICA, fontSize, Font.BOLD))); accell.setHeader(true); actionTable.addCell(accell); } accell = new Cell(new Paragraph(ReviewConstants.S_OWNER, new Font( Font.HELVETICA, fontSize, Font.BOLD))); accell.setHeader(true); actionTable.addCell(accell); accell = new Cell(new Paragraph(ReviewConstants.S_STATE, new Font( Font.HELVETICA, fontSize, Font.BOLD))); accell.setHeader(true); actionTable.addCell(accell); int acSize = 0; if (_actionList != null) { acSize = _actionList.size(); } for (int i = 0; i < acSize; i++) { _aiBean = (ActionItemData) _actionList.get(i); Cell adCell = new Cell(new Paragraph(_aiBean.getActionID(), new Font( Font.HELVETICA, ReviewConstants.MAGIC_EIGHT))); adCell.setHeader(false); actionTable.addCell(adCell); if(!"Nuclear Energy Engineering".equalsIgnoreCase(businessUnit)){ if (_aiBean.getActionItemType().equals("0")) { adCell = new Cell(new Paragraph("Normal", new Font(Font.HELVETICA, fontSize))); } else { adCell = new Cell(new Paragraph("Critical", new Font(Font.HELVETICA, fontSize))); } adCell.setHeader(false); actionTable.addCell(adCell); } adCell = new Cell(new Paragraph(_aiBean.getRequiredAction(), new Font(Font.HELVETICA, fontSize))); adCell.setHeader(false); actionTable.addCell(adCell); adCell = new Cell(new Paragraph(_aiBean.getClosureCriteria(), new Font(Font.HELVETICA, fontSize))); adCell.setHeader(false); actionTable.addCell(adCell); String drbLink = ReviewConstants.EMPTY; drbRefList = new ArrayList(); if (!DRUtils.isEmpty(_aiBean.getState()) && ((_aiBean.getState() .equalsIgnoreCase(ReviewConstants.DRAFT_BEGUN_STATE)) || (_aiBean.getState() .equalsIgnoreCase(ReviewConstants.SCOPE_PROPOSED)) || (_aiBean .getState() .equalsIgnoreCase(ReviewConstants.RES_PROPOSED)))) { drbLink = ReviewConstants.EMPTY; _aiBean.setDisposition(ReviewConstants.EMPTY); } else { drbRefList = _actionService.getDrbRefForPDF(_aiBean.getActionSeqID(), _connection); int drbRefCnt = 0; if (drbRefList != null) { drbRefCnt = drbRefList.size(); int j = 0; for (j = 0; j < drbRefCnt; j++) { LOG.info("drbRefList.get(j)" + drbRefList.get(j).toString()); if (j < (drbRefCnt - 1)) { drbLink += drbRefList.get(j).toString() + ReviewConstants.COMMA_SPACE; } else { drbLink += drbRefList.get(j).toString(); } } } } LOG.info("drbLink" + drbLink); adCell = new Cell(new Paragraph(_aiBean.getDisposition(), new Font(Font.HELVETICA, fontSize))); adCell.setHeader(false); actionTable.addCell(adCell); //Updated for Nuclear Energy Engineering Business Unit Requirement by Naveen if(!"Nuclear Energy Engineering".equalsIgnoreCase(businessUnit)){ adCell = new Cell(new Paragraph(drbLink, new Font( Font.HELVETICA, fontSize))); adCell.setHeader(false); actionTable.addCell(adCell); adCell = new Cell(new Paragraph(_aiBean.getDeadline(), new Font(Font.HELVETICA, fontSize))); adCell.setHeader(false); actionTable.addCell(adCell); } adCell = new Cell(new Paragraph(_aiBean.getActionItemOwnerName(), new Font(Font.HELVETICA, fontSize))); adCell.setHeader(false); actionTable.addCell(adCell); adCell = new Cell(new Paragraph(_aiBean.getState(), new Font(Font.HELVETICA, fontSize))); adCell.setHeader(false); actionTable.addCell(adCell); //added by santosh actionTable.endHeaders(); document.add(actionTable); // added by santosh end } /*Phrase headerPhrase = new Phrase(); Table headTab = (Table)actionTable.getElement(0, 5); headerPhrase.add(headTab); HeaderFooter printHeader = new HeaderFooter(headerPhrase,false); System.out.println("addHeader"); document.setHeader(printHeader); actionTable.setLastHeaderRow(1); actionTable.endHeaders(); document.add(actionTable);*/ // added by santosh actionTable.endHeaders(); document.add(actionTable); // added by santosh end section.add(actionTable); } catch (Exception e) { LOG.error("General Exception occured", e); } }

    Read the article

  • Process.Start in C# = php ?

    - by Karandeep Singh
    In .NET The Process class contains several useful properties/methods that allow developers to access process relative information. Have you any equivalent method or class in php. Have any equivalent method in php like c# method "Process.Start()".

    Read the article

  • Emulator problem in Android

    - by AMANDEEP SINGH
    When I launch the emulator I face many problems (Errors):- HttpConnectionApp]emulator-5554 disconnected! Cancelling 'net.paxcel.http.HttpConnectionApp activity launch'! Emulator]emulator: ERROR: the user data image is used by another emulator. aborting Each time I have to re-run it but all in vain. How can I improve this so that I can re-run the application on same AVD?

    Read the article

  • Use Of Android NDK

    - by Shalini Singh
    Hi!!!! i am new for NDK. i want to know what is the benefit of native code in android . By this can we improve our application performance. and main thing exactly when we will use this native code. please clear it. and from where i can get more information............

    Read the article

  • Sorting manually generated index using perl script

    - by Pradeep Singh
    \item Bernoulli measure, 14 \item cellular automata \subitem Soft, 3, 28 \subitem balance theorem, 23, 45 \item tiles \subitem tiling problem, 19, 58 \subitem aperiodic tile set, 18, 45 \item Garden-of-Eden -theorem, 12 \item Bernoulli measure, 15, 16, 35 \item cellular automata \subitem balance theorem, 9, 11, 14 \subitem blocking word, 22, 32 \item Garden-of-Eden -theorem, 32 I have to sort the above index alphabetically using a perl script. Duplicate item or subitem entries should be merged and their numbers should be sorted. The subitems also should be sorted under respective item and their numbers should be also sorted. If same item is repeated in more than one place with subitems all the subitems should be merged under a single item and also subitems should be sorted

    Read the article

  • php switch statement error on int = 0

    - by Jagdeep Singh
    I am having a problem in php switch case. When i set $number=0 it should run very first case but here this code returns 10-20K that is in second case. I checked comparison operators, tested them in if else case they return correct values but here first case do not run on $number=0 Why is this happening ? php consider 0 as false or something wrong in code ? Link to codepad paste http://codepad.org/2glDh39K also here is the code <?php $number = 0; switch ($number) { case ($number <= 10000): echo "0-10K"; break; case ($number > 10000 && $number <= 20000): echo "10-20K"; break; case ($number > 20000 && $number <= 30000): echo "20-30K"; break; case ($number > 30000 && $number <= 40000): echo "30-40K"; break; case ($number > 40000 && $number <= 50000): echo "40-50K"; break; case ($number > 50000 && $number <= 60000): echo "50-60K"; break; case ($number > 60000 && $number <= 70000): echo "60-70K"; break; case ($number > 70000 && $number <= 80000): echo "70-80K"; break; case ($number > 80000 && $number <= 90000): echo "80-90K"; break; case ($number > 90000): echo "90K+"; break; default: //default echo "N/A"; break; } ?>

    Read the article

  • How can a user view profile info of other users?

    - by Arvind Singh
    I have stored profile info using this code ProfileBase userprofile = HttpContext.Current.Profile; userprofile.SetPropertyValue("FirstName", TextBoxFirstName.Text); userprofile.SetPropertyValue("LastName", TextBoxLastName.Text); userprofile.SetPropertyValue("AboutMe", TextBoxAboutMe.Text); userprofile.SetPropertyValue("ContactNo", TextBoxContactNo.Text); and in web.config <profile enabled="true" defaultProvider="AspNetSqlProfileProvider"> <properties> <add name="FirstName" type="String" /> <add name="LastName" type="String" /> <add name="AboutMe" type="String" /> <add name="ContactNo" type="String" /> </properties> </profile> The profile info is stored and every user is able to view his own profile info using something like this TextBoxFirstName.Text = HttpContext.Current.Profile.GetPropertyValue("FirstName").ToString(); How to fetch profile info of other user say a user types the username of other user in a text box and clicks a button?

    Read the article

  • conditional update records mysql query

    - by Shakti Singh
    Hi, Is there any single msql query which can update customer DOB? I want to update the DOB of those customers which have DOB greater than current date. example:- if a customer have dob 2034 update it to 1934 , if have 2068 updated with 1968. There was a bug in my system if you enter date less than 1970 it was storing it as 2070. The bug is solved now but what about the customers which have wrong DOB. So I have to update their DOB. All customers are stored in customer_entity table and the entity_id is the customer_id Details is as follows:- desc customer_entity -> ; +------------------+----------------------+------+-----+---------------------+----------------+ | Field | Type | Null | Key | Default | Extra | +------------------+----------------------+------+-----+---------------------+----------------+ | entity_id | int(10) unsigned | NO | PRI | NULL | auto_increment | | entity_type_id | smallint(8) unsigned | NO | MUL | 0 | | | attribute_set_id | smallint(5) unsigned | NO | | 0 | | | website_id | smallint(5) unsigned | YES | MUL | NULL | | | email | varchar(255) | NO | MUL | | | | group_id | smallint(3) unsigned | NO | | 0 | | | increment_id | varchar(50) | NO | | | | | store_id | smallint(5) unsigned | YES | MUL | 0 | | | created_at | datetime | NO | | 0000-00-00 00:00:00 | | | updated_at | datetime | NO | | 0000-00-00 00:00:00 | | | is_active | tinyint(1) unsigned | NO | | 1 | | +------------------+----------------------+------+-----+---------------------+----------------+ 11 rows in set (0.00 sec) And the DOB is stored in the customer_entity_datetime table the column value contain the DOB. but in this table values of all other attribute are also stored such as fname,lname etc. So the attribute_id with value 11 is DOB attribute. mysql> desc customer_entity_datetime; +----------------+----------------------+------+-----+---------------------+----------------+ | Field | Type | Null | Key | Default | Extra | +----------------+----------------------+------+-----+---------------------+----------------+ | value_id | int(11) | NO | PRI | NULL | auto_increment | | entity_type_id | smallint(8) unsigned | NO | MUL | 0 | | | attribute_id | smallint(5) unsigned | NO | MUL | 0 | | | entity_id | int(10) unsigned | NO | MUL | 0 | | | value | datetime | NO | | 0000-00-00 00:00:00 | | +----------------+----------------------+------+-----+---------------------+----------------+ 5 rows in set (0.01 sec) Thanks.

    Read the article

  • Java Memory Management

    - by Tara Singh
    I am designing a client-server chat application in Java. This is a secure application where the messages are exchanged using cryptographic algorithms. I have one server and it can support many clients. My problem is that when one client logs on the server it works fine, but when another user logs into the system, the server starts giving me bad padding exceptions for the encrypted text. I am not able to figure out the problem, according to my logic, when new connection request to server is made, the server creates a thread for listening to the client. Is it possible that once the instance of thread class is created, it does all the processing correctly for the first client, but not for the second client because the variables in server listener thread class already have some previous value, and thus the encrypted text is not decrypted properly? Please advise how I can make this process more robust so that the number of clients does not affect how well the server functions.

    Read the article

  • Super class variables not printing through sub class

    - by Abhishek Singh
    Can u tell me why this code is not displaying any result on the console. class employee { protected String name; protected double salary; protected String dob; public employee(String name, double salary, String dob) { this.name = name; this.salary = salary; this.dob = dob; } public employee(String name, double salary) { this.name = name; this.salary = salary; } } public class Manage extends employee { String dept1; public Manage(String name, double salary, String dob, String dept1) { super(name, salary, dob); this.dept1 = dept1; } public Manage(String name, double salary, String dept1) { super(name, salary); this.dept1 = dept1; } public static void main(String args[]) { employee e = new employee("Vikas", 122345); employee e2 = new employee("Vikas", 122345, "12-2-1991"); Manage m = (Manage) new Manage("Vikas", 122345, "Sales"); Manage m2 = new Manage("Vikas", 122345, "12-2-1991", "sales"); m.display(); m2.display(); } public void display() { System.out.println("Name " + name); System.out.println("Salary " + salary); System.out.println("Birth " + dob); System.out.println("Department " + dept1); } }

    Read the article

  • Change only Revision number in AssemblyInfo.cs with msbuild FileUpdate task

    - by Divya mohan Singh
    I need to change only the revision number of an AssemblyInfo.cs file. The version number is in the format Major.Minor.Build.Revision e.g. 1.4.6.0. Currently I change the version with the FileUpdate task (from the MSBuild Community Tasks Project) and the following regex: <FileUpdate Files="@(AssemblyResult)" Regex='(\[\s*assembly:\s*AssemblyVersion\(\s*"[^\.]+\.[^\.]+)\.([^\.]+)(\.)([^\.]+)("\)\s*\])' ReplacementText='[assembly: AssemblyVersion("$(AssemblyMajorNumber).$(AssemblyMinorNumber).$(AssemblyBuildNumber).$(Revision)")]' /> Now I need to update only the revision number and leave major,minor and build unchanged. So, is there any task to do this? Or can it be done with a regex? What would be the regular expression then?

    Read the article

  • How can we call an activity through service in android???

    - by Shalini Singh
    Hi! friends, i am a android developer,,, want to know is it possible to call an activity through background service in android like : import android.app.Service; import android.content.Intent; import android.content.SharedPreferences; import android.media.MediaPlayer; import android.os.Handler; import android.os.IBinder; import android.os.Message; public class background extends Service{ private int timer1; @Override public void onCreate() { // TODO Auto-generated method stub super.onCreate(); SharedPreferences preferences = getSharedPreferences("SaveTime", MODE_PRIVATE); timer1 = preferences.getInt("time", 0); startservice(); } @Override public IBinder onBind(Intent arg0) { // TODO Auto-generated method stub return null; } private void startservice() { Handler handler = new Handler(); handler.postDelayed(new Runnable(){ public void run() { mediaPlayerPlay.sendEmptyMessage(0); } }, timer1*60*1000); } private Handler mediaPlayerPlay = new Handler(){ @Override public void handleMessage(Message msg) { try { getApplication(); MediaPlayer mp = new MediaPlayer(); mp = MediaPlayer.create(background.this, R.raw.alarm); mp.start(); } catch(Exception e) { e.printStackTrace(); } super.handleMessage(msg); } }; /* * (non-Javadoc) * * @see android.app.Service#onDestroy() */ @Override public void onDestroy() { // TODO Auto-generated method stub super.onDestroy(); } } i want to call my activity......

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Issues while downloading document from Sharepoint using JAVA

    - by Deepak Singh Rawat
    I am trying to download a file from Sharepoint 2007 sp2 document library using GetItem method of the Copy webservice. I am facing the following issues : In the local instance ( Windows Vista ) I can save only 10.5 Kb of any file. The webservice is returning only 10.5 Kb of data for any file. On the production server, I am able to List the documents using some credentials but when I am trying to download a document using the same credentials I get a 401 : Unauthorized message. I can download the document using the Sharepoint website successfully.

    Read the article

  • check only one checkbox in gridview using jquery

    - by Gurbax Singh Bhangal
    i have a grid view in which i have placed the checkbox in itemtemplate i want only the one checkbox is selected from Gridview to select that perticular row so that i can use that id to edit or delete the row aspx page code is <asp:TemplateField Visible="false"> <ItemTemplate> <asp:Label ID="lblId" runat="server" Text='<%#Eval("id") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Select </HeaderTemplate> <ItemTemplate> <asp:CheckBox ID="chkSelect" runat="server"/> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Branch Name </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblBranch_Name" runat="server" Text='<%# Bind("Branch") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Address </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblAddress" runat="server" Text='<%# Eval("Address") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> City </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblCity" runat="server" Text='<%# Bind("City") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> </Columns> and i want when i click on the checkbox which is at first of each row only one check box is selected from all the rows thanks

    Read the article

  • calling background service from BroadcastReceiver....

    - by Shalini Singh
    Hi , i am trying to call a push notification background from BroadcastReceiver class.but my application is going to crash the code is given bellow public class AlarmReceiver extends BroadcastReceiver { Context ctx; static int count=1; @Override public void onReceive(Context context, Intent intent) { // TODO Auto-generated method stub //Toast.makeText(context, "working"+count, Toast.LENGTH_LONG).show(); count++; Log.e("broadcast***","receiver"); Intent myIntent=new Intent(context,NotifyService.class); myIntent.setFlags(Intent.FLAG_ACTIVITY_NEW_TASK); context.startActivity(myIntent); } } * manifest entry:- <intent-filter> <action android:name="android.intent.action.BOOT_COMPLETED"/> </intent-filter> </receiver> Error: 05-24 15:17:00.042: ERROR/AndroidRuntime(424): Caused by: android.content.ActivityNotFoundException: Unable to find explicit activity class {com.android.alarm/com.android.alarm.NotifyService}; have you declared this activity in your AndroidManifest.xml? Please help me....

    Read the article

  • Cordova - Scrolling with a fixed header and footer (ios)

    - by Samu Singh
    Using Cordova (phonegap) & bootstrap to make a mobile application, testing on IOS for now. Getting an issue with a header and footer bar that are fixed with scrollable content in the middle. When tapping to scroll, the header/footer bar moves down or up with the content but then snaps back to place as soon as the scrolling completes. If I use -webkit-overflow-scrolling: touch; it works as expected, but it makes it really awkward to scroll through the content, and if you scroll passed the end, it only scrolls the header or footer (with elastic overflow) until you stop for a second. here's my html for the header/footer bars: <div id="headerBar"> <div class="container-fluid" style="background-color: #1569C7"> <div class="row"> <div class="col-xs-3 text-left"> <button id="logoutButton" type="button" class="btn btn-default"> Log Out </button> <button type="button" class="btn btn-default" id="restoreQuestionFeedButton"> <span class="glyphicon glyphicon-chevron-left"></span> </button> </div> <div class="col-xs-6 text-center" style="height: 55px"> <strong id="usernameText"></strong> </div> <div class="col-xs-3 text-right"> <button id="oldCreatQuestionButton" type="button" class="btn btn-default"> <span class="glyphicon glyphicon-plus"></span> </button> </div> </div> </div> </div> <div id="footerBar"> <div class="container-fluid" style="padding: 0"> <div class="row text-center"> <button id="createQuestionButton" type="button" class="btn btn-default footerButton"> <span class="glyphicon glyphicon-plus"></span> <strong>Ask a new free question!</strong> </button> </div> </div> </div> And here is the related CSS: #headerBar { position: fixed; z-index: 100; top: 0; left: 0; width: 100%; background-color: #1569C7; } #footerBar { position: fixed; z-index: 100; bottom: 0; left: 0; width: 100%; background-color: #1569C7 !important; }

    Read the article

< Previous Page | 2 3 4 5 6 7 8 9 10 11  | Next Page >