Search Results

Search found 1395 results on 56 pages for 'vijay kumar singh'.

Page 6/56 | < Previous Page | 2 3 4 5 6 7 8 9 10 11 12 13  | Next Page >

  • Can this word search algorithm be made faster?

    - by Ashwin Singh
    Problem: Find a match of word S in text T Given: S and T are part of spoken and written English. Example: Match 'Math' in 'I love Mathematics' NOTE: Ignore CASES. My algorithm: STEP 1) Convert S, T to char[] STEP 2) for i=0, i < T.length , i++ STEP 3) for j=S.length-1, j>0 , j-- STEP 3 is the magic, instead of going about matching M,A,T,H, this matches M, H, T and finally A. This helps in eliminating a lot of possible partial matches. For example, if I go sequentially like M A as in Boyer Moore's method ... it can match Matter, Mass, Matchstick etc. using M _ _ H will bring down size of partial matches. STEP 4) if S[j]!=T[i] -> break; else if j==i -> PRINT MATCH

    Read the article

  • No windows whatsoever after compiz reset

    - by Shashank Singh
    Currently using 12.04. This time I was trying to use the application switcher, and it asked me to resolve a few conflicts most of which were not easy to comprehend. So after some yes and no dialogue boxes leading me nowhere, I thought a reset should set things fine. However, after preferences-reset to default, I can't see any window!! NONE whatsoever except the log out one when I press ctrl+alt+del All I can see is the wallpaper and the mouse pointer. I cant even see the terminal or anything when I press alt+f2. I am posting this when I switch to ubuntu 2d (I cant make out the difference between the two, but this just works for now almost the same way)

    Read the article

  • Synaptics drivers are not loading on Kubuntu 13.10 on Dell Vostro 2420

    - by Alok Singh Mahor
    I freshly installed Kubuntu 13.10, 32 bit version on newly purchased Dell Vostro 2420. everything is working fine except scrolling and multitouch features through touchpad. I am able to change position of cursor using touchpad and able to tap (single click and double click) but scrolling is not working I tried to find out solution by searching on google but could not find proper solution to load synaptics drivers. i am listing some details: Laptop: Dell Vostro 2420 Linux Kernel version and distribution: 3.11.0-12-generic, Kubuntu 13.10 output of xinput list is ? Virtual core pointer id=2 [master pointer (3)] ? ? Virtual core XTEST pointer id=4 [slave pointer (2)] ? ? PS/2 Generic Mouse id=12 [slave pointer (2)] ? Virtual core keyboard id=3 [master keyboard (2)] ? Virtual core XTEST keyboard id=5 [slave keyboard (3)] ? Power Button id=6 [slave keyboard (3)] ? Video Bus id=7 [slave keyboard (3)] ? Power Button id=8 [slave keyboard (3)] ? Sleep Button id=9 [slave keyboard (3)] ? Laptop_Integrated_Webcam_HD id=10 [slave keyboard (3)] ? AT Translated Set 2 keyboard id=11 [slave keyboard (3)] ? Dell WMI hotkeys id=13 [slave keyboard (3)] Output of synclient -l is Couldn't find synaptics properties. No synaptics driver loaded? output of lshw is at http://paste.ubuntu.com/6645687/ xserver log and dmesg dont have trace of synaptics kindly tell me how to troubleshoot this problem.

    Read the article

  • Thinking Local, Regional and Global

    - by Apeksha Singh-Oracle
    The FIFA World Cup tournament is the biggest single-sport competition: it’s watched by about 1 billion people around the world. Every four years each national team’s manager is challenged to pull together a group players who ply their trade across the globe. For example, of the 23 members of Brazil’s national team, only four actually play for Brazilian teams, and the rest play in England, France, Germany, Spain, Italy and Ukraine. Each country’s national league, each team and each coach has a unique style. Getting all these “localized” players to work together successfully as one unit is no easy feat. In addition to $35 million in prize money, much is at stake – not least national pride and global bragging rights until the next World Cup in four years time. Achieving economic integration in the ASEAN region by 2015 is a bit like trying to create the next World Cup champion by 2018. The team comprises Brunei Darussalam, Cambodia, Indonesia, Lao PDR, Malaysia, Myanmar, Philippines, Singapore, Thailand and Vietnam. All have different languages, currencies, cultures and customs, rules and regulations. But if they can pull together as one unit, the opportunity is not only great for business and the economy, but it’s also a source of regional pride. BCG expects by 2020 the number of firms headquartered in Asia with revenue exceeding $1 billion will double to more than 5,000. Their trade in the region and with the world is forecast to increase to 37% of an estimated $37 trillion of global commerce by 2020 from 30% in 2010. Banks offering transactional banking services to the emerging market place need to prepare to repond to customer needs across the spectrum – MSMEs, SMEs, corporates and multi national corporations. Customers want innovative, differentiated, value added products and services that provide: • Pan regional operational independence while enabling single source of truth at a regional level • Regional connectivity and Cash & Liquidity  optimization • Enabling Consistent experience for their customers  by offering standardized products & services across all ASEAN countries • Multi-channel & self service capabilities / access to real-time information on liquidity and cash flows • Convergence of cash management with supply chain and trade finance While enabling the above to meet customer demands, the need for a comprehensive and robust credit management solution for effective regional banking operations is a must to manage risk. According to BCG, Asia-Pacific wholesale transaction-banking revenues are expected to triple to $139 billion by 2022 from $46 billion in 2012. To take advantage of the trend, banks will have to manage and maximize their own growth opportunities, compete on a broader scale, manage the complexity within the region and increase efficiency. They’ll also have to choose the right operating model and regional IT platform to offer: • Account Services • Cash & Liquidity Management • Trade Services & Supply Chain Financing • Payments • Securities services • Credit and Lending • Treasury services The core platform should be able to balance global needs and local nuances. Certain functions need to be performed at a regional level, while others need to be performed on a country level. Financial reporting and regulatory compliance are a case in point. The ASEAN Economic Community is in the final lap of its preparations for the ultimate challenge: becoming a formidable team in the global league. Meanwhile, transaction banks are designing their own hat trick: implementing a world-class IT platform, positioning themselves to repond to customer needs and establishing a foundation for revenue generation for years to come. Anand Ramachandran Senior Director, Global Banking Solutions Practice Oracle Financial Services Global Business Unit

    Read the article

  • C# output of running command prompt

    - by Kaushal Singh
    In this following code whenever I send any command like dir or anything this function get stuck in while loop... I want the output of the command prompt each time I send it command to execute without closing the process after the execution of command. public void shell(String cmd) { ProcessStartInfo PSI = new ProcessStartInfo(); PSI.FileName = "c:\\windows\\system32\\cmd.exe"; PSI.RedirectStandardInput = true; PSI.RedirectStandardOutput = true; PSI.RedirectStandardError = true; PSI.UseShellExecute = false; Process p = Process.Start(PSI); StreamWriter CSW = p.StandardInput; StreamReader CSR = p.StandardOutput; CSW.WriteLine(cmd); CSW.Flush(); while(!(CSR.EndOfStream)) { Console.WriteLine(CSR.ReadLine()); } CSR.Close(); }

    Read the article

  • For an ORM supporting data validation, should constraints be enforced in the database as well?

    - by Ramnique Singh
    I have always applied constraints at the database level in addition to my (ActiveRecord) models. But I've been wondering if this is really required? A little background I recently had to unit test a basic automated timestamp generation method for a model. Normally, the test would create an instance of the model and save it without validation. But there are other required fields that aren't nullable at the in the table definition, meaning I cant save the instance even if I skip the ActiveRecord validation. So I'm thinking if I should remove such constraints from the db itself, and let the ORM handle them? Possible advantages if I skip constraints in db, imo - Can modify a validation rule in the model, without having to migrate the database. Can skip validation in testing. Possible disadvantage? If its possible that ORM validation fails or is bypassed, howsoever, the database does not check for constraints. What do you think? EDIT In this case, I'm using the Yii Framework, which generates the model from the database, hence database rules are generated also (though I could always write them post-generation myself too).

    Read the article

  • problem with .wax format

    - by Pranjal Singh
    I installed Ubuntu 10.4 onto a pc for an elderly woman. It was supposed to solve the problems she was having with windows, ie: she would constantly remove things, or try to fix problems herself. So I figured that Linux would solve those issues. However, what I didn't take into account was that she watches " http://www.shepherdschapel.com/broadband.htm " and when using Ubuntu, I can't seem to find a media player to make the files work. I am out of ideas. I tried kplayer, and it worked (sort of). The file that is downloaded from the site when you click the windows media player site one link is, .wax format. Which is an instruction file for windows media player. Is there anything I can do to make these videos work?

    Read the article

  • Ubuntu 13.04 is showing some error while opening my computer

    - by Singh
    Few months before when I was using Ubuntu 12.04 then I found some errors while starting my computer. Due to this problem I had given my CPU to a shop to repair it I don't know what he has done to my CPU but I only know that finally I got my CPU with Ubuntu 13.04. The technician was unable to make any partition and I also think that he had installed 13.04 over 12.04 and so now my computer is showing some error when I'm starting my computer the error is as follows: error: attempt to read or write outside of the disk 'hd0'. grub rescue _ Before showing this error, few times my computer was working very slow. So kindly someone tell me that is there any way by which I can start my computer. Please also tell me that what things I have to keep in mind while using Ubuntu so that in future I find no difficulties(errors) while using Ubuntu.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • SQLAuthority News – TechEd India – April 12-14, 2010 Bangalore – An Unforgettable Experience – An Op

    - by pinaldave
    TechEd India was one of the largest Technology events in India led by Microsoft. This event was attended by more than 3,000 technology enthusiasts, making it one of the most well-organized events of the year. Though I attempted to attend almost all the technology events here, I have not seen any bigger or better event in Indian subcontinents other than this. There are 21 Technical Tracks at Tech·Ed India 2010 that span more than 745 learning opportunities. I was fortunate enough to be a part of this whole event as a speaker and a delegate, as well. TechEd India Speaker Badge and A Token of Lifetime Hotel Selection I presented three different sessions at TechEd India and was also a part of panel discussion. (The details of the sessions are given at the end of this blog post.) Due to extensive traveling, I stay away from my family occasionally. For this reason, I took my wife – Nupur and daughter Shaivi (8 months old) to the event along with me. We stayed at the same hotel where the event was organized so as to maximize my time bonding with my family and to have more time in networking with technology community, at the same time. The hotel Lalit Ashok is the largest and most luxurious venue one can find in Bangalore, located in the middle of the city. The cost of the hotel was a bit pricey, but looking at all the advantages, I had decided to ask for a booking there. Hotel Lalit Ashok Nupur Dave and Shaivi Dave Arrival Day – DAY 0 – April 11, 2010 I reached the event a day earlier, and that was one wise decision for I was able to relax a bit and go over my presentation for the next day’s course. I am a kind of person who likes to get everything ready ahead of time. I was also able to enjoy a pleasant evening with several Microsoft employees and my family friends. I even checked out the location where I would be doing presentations the next day. I was fortunate enough to meet Bijoy Singhal from Microsoft who helped me out with a few of the logistics issues that occured the day before. I was not aware of the fact that the very next day he was going to be “The Man” of the TechEd 2010 event. Vinod Kumar from Microsoft was really very kind as he talked to me regarding my subsequent session. He gave me some suggestions which were really helpful that I was able to incorporate them during my presentation. Finally, I was able to meet Abhishek Kant from Microsoft; his valuable suggestions and unlimited passion have inspired many people like me to work with the Community. Pradipta from Microsoft was also around, being extremely busy with logistics; however, in those busy times, he did find some good spare time to have a chat with me and the other Community leaders. I also met Harish Ranganathan and Sachin Rathi, both from Microsoft. It was so interesting to listen to both of them talking about SharePoint. I just have no words to express my overwhelmed spirit because of all these passionate young guys - Pradipta,Vinod, Bijoy, Harish, Sachin and Ahishek (of course!). Map of TechEd India 2010 Event Day 1 – April 12, 2010 From morning until night time, today was truly a very busy day for me. I had two presentations and one panel discussion for the day. Needless to say, I had a few meetings to attend as well. The day started with a keynote from S. Somaseger where he announced the launch of Visual Studio 2010. The keynote area was really eye-catching because of the very large, bigger-than- life uniform screen. This was truly one to show. The title music of the keynote was very interesting and it featured Bijoy Singhal as the model. It was interesting to talk to him afterwards, when we laughed at jokes together about his modeling assignment. TechEd India Keynote Opening Featuring Bijoy TechEd India 2010 Keynote – S. Somasegar Time: 11:15pm – 11:45pm Session 1: True Lies of SQL Server – SQL Myth Buster Following the excellent keynote, I had my very first session on the subject of SQL Server Myth Buster. At first, I was a bit nervous as right after the keynote, for this was my very first session and during my presentation I saw lots of Microsoft Product Team members. Well, it really went well and I had a really good discussion with attendees of the session. I felt that a well begin was half-done and my confidence was regained. Right after the session, I met a few of my Community friends and had meaningful discussions with them on many subjects. The abstract of the session is as follows: In this 30-minute demo session, I am going to briefly demonstrate few SQL Server Myths and their resolutions as I back them up with some demo. This demo presentation is a must-attend for all developers and administrators who would come to the event. This is going to be a very quick yet fun session. Pinal Presenting session at TechEd India 2010 Time: 1:00 PM – 2:00 PM Lunch with Somasegar After the session I went to see my daughter, and then I headed right away to the lunch with S. Somasegar – the keynote speaker and senior vice president of the Developer Division at Microsoft. I really thank to Abhishek who made it possible for us. Because of his efforts, all the MVPs had the opportunity to meet such a legendary person and had to talk with them on Microsoft Technology. Though Somasegar is currently holding such a high position in Microsoft, he is very polite and a real gentleman, and how I wish that everybody in industry is like him. Believe me, if you spread love and kindness, then that is what you will receive back. As soon as lunch time was over, I ran to the session hall as my second presentation was about to start. Time: 2:30pm – 3:30pm Session 2: Master Data Services in Microsoft SQL Server 2008 R2 Business Intelligence is a subject which was widely talked about at TechEd. Everybody was interested in this subject, and I did not excuse myself from this great concept as well. I consider myself fortunate as I was presenting on the subject of Master Data Services at TechEd. When I had initially learned this subject, I had a bit of confusion about the usage of this tool. Later on, I decided that I would tackle about how we all developers and DBAs are not able to understand something so simple such as this, and even worst, creating confusion about the technology. During system designing, it is very important to have a reference material or master lookup tables. Well, I talked about the same subject and presented the session keeping that as my center talk. The session went very well and I received lots of interesting questions. I got many compliments for talking about this subject on the real-life scenario. I really thank Rushabh Mehta (CEO, Solid Quality Mentors India) for his supportive suggestions that helped me prepare the slide deck, as well as the subject. Pinal Presenting session at TechEd India 2010 The abstract of the session is as follows: SQL Server Master Data Services will ship with SQL Server 2008 R2 and will improve Microsoft’s platform appeal. This session provides an in-depth demonstration of MDS features and highlights important usage scenarios. Master Data Services enables consistent decision-making process by allowing you to create, manage and propagate changes from a single master view of your business entities. Also, MDS – Master Data-hub which is a vital component, helps ensure the consistency of reporting across systems and deliver faster and more accurate results across the enterprise. We will talk about establishing the basis for a centralized approach to defining, deploying, and managing master data in the enterprise. Pinal Presenting session at TechEd India 2010 The day was still not over for me. I had ran into several friends but we were not able keep our enthusiasm under control about all the rumors saying that SQL Server 2008 R2 was about to be launched tomorrow in the keynote. I then ran to my third and final technical event for the day- a panel discussion with the top technologies of India. Time: 5:00pm – 6:00pm Panel Discussion: Harness the power of Web – SEO and Technical Blogging As I have delivered two technical sessions by this time, I was a bit tired but  not less enthusiastic when I had to talk about Blog and Technology. We discussed many different topics there. I told them that the most important aspect for any blog is its content. We discussed in depth the issues with plagiarism and how to avoid it. Another topic of discussion was how we technology bloggers can create awareness in the Community about what the right kind of blogging is and what morally and technically wrong acts are. A couple of questions were raised about what type of liberty a person can have in terms of writing blogs. Well, it was generically agreed that a blog is mainly a representation of our ideas and thoughts; it should not be governed by external entities. As long as one is writing what they really want to say, but not providing incorrect information or not practicing plagiarism, a blogger should be allowed to express himself. This panel discussion was supposed to be over in an hour, but the interest of the participants was remarkable and so it was extended for 30 minutes more. Finally, we decided to bring to a close the discussion and agreed that we will continue the topic next year. TechEd India Panel Discussion on Web, Technology and SEO Surprisingly, the day was just beginning after doing all of these. By this time, I have almost met all the MVP who arrived at the event, as well as many Microsoft employees. There were lots of Community folks present, too. I decided that I would go to meet several friends from the Community and continue to communicate with me on SQLAuthority.com. I also met Abhishek Baxi and had a good talk with him regarding Win Mobile and Twitter. He also took a very quick video of me wherein I spoke in my mother’s tongue, Gujarati. It was funny that I talked in Gujarati almost all the day, but when I was talking in the interview I could not find the right Gujarati words to speak. I think we all think in English when we think about Technology, so as to address universality. After meeting them, I headed towards the Speakers’ Dinner. Time: 8:00 PM – onwards Speakers Dinner The Speakers’ dinner was indeed a wonderful opportunity for all the speakers to get together and relax. We talked so many different things, from XBOX to Hindi Movies, and from SQL to Samosas. I just could not express how much fun I had. After a long evening, when I returned tmy room and met Shaivi, I just felt instantly relaxed. Kids are really gifts from God. Today was a really long but exciting day. So many things happened in just one day: Visual Studio Lanch, lunch with Somasegar, 2 technical sessions, 1 panel discussion, community leaders meeting, speakers dinner and, last but not leas,t playing with my child! A perfect day! Day 2 – April 13, 2010 Today started with a bang with the excellent keynote by Kamal Hathi who launched SQL Server 2008 R2 in India and demonstrated the power of PowerPivot to all of us. 101 Million Rows in Excel brought lots of applause from the audience. Kamal Hathi Presenting Keynote at TechEd India 2010 The day was a bit easier one for me. I had no sessions today and no events planned. I had a few meetings planned for the second day of the event. I sat in the speaker’s lounge for half a day and met many people there. I attended nearly 9 different meetings today. The subjects of the meetings were very different. Here is a list of the topics of the Community-related meetings: SQL PASS and its involvement in India and subcontinents How to start community blogging Forums and developing aptitude towards technology Ahmedabad/Gandhinagar User Groups and their developments SharePoint and SQL Business Meeting – a client meeting Business Meeting – a potential performance tuning project Business Meeting – Solid Quality Mentors (SolidQ) And family friends Pinal Dave at TechEd India The day passed by so quickly during this meeting. In the evening, I headed to Partners Expo with friends and checked out few of the booths. I really wanted to talk about some of the products, but due to the freebies there was so much crowd that I finally decided to just take the contact details of the partner. I will now start sending them with my queries and, hopefully, I will have my questions answered. Nupur and Shaivi had also one meeting to attend; it was with our family friend Vijay Raj. Vijay is also a person who loves Technology and loves it more than anybody. I see him growing and learning every day, but still remaining as a ‘human’. I believe that if someone acquires as much knowledge as him, that person will become either a computer or cyborg. Here, Vijay is still a kind gentleman and is able to stay as our close family friend. Shaivi was really happy to play with Uncle Vijay. Pinal Dave and Vijay Raj Renuka Prasad, a Microsoft MVP, impressed me with his passion and knowledge of SQL. Every time he gives me credit for his success, I believe that he is very humble. He has way more certifications than me and has worked many more years with SQL compared to me. He is an excellent photographer as well. Most of the photos in this blog post have been taken by him. I told him if ever he wants to do a part time job, he can do the photography very well. Pinal Dave and Renuka Prasad I also met L Srividya from Microsoft, whom I was looking forward to meet. She is a bundle of knowledge that everyone would surely learn a lot from her. I was able to get a few minutes from her and well, I felt confident. She enlightened me with SQL Server BI concepts, domain management and SQL Server security and few other interesting details. I also had a wonderful time talking about SharePoint with fellow Solid Quality Mentor Joy Rathnayake. He is very passionate about SharePoint but when you talk .NET and SQL with him, he is still overwhelmingly knowledgeable. In fact, while talking to him, I figured out that the recent training he delivered was on SQL Server 2008 R2. I told him a joke that it hurts my ego as he is more popular now in SQL training and consulting than me. I am sure all of you agree that working with good people is a gift from God. I am fortunate enough to work with the best of the best Industry experts. It was a great pleasure to hang out with my Community friends – Ahswin Kini, HimaBindu Vejella, Vasudev G, Suprotim Agrawal, Dhananjay, Vikram Pendse, Mahesh Dhola, Mahesh Mitkari,  Manu Zacharia, Shobhan, Hardik Shah, Ashish Mohta, Manan, Subodh Sohani and Sanjay Shetty (of course!) .  (Please let me know if I have met you at the event and forgot your name to list here). Time: 8:00 PM – onwards Community Leaders Dinner After lots of meetings, I headed towards the Community Leaders dinner meeting and met almost all the folks I met in morning. The discussion was almost the same but the real good thing was that we were enjoying it. The food was really good. Nupur was invited in the event, but Shaivi could not come. When Nupur tried to enter the event, she was stopped as Shaivi did not have the pass to enter the dinner. Nupur expressed that Shaivi is only 8 months old and does not eat outside food as well and could not stay by herself at this age, but the door keeper did not agree and asked that without the entry details Shaivi could not go in, but Nupur could. Nupur called me on phone and asked me to help her out. By the time, I was outside; the organizer of the event reached to the door and happily approved Shaivi to join the party. Once in the party, Shaivi had lots of fun meeting so many people. Shaivi Dave and Abhishek Kant Dean Guida (Infragistics President and CEO) and Pinal Dave (SQLAuthority.com) Day 3 – April 14, 2010 Though, it was last day, I was very much excited today as I was about to present my very favorite session. Query Optimization and Performance Tuning is my domain expertise and I make my leaving by consulting and training the same. Today’s session was on the same subject and as an additional twist, another subject about Spatial Database was presented. I was always intrigued with Spatial Database and I have enjoyed learning about it; however, I have never thought about Spatial Indexing before it was decided that I will do this session. I really thank Solid Quality Mentor Dr. Greg Low for his assistance in helping me prepare the slide deck and also review the content. Furthermore, today was really what I call my ‘learning day’ . So far I had not attended any session in TechEd and I felt a bit down for that. Everybody spends their valuable time & money to learn something new and exciting in TechEd and I had not attended a single session at the moment thinking that it was already last day of the event. I did have a plan for the day and I attended two technical sessions before my session of spatial database. I attended 2 sessions of Vinod Kumar. Vinod is a natural storyteller and there was no doubt that his sessions would be jam-packed. People attended his sessions simply because Vinod is syhe speaker. He did not have a single time disappointed audience; he is truly a good speaker. He knows his stuff very well. I personally do not think that in India he can be compared to anyone for SQL. Time: 12:30pm-1:30pm SQL Server Query Optimization, Execution and Debugging Query Performance I really had a fun time attending this session. Vinod made this session very interactive. The entire audience really got into the presentation and started participating in the event. Vinod was presenting a small problem with Query Tuning, which any developer would have encountered and solved with their help in such a fashion that a developer feels he or she have already resolved it. In one question, I was the only one who was ready to answer and Vinod told me in a light tone that I am now allowed to answer it! The audience really found it very amusing. There was a huge crowd around Vinod after the session. Vinod – A master storyteller! Time: 3:45pm-4:45pm Data Recovery / consistency with CheckDB This session was much heavier than the earlier one, and I must say this is my most favorite session I EVER attended in India. In this TechEd I have only attended two sessions, but in my career, I have attended numerous technical sessions not only in India, but all over the world. This session had taken my breath away. One by one, Vinod took the different databases, and started to corrupt them in different ways. Each database has some unique ways to get corrupted. Once that was done, Vinod started to show the DBCC CEHCKDB and demonstrated how it can solve your problem. He finally fixed all the databases with this single tool. I do have a good knowledge of this subject, but let me honestly admit that I have learned a lot from this session. I enjoyed and cheered during this session along with other attendees. I had total satisfaction that, just like everyone, I took advantage of the event and learned something. I am now TECHnically EDucated. Pinal Dave and Vinod Kumar After two very interactive and informative SQL Sessions from Vinod Kumar, the next turn me presenting on Spatial Database and Indexing. I got once again nervous but Vinod told me to stay natural and do my presentation. Well, once I got a huge stage with a total of four projectors and a large crowd, I felt better. Time: 5:00pm-6:00pm Session 3: Developing with SQL Server Spatial and Deep Dive into Spatial Indexing Pinal Presenting session at TechEd India 2010 Pinal Presenting session at TechEd India 2010 I kicked off this session with Michael J Swart‘s beautiful spatial image. This session was the last one for the day but, to my surprise, I had more than 200+ attendees. Slowly, the rain was starting outside and I was worried that the hall would not be full; despite this, there was not a single seat available in the first five minutes of the session. Thanks to all of you for attending my presentation. I had demonstrated the map of world (and India) and quickly explained what  Geographic and Geometry data types in Spatial Database are. This session had interesting story of Indexing and Comparison, as well as how different traditional indexes are from spatial indexing. Pinal Presenting session at TechEd India 2010 Due to the heavy rain during this event, the power went off for about 22 minutes (just an accident – nobodies fault). During these minutes, there were no audio, no video and no light. I continued to address the mass of 200+ people without any audio device and PowerPoint. I must thank the audience because not a single person left from the session. They all stayed in their place, some moved closure to listen to me properly. I noticed that the curiosity and eagerness to learn new things was at the peak even though it was the very last session of the TechEd. Everybody wanted get the maximum knowledge out of this whole event. I was touched by the support from audience. They listened and participated in my session even without any kinds of technology (no ppt, no mike, no AC, nothing). During these 22 minutes, I had completed my theory verbally. Pinal Presenting session at TechEd India 2010 After a while, we got the projector back online and we continued with some exciting demos. Many thanks to Microsoft people who worked energetically in background to get the backup power for project up. I had a very interesting demo wherein I overlaid Bangalore and Hyderabad on the India Map and find their aerial distance between them. After finding the aerial distance, we browsed online and found that SQL Server estimates the exact aerial distance between these two cities, as compared to the factual distance. There was a huge applause from the crowd on the subject that SQL Server takes into the count of the curvature of the earth and finds the precise distances based on details. During the process of finding the distance, I demonstrated a few examples of the indexes where I expressed how one can use those indexes to find these distances and how they can improve the performance of similar query. I also demonstrated few examples wherein we were able to see in which data type the Index is most useful. We finished the demos with a few more internal stuff. Pinal Presenting session at TechEd India 2010 Despite all issues, I was mostly satisfied with my presentation. I think it was the best session I have ever presented at any conference. There was no help from Technology for a while, but I still got lots of appreciation at the end. When we ended the session, the applause from the audience was so loud that for a moment, the rain was not audible. I was truly moved by the dedication of the Technology enthusiasts. Pinal Dave After Presenting session at TechEd India 2010 The abstract of the session is as follows: The Microsoft SQL Server 2008 delivers new spatial data types that enable you to consume, use, and extend location-based data through spatial-enabled applications. Attend this session to learn how to use spatial functionality in next version of SQL Server to build and optimize spatial queries. This session outlines the new geography data type to store geodetic spatial data and perform operations on it, use the new geometry data type to store planar spatial data and perform operations on it, take advantage of new spatial indexes for high performance queries, use the new spatial results tab to quickly and easily view spatial query results directly from within Management Studio, extend spatial data capabilities by building or integrating location-enabled applications through support for spatial standards and specifications and much more. Time: 8:00 PM – onwards Dinner by Sponsors After the lively session during the day, there was another dinner party courtesy of one of the sponsors of TechEd. All the MVPs and several Community leaders were present at the dinner. I would like to express my gratitude to Abhishek Kant for organizing this wonderful event for us. It was a blast and really relaxing in all angles. We all stayed there for a long time and talked about our sweet and unforgettable memories of the event. Pinal Dave and Bijoy Singhal It was really one wonderful event. After writing this much, I say that I have no words to express about how much I enjoyed TechEd. However, it is true that I shared with you only 1% of the total activities I have done at the event. There were so many people I have met, yet were not mentioned here although I wanted to write their names here, too . Anyway, I have learned so many things and up until now, I am not able to get over all the fun I had in this event. Pinal Dave at TechEd India 2010 The Next Days – April 15, 2010 – till today I am still not able to get my mind out of the whole experience I had at TechEd India 2010. It was like a whole Microsoft Family working together to celebrate a happy occasion. TechEd India – Truly An Unforgettable Experience! Reference : Pinal Dave (http://blog.SQLAuthority.com) Filed under: About Me, MVP, Pinal Dave, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, SQLAuthority Author Visit, SQLAuthority News, SQLServer, T SQL, Technology Tagged: TechEd, TechEdIn

    Read the article

  • SQLAuthority News – TechEd India – April 12-14, 2010 Bangalore – An Unforgettable Experience – An Op

    - by pinaldave
    TechEd India was one of the largest Technology events in India led by Microsoft. This event was attended by more than 3,000 technology enthusiasts, making it one of the most well-organized events of the year. Though I attempted to attend almost all the technology events here, I have not seen any bigger or better event in Indian subcontinents other than this. There are 21 Technical Tracks at Tech·Ed India 2010 that span more than 745 learning opportunities. I was fortunate enough to be a part of this whole event as a speaker and a delegate, as well. TechEd India Speaker Badge and A Token of Lifetime Hotel Selection I presented three different sessions at TechEd India and was also a part of panel discussion. (The details of the sessions are given at the end of this blog post.) Due to extensive traveling, I stay away from my family occasionally. For this reason, I took my wife – Nupur and daughter Shaivi (8 months old) to the event along with me. We stayed at the same hotel where the event was organized so as to maximize my time bonding with my family and to have more time in networking with technology community, at the same time. The hotel Lalit Ashok is the largest and most luxurious venue one can find in Bangalore, located in the middle of the city. The cost of the hotel was a bit pricey, but looking at all the advantages, I had decided to ask for a booking there. Hotel Lalit Ashok Nupur Dave and Shaivi Dave Arrival Day – DAY 0 – April 11, 2010 I reached the event a day earlier, and that was one wise decision for I was able to relax a bit and go over my presentation for the next day’s course. I am a kind of person who likes to get everything ready ahead of time. I was also able to enjoy a pleasant evening with several Microsoft employees and my family friends. I even checked out the location where I would be doing presentations the next day. I was fortunate enough to meet Bijoy Singhal from Microsoft who helped me out with a few of the logistics issues that occured the day before. I was not aware of the fact that the very next day he was going to be “The Man” of the TechEd 2010 event. Vinod Kumar from Microsoft was really very kind as he talked to me regarding my subsequent session. He gave me some suggestions which were really helpful that I was able to incorporate them during my presentation. Finally, I was able to meet Abhishek Kant from Microsoft; his valuable suggestions and unlimited passion have inspired many people like me to work with the Community. Pradipta from Microsoft was also around, being extremely busy with logistics; however, in those busy times, he did find some good spare time to have a chat with me and the other Community leaders. I also met Harish Ranganathan and Sachin Rathi, both from Microsoft. It was so interesting to listen to both of them talking about SharePoint. I just have no words to express my overwhelmed spirit because of all these passionate young guys - Pradipta,Vinod, Bijoy, Harish, Sachin and Ahishek (of course!). Map of TechEd India 2010 Event Day 1 – April 12, 2010 From morning until night time, today was truly a very busy day for me. I had two presentations and one panel discussion for the day. Needless to say, I had a few meetings to attend as well. The day started with a keynote from S. Somaseger where he announced the launch of Visual Studio 2010. The keynote area was really eye-catching because of the very large, bigger-than- life uniform screen. This was truly one to show. The title music of the keynote was very interesting and it featured Bijoy Singhal as the model. It was interesting to talk to him afterwards, when we laughed at jokes together about his modeling assignment. TechEd India Keynote Opening Featuring Bijoy TechEd India 2010 Keynote – S. Somasegar Time: 11:15pm – 11:45pm Session 1: True Lies of SQL Server – SQL Myth Buster Following the excellent keynote, I had my very first session on the subject of SQL Server Myth Buster. At first, I was a bit nervous as right after the keynote, for this was my very first session and during my presentation I saw lots of Microsoft Product Team members. Well, it really went well and I had a really good discussion with attendees of the session. I felt that a well begin was half-done and my confidence was regained. Right after the session, I met a few of my Community friends and had meaningful discussions with them on many subjects. The abstract of the session is as follows: In this 30-minute demo session, I am going to briefly demonstrate few SQL Server Myths and their resolutions as I back them up with some demo. This demo presentation is a must-attend for all developers and administrators who would come to the event. This is going to be a very quick yet fun session. Pinal Presenting session at TechEd India 2010 Time: 1:00 PM – 2:00 PM Lunch with Somasegar After the session I went to see my daughter, and then I headed right away to the lunch with S. Somasegar – the keynote speaker and senior vice president of the Developer Division at Microsoft. I really thank to Abhishek who made it possible for us. Because of his efforts, all the MVPs had the opportunity to meet such a legendary person and had to talk with them on Microsoft Technology. Though Somasegar is currently holding such a high position in Microsoft, he is very polite and a real gentleman, and how I wish that everybody in industry is like him. Believe me, if you spread love and kindness, then that is what you will receive back. As soon as lunch time was over, I ran to the session hall as my second presentation was about to start. Time: 2:30pm – 3:30pm Session 2: Master Data Services in Microsoft SQL Server 2008 R2 Business Intelligence is a subject which was widely talked about at TechEd. Everybody was interested in this subject, and I did not excuse myself from this great concept as well. I consider myself fortunate as I was presenting on the subject of Master Data Services at TechEd. When I had initially learned this subject, I had a bit of confusion about the usage of this tool. Later on, I decided that I would tackle about how we all developers and DBAs are not able to understand something so simple such as this, and even worst, creating confusion about the technology. During system designing, it is very important to have a reference material or master lookup tables. Well, I talked about the same subject and presented the session keeping that as my center talk. The session went very well and I received lots of interesting questions. I got many compliments for talking about this subject on the real-life scenario. I really thank Rushabh Mehta (CEO, Solid Quality Mentors India) for his supportive suggestions that helped me prepare the slide deck, as well as the subject. Pinal Presenting session at TechEd India 2010 The abstract of the session is as follows: SQL Server Master Data Services will ship with SQL Server 2008 R2 and will improve Microsoft’s platform appeal. This session provides an in-depth demonstration of MDS features and highlights important usage scenarios. Master Data Services enables consistent decision-making process by allowing you to create, manage and propagate changes from a single master view of your business entities. Also, MDS – Master Data-hub which is a vital component, helps ensure the consistency of reporting across systems and deliver faster and more accurate results across the enterprise. We will talk about establishing the basis for a centralized approach to defining, deploying, and managing master data in the enterprise. Pinal Presenting session at TechEd India 2010 The day was still not over for me. I had ran into several friends but we were not able keep our enthusiasm under control about all the rumors saying that SQL Server 2008 R2 was about to be launched tomorrow in the keynote. I then ran to my third and final technical event for the day- a panel discussion with the top technologies of India. Time: 5:00pm – 6:00pm Panel Discussion: Harness the power of Web – SEO and Technical Blogging As I have delivered two technical sessions by this time, I was a bit tired but  not less enthusiastic when I had to talk about Blog and Technology. We discussed many different topics there. I told them that the most important aspect for any blog is its content. We discussed in depth the issues with plagiarism and how to avoid it. Another topic of discussion was how we technology bloggers can create awareness in the Community about what the right kind of blogging is and what morally and technically wrong acts are. A couple of questions were raised about what type of liberty a person can have in terms of writing blogs. Well, it was generically agreed that a blog is mainly a representation of our ideas and thoughts; it should not be governed by external entities. As long as one is writing what they really want to say, but not providing incorrect information or not practicing plagiarism, a blogger should be allowed to express himself. This panel discussion was supposed to be over in an hour, but the interest of the participants was remarkable and so it was extended for 30 minutes more. Finally, we decided to bring to a close the discussion and agreed that we will continue the topic next year. TechEd India Panel Discussion on Web, Technology and SEO Surprisingly, the day was just beginning after doing all of these. By this time, I have almost met all the MVP who arrived at the event, as well as many Microsoft employees. There were lots of Community folks present, too. I decided that I would go to meet several friends from the Community and continue to communicate with me on SQLAuthority.com. I also met Abhishek Baxi and had a good talk with him regarding Win Mobile and Twitter. He also took a very quick video of me wherein I spoke in my mother’s tongue, Gujarati. It was funny that I talked in Gujarati almost all the day, but when I was talking in the interview I could not find the right Gujarati words to speak. I think we all think in English when we think about Technology, so as to address universality. After meeting them, I headed towards the Speakers’ Dinner. Time: 8:00 PM – onwards Speakers Dinner The Speakers’ dinner was indeed a wonderful opportunity for all the speakers to get together and relax. We talked so many different things, from XBOX to Hindi Movies, and from SQL to Samosas. I just could not express how much fun I had. After a long evening, when I returned tmy room and met Shaivi, I just felt instantly relaxed. Kids are really gifts from God. Today was a really long but exciting day. So many things happened in just one day: Visual Studio Lanch, lunch with Somasegar, 2 technical sessions, 1 panel discussion, community leaders meeting, speakers dinner and, last but not leas,t playing with my child! A perfect day! Day 2 – April 13, 2010 Today started with a bang with the excellent keynote by Kamal Hathi who launched SQL Server 2008 R2 in India and demonstrated the power of PowerPivot to all of us. 101 Million Rows in Excel brought lots of applause from the audience. Kamal Hathi Presenting Keynote at TechEd India 2010 The day was a bit easier one for me. I had no sessions today and no events planned. I had a few meetings planned for the second day of the event. I sat in the speaker’s lounge for half a day and met many people there. I attended nearly 9 different meetings today. The subjects of the meetings were very different. Here is a list of the topics of the Community-related meetings: SQL PASS and its involvement in India and subcontinents How to start community blogging Forums and developing aptitude towards technology Ahmedabad/Gandhinagar User Groups and their developments SharePoint and SQL Business Meeting – a client meeting Business Meeting – a potential performance tuning project Business Meeting – Solid Quality Mentors (SolidQ) And family friends Pinal Dave at TechEd India The day passed by so quickly during this meeting. In the evening, I headed to Partners Expo with friends and checked out few of the booths. I really wanted to talk about some of the products, but due to the freebies there was so much crowd that I finally decided to just take the contact details of the partner. I will now start sending them with my queries and, hopefully, I will have my questions answered. Nupur and Shaivi had also one meeting to attend; it was with our family friend Vijay Raj. Vijay is also a person who loves Technology and loves it more than anybody. I see him growing and learning every day, but still remaining as a ‘human’. I believe that if someone acquires as much knowledge as him, that person will become either a computer or cyborg. Here, Vijay is still a kind gentleman and is able to stay as our close family friend. Shaivi was really happy to play with Uncle Vijay. Pinal Dave and Vijay Raj Renuka Prasad, a Microsoft MVP, impressed me with his passion and knowledge of SQL. Every time he gives me credit for his success, I believe that he is very humble. He has way more certifications than me and has worked many more years with SQL compared to me. He is an excellent photographer as well. Most of the photos in this blog post have been taken by him. I told him if ever he wants to do a part time job, he can do the photography very well. Pinal Dave and Renuka Prasad I also met L Srividya from Microsoft, whom I was looking forward to meet. She is a bundle of knowledge that everyone would surely learn a lot from her. I was able to get a few minutes from her and well, I felt confident. She enlightened me with SQL Server BI concepts, domain management and SQL Server security and few other interesting details. I also had a wonderful time talking about SharePoint with fellow Solid Quality Mentor Joy Rathnayake. He is very passionate about SharePoint but when you talk .NET and SQL with him, he is still overwhelmingly knowledgeable. In fact, while talking to him, I figured out that the recent training he delivered was on SQL Server 2008 R2. I told him a joke that it hurts my ego as he is more popular now in SQL training and consulting than me. I am sure all of you agree that working with good people is a gift from God. I am fortunate enough to work with the best of the best Industry experts. It was a great pleasure to hang out with my Community friends – Ahswin Kini, HimaBindu Vejella, Vasudev G, Suprotim Agrawal, Dhananjay, Vikram Pendse, Mahesh Dhola, Mahesh Mitkari,  Manu Zacharia, Shobhan, Hardik Shah, Ashish Mohta, Manan, Subodh Sohani and Sanjay Shetty (of course!) .  (Please let me know if I have met you at the event and forgot your name to list here). Time: 8:00 PM – onwards Community Leaders Dinner After lots of meetings, I headed towards the Community Leaders dinner meeting and met almost all the folks I met in morning. The discussion was almost the same but the real good thing was that we were enjoying it. The food was really good. Nupur was invited in the event, but Shaivi could not come. When Nupur tried to enter the event, she was stopped as Shaivi did not have the pass to enter the dinner. Nupur expressed that Shaivi is only 8 months old and does not eat outside food as well and could not stay by herself at this age, but the door keeper did not agree and asked that without the entry details Shaivi could not go in, but Nupur could. Nupur called me on phone and asked me to help her out. By the time, I was outside; the organizer of the event reached to the door and happily approved Shaivi to join the party. Once in the party, Shaivi had lots of fun meeting so many people. Shaivi Dave and Abhishek Kant Dean Guida (Infragistics President and CEO) and Pinal Dave (SQLAuthority.com) Day 3 – April 14, 2010 Though, it was last day, I was very much excited today as I was about to present my very favorite session. Query Optimization and Performance Tuning is my domain expertise and I make my leaving by consulting and training the same. Today’s session was on the same subject and as an additional twist, another subject about Spatial Database was presented. I was always intrigued with Spatial Database and I have enjoyed learning about it; however, I have never thought about Spatial Indexing before it was decided that I will do this session. I really thank Solid Quality Mentor Dr. Greg Low for his assistance in helping me prepare the slide deck and also review the content. Furthermore, today was really what I call my ‘learning day’ . So far I had not attended any session in TechEd and I felt a bit down for that. Everybody spends their valuable time & money to learn something new and exciting in TechEd and I had not attended a single session at the moment thinking that it was already last day of the event. I did have a plan for the day and I attended two technical sessions before my session of spatial database. I attended 2 sessions of Vinod Kumar. Vinod is a natural storyteller and there was no doubt that his sessions would be jam-packed. People attended his sessions simply because Vinod is syhe speaker. He did not have a single time disappointed audience; he is truly a good speaker. He knows his stuff very well. I personally do not think that in India he can be compared to anyone for SQL. Time: 12:30pm-1:30pm SQL Server Query Optimization, Execution and Debugging Query Performance I really had a fun time attending this session. Vinod made this session very interactive. The entire audience really got into the presentation and started participating in the event. Vinod was presenting a small problem with Query Tuning, which any developer would have encountered and solved with their help in such a fashion that a developer feels he or she have already resolved it. In one question, I was the only one who was ready to answer and Vinod told me in a light tone that I am now allowed to answer it! The audience really found it very amusing. There was a huge crowd around Vinod after the session. Vinod – A master storyteller! Time: 3:45pm-4:45pm Data Recovery / consistency with CheckDB This session was much heavier than the earlier one, and I must say this is my most favorite session I EVER attended in India. In this TechEd I have only attended two sessions, but in my career, I have attended numerous technical sessions not only in India, but all over the world. This session had taken my breath away. One by one, Vinod took the different databases, and started to corrupt them in different ways. Each database has some unique ways to get corrupted. Once that was done, Vinod started to show the DBCC CEHCKDB and demonstrated how it can solve your problem. He finally fixed all the databases with this single tool. I do have a good knowledge of this subject, but let me honestly admit that I have learned a lot from this session. I enjoyed and cheered during this session along with other attendees. I had total satisfaction that, just like everyone, I took advantage of the event and learned something. I am now TECHnically EDucated. Pinal Dave and Vinod Kumar After two very interactive and informative SQL Sessions from Vinod Kumar, the next turn me presenting on Spatial Database and Indexing. I got once again nervous but Vinod told me to stay natural and do my presentation. Well, once I got a huge stage with a total of four projectors and a large crowd, I felt better. Time: 5:00pm-6:00pm Session 3: Developing with SQL Server Spatial and Deep Dive into Spatial Indexing Pinal Presenting session at TechEd India 2010 Pinal Presenting session at TechEd India 2010 I kicked off this session with Michael J Swart‘s beautiful spatial image. This session was the last one for the day but, to my surprise, I had more than 200+ attendees. Slowly, the rain was starting outside and I was worried that the hall would not be full; despite this, there was not a single seat available in the first five minutes of the session. Thanks to all of you for attending my presentation. I had demonstrated the map of world (and India) and quickly explained what  Geographic and Geometry data types in Spatial Database are. This session had interesting story of Indexing and Comparison, as well as how different traditional indexes are from spatial indexing. Pinal Presenting session at TechEd India 2010 Due to the heavy rain during this event, the power went off for about 22 minutes (just an accident – nobodies fault). During these minutes, there were no audio, no video and no light. I continued to address the mass of 200+ people without any audio device and PowerPoint. I must thank the audience because not a single person left from the session. They all stayed in their place, some moved closure to listen to me properly. I noticed that the curiosity and eagerness to learn new things was at the peak even though it was the very last session of the TechEd. Everybody wanted get the maximum knowledge out of this whole event. I was touched by the support from audience. They listened and participated in my session even without any kinds of technology (no ppt, no mike, no AC, nothing). During these 22 minutes, I had completed my theory verbally. Pinal Presenting session at TechEd India 2010 After a while, we got the projector back online and we continued with some exciting demos. Many thanks to Microsoft people who worked energetically in background to get the backup power for project up. I had a very interesting demo wherein I overlaid Bangalore and Hyderabad on the India Map and find their aerial distance between them. After finding the aerial distance, we browsed online and found that SQL Server estimates the exact aerial distance between these two cities, as compared to the factual distance. There was a huge applause from the crowd on the subject that SQL Server takes into the count of the curvature of the earth and finds the precise distances based on details. During the process of finding the distance, I demonstrated a few examples of the indexes where I expressed how one can use those indexes to find these distances and how they can improve the performance of similar query. I also demonstrated few examples wherein we were able to see in which data type the Index is most useful. We finished the demos with a few more internal stuff. Pinal Presenting session at TechEd India 2010 Despite all issues, I was mostly satisfied with my presentation. I think it was the best session I have ever presented at any conference. There was no help from Technology for a while, but I still got lots of appreciation at the end. When we ended the session, the applause from the audience was so loud that for a moment, the rain was not audible. I was truly moved by the dedication of the Technology enthusiasts. Pinal Dave After Presenting session at TechEd India 2010 The abstract of the session is as follows: The Microsoft SQL Server 2008 delivers new spatial data types that enable you to consume, use, and extend location-based data through spatial-enabled applications. Attend this session to learn how to use spatial functionality in next version of SQL Server to build and optimize spatial queries. This session outlines the new geography data type to store geodetic spatial data and perform operations on it, use the new geometry data type to store planar spatial data and perform operations on it, take advantage of new spatial indexes for high performance queries, use the new spatial results tab to quickly and easily view spatial query results directly from within Management Studio, extend spatial data capabilities by building or integrating location-enabled applications through support for spatial standards and specifications and much more. Time: 8:00 PM – onwards Dinner by Sponsors After the lively session during the day, there was another dinner party courtesy of one of the sponsors of TechEd. All the MVPs and several Community leaders were present at the dinner. I would like to express my gratitude to Abhishek Kant for organizing this wonderful event for us. It was a blast and really relaxing in all angles. We all stayed there for a long time and talked about our sweet and unforgettable memories of the event. Pinal Dave and Bijoy Singhal It was really one wonderful event. After writing this much, I say that I have no words to express about how much I enjoyed TechEd. However, it is true that I shared with you only 1% of the total activities I have done at the event. There were so many people I have met, yet were not mentioned here although I wanted to write their names here, too . Anyway, I have learned so many things and up until now, I am not able to get over all the fun I had in this event. Pinal Dave at TechEd India 2010 The Next Days – April 15, 2010 – till today I am still not able to get my mind out of the whole experience I had at TechEd India 2010. It was like a whole Microsoft Family working together to celebrate a happy occasion. TechEd India – Truly An Unforgettable Experience! Reference : Pinal Dave (http://blog.SQLAuthority.com) Filed under: About Me, MVP, Pinal Dave, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, SQLAuthority Author Visit, SQLAuthority News, SQLServer, T SQL, Technology Tagged: TechEd, TechEdIn

    Read the article

  • How to send AT command in android?

    - by jitendra Kumar
    Hi All, I want to send At command throug my application to modem. Can some one please let me know how to send AT command thr my application?? Do we need Phone object to send AT command??? The ATResponseParser class parses part of the AT command syntax used to communicate with the mobile radio hardware in a mobile handset. This is, in fact, a command syntax very much like the AT command syntax used by modems, a standard described in the 3GPP document number TS 27.007 and related specifications. I ant to send below AT command to Mode. 6.5 Hangup call +CHUP Table 13a: +CHUP action command syntax Command Possible response(s) +CHUP +CHUP=? Please help me. Regards, Jitendra Kumar

    Read the article

  • java.sql.SQLException: SQL logic error or missing database

    - by Sunil Kumar Sahoo
    Hi All, I ahve created database connection with SQLite using JDBC in java. My sql statements execute properly. But sometimes I get the following error while i use conn.commit() java.sql.SQLException: SQL logic error or missing database Can anyone please help me how to avoid this type of problem. Can anyone give me better approach of calling JDBC programs Class.forName("org.sqlite.JDBC"); conn = DriverManager.getConnection("jdbc:sqlite:/home/Data/database.db3"); conn.setAutoCommit(false); String query = "Update Chits set BlockedForChit = 0 where ServerChitID = '" + serverChitId + "' AND ChitGatewayID = '" + chitGatewayId + "'"; Statement stmt = null; try { stmt.execute(query); conn.commit(); stmt.close(); stmt = null; } Thanks Sunil Kumar Sahoo

    Read the article

  • java.sql.SQLException: SQL logic error or missing database, SQLite, JDBC

    - by Sunil Kumar Sahoo
    Hi All, I ahve created database connection with SQLite using JDBC in java. My sql statements execute properly. But sometimes I get the following error while i use conn.commit() java.sql.SQLException: SQL logic error or missing database Can anyone please help me how to avoid this type of problem. Can anyone give me better approach of calling JDBC programs Class.forName("org.sqlite.JDBC"); conn = DriverManager.getConnection("jdbc:sqlite:/home/Data/database.db3"); conn.setAutoCommit(false); String query = "Update Chits set BlockedForChit = 0 where ServerChitID = '" + serverChitId + "' AND ChitGatewayID = '" + chitGatewayId + "'"; Statement stmt = conn.createStatement(); try { stmt.execute(query); conn.commit(); stmt.close(); stmt = null; } Thanks Sunil Kumar Sahoo

    Read the article

  • Add Command prompt in VS 2008 Express Edition manually

    - by Kumar
    Hi all, To add the Command prompt in VS 2008 express edition, i have done the following steps: Tools-ExternalTools-Click on Add- Then I have entered the following information. Title: Visual Studio 2008 Command Prompt Command: cmd.exe Arguments: %comspec% /k ""C:\Program Files\Microsoft Visual Studio 9.0\VC\vcvarsall.bat"" x86 Initial Directory: $(ProjectDir) Then OK/Apply: After this when I went to Tools Menu and click on Visual Studio 2008 Command Prompt, command prompt open but got the following error message: '"C:\Program Files\Microsoft Visual Studio 9.0\VC\vcvarsall.bat"' is not recognized as an internal or external command, operable program or batch file. C:\Program Files\Microsoft Visual Studio 9.0\Common7\IDE Please somebody help me to fix this problem.. Or somebody teach me freshly how to add command prompt in Tools Menu manually in VS 2008 Express Edition. Thanks, Kumar

    Read the article

  • pound sign is not working in mail content using java.mail package?

    - by kumar kasimala
    HI all, I am using javax.mail packaage MINEMESSAGE,MimeMultipart class to send a mail, but even though I mention type utf-8, unicode characters are not working in body text. like pound sign is not working. please help what to do. here is my message headers To: kumar[email protected] Message-ID: <875158456.1.1294898905049.JavaMail.root@nextrelease> Subject: My Site Free Trial - 5 days left MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="----=_Part_0_1733237863.1294898905008" MyHeaderName: myHeaderValue Date: Thu, 13 Jan 2011 06:08:25 +0000 (UTC) ------=_Part_0_1733237863.1294898905008 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable

    Read the article

  • How to write java program to increase file limit using ulimit

    - by Sunil Kumar Sahoo
    I am using Fedora linux where ulimit -n 10000 increases file limit upto 10000. I want to achieve the same using java program How to write java program to increase file limit using ulimit I have tried with the below program but it didnot work well. The program didnot give any error. but didnot increase file limit also public class IncreaseFIle { public static void main(String[] args) { String command = "/bin/bash ulimit -n 10000"; // String command = "pwd"; try { Runtime.getRuntime().exec(command); } catch (IOException ex) { ex.printStackTrace(); } } } Thanks Sunil Kumar Sahoo

    Read the article

  • list-index hibernate ?

    - by kumar kasimala
    Hi I am bit confusion of list index type,my mapping file has like below <list name="transactionItems" cascade="save-update,delete-orphan" lazy="false"> <key column="TRANSACTION_ID" /> <list-index column="IDX" /> <one-to-many class="TransactionItem" /> </list> whenever hibernate load a mapped object,its through exception null index column for collection:transactionItems please suggest me what can be the problem here. can you exaplain a bit about list-index? thanks & Regards kumar kasiamla India,Hyderabad.

    Read the article

  • SocketTimeOutException while creating socket, java

    - by Sunil Kumar Sahoo
    Hi All, I have created a sample java socket application. I used Socket s = new Socket(ip, port) Now it works fine. but when my internet connection is very slow that time after a long interval (even if sometimes after 2 minutes) i used to get SocketTimeOutException in that line. means it gives that error while creating socket. I want the exception should be handled properly means if internet connection is very slow then if that error occurs it happens very late now . I want if this type of error occurs then it should be caught very fast means the error should not come at such a delay interval of time rather it should come immediately. How to achieve this. Thanks Sunil Kumar Sahoo

    Read the article

  • How to detect internet connectivity using java program

    - by Sunil Kumar Sahoo
    How to write a java program which will tell me whether I have internet access or not. I donot want to ping or create connection with some external url because if that server will be down then my program will not work. I want reliable way to detect which will tell me 100% guarantee that whether I have internet connection or not irrespective of my Operating System. I want the program for the computers who are directly connected to internet. I have tried with the below program URL url = new URL("http://www.xyz.com/"); URLConnection conn = url.openConnection(); conn.connect(); I want something more appropriate than this program Thanks Sunil Kumar Sahoo

    Read the article

  • How to maximize java swing application

    - by Sunil Kumar Sahoo
    Hi All, I have created a login page using java swing. and i created jar for the application. Now when I run the jar then my login page is displayed then i minimize the application and again run the jar then another instance of my application is displayed (means now in my system I have two login page. 1 is in minimized format and another is in normal state. But I want that if in my system login page is already running and is minimized then if i run the jar once again then it will not start as a new application rather it should maximize the earlier login page. How to achieve this type of functionality ? please help me Thanks Sunil Kumar Sahoo

    Read the article

  • generate all subsets of size k from a set

    - by Kumar
    hi, i want to generate all the subsets of size k from a set. eg:-say i have a set of 6 elements, i have to list all the subsets in which the cardinality of elements is 3. I tried looking for solution,but those are code snippets. Its been long since I have done coding,so I find it hard to understand the code and construct a executable program around it. A complete executable program in C or C++ will be quite helpful. Hoping of an optimal solution using recursion. Thanks in advance. Kumar.

    Read the article

  • A Multi-Channel Contact Center Can Reduce Total Cost of Ownership

    - by Tom Floodeen
    In order to remain competitive in today’s market, CRM customers need to provide feature-rich superior call center experience to their customers across all communication channels while improving their service agent productivity. They also require their call center to be deeply integrated with their CRM system; and they need to implement all this quickly, seamlessly, and without breaking the bank. Oracle’s Siebel Customer Relationship Management (CRM) is the world’s leading application suite for automated customer-facing operations for Sales and Marketing and for managing all aspects of providing service to customers. Oracle’s Contact On Demand (COD) is a world-class carrier grade hosted multi-channel contact center solution that can be deployed in days without up-front capital expenditures or integration costs. Agents can work efficiently from anywhere in the world with 360-degree views into customer interactions and real-time business intelligence. Customers gain from rapid and personalized sales and service, while organizations can dramatically reduce costs and increase revenues Oracle’s latest update of Siebel CRM now comes pre-integrated with Oracle’s Contact On Demand. This solution seamlessly runs fully-functional contact center provided by a single vendor, significantly reducing your total cost of ownership. This solution supports Siebel 7.8 and higher for Voice and Siebel 8.1 and higher for Voice and Siebel CRM Chat.  The impressive feature list of Oracle’s COD solution includes full-control CTI toolbar with Voice, Chat, and Click to Dial features.  It also includes context-sensitive screens, automated desktops, built-in IVR, Multidimensional routing, Supervisor and Quality monitoring, and Instant Provisioning. The solution also ships with Extensible Web Services interface for implementing more complex business processes. Click here to learn how to reduce complexity and total cost of ownership of your contact center. Contact Ann Singh at [email protected] for additional information.

    Read the article

  • How to make a sum of total for each id

    - by JetJack
    Using Crystal report 7 I want to view the table 1 and sum of table2 table1 id name 001 raja 002 vijay 003 suresh .... table2 id value 001 100 001 200 001 150 002 200 003 150 003 200 ... I want to display all the rows from table1 and sum(values) from table2. How to do this in crystal report Expected Output id name value 001 raja 450 002 vijay 200 003 suresh 350 .... Note: I add the table field directly to the report, i am not added store procedure or views or query in the report. How to do this. Need Crystal report help

    Read the article

  • Cannot get Correct month for a call from call log history

    - by Nishant Kumar
    I am trying to extract information from the call log of the android. I am getting the call date that is one month back from the actual time of call. I mean to say that the information extracted by my code for the date of call is one mont back than the actual call date. I have the following in the Emulator: I saved a contact. Then I made a call to the contact. Code: I have 3 ways of extracting call Date information but getting the same wrong result. My code is as follows: /* Make the query to call log content */ Cursor callLogResult = context.getContentResolver().query( CallLog.Calls.CONTENT_URI, null, null, null, null); int columnIndex = callLogResult.getColumnIndex(Calls.DATE); Long timeInResult = callLogResult.getLong(columnIndex); /* Method 1 to change the milliseconds obtained to the readable date formate */ Time time = new Time(); time.toMillis(true); time.set(timeInResult); String callDate= time.monthDay+"-"+time.month+"-"+time.year; /* Method 2 for extracting the date from tha value read from the column */ Calendar calendar = Calendar.getInstance(); calendar.setTimeInMillis(time); String Month = calendar.get(Calendar.MONTH) ; /* Method 3 for extracting date from the result obtained */ Date date = new Date(timeInResult); String mont = date.getMonth() While using the Calendar method , I also tried to set the DayLight SAving Offset but it didnot worked, calendar.setTimeZone(TimeZone.getTimeZone("Europe/Paris")); int DST_OFFSET = calendar.get( Calendar.DST_OFFSET ); // DST_OFFSET Boolean isSet = calendar.getTimeZone().useDaylightTime(); if(isSet) calendar.set(Calendar.DST_OFFSET , 0); int reCheck = calendar.get(Calendar.DST_OFFSET ); But the value is not set to 0 in recheck. I am getting the wrong month value by using this also. Please some one help me where I am wrong? or is this the error in emulator ?? Thanks, Nishant Kumar Engineering Student

    Read the article

< Previous Page | 2 3 4 5 6 7 8 9 10 11 12 13  | Next Page >