Search Results

Search found 29913 results on 1197 pages for 'content manager assistant'.

Page 616/1197 | < Previous Page | 612 613 614 615 616 617 618 619 620 621 622 623  | Next Page >

  • source command in Linux

    - by Rodnower
    My question is: why if I run some file with name aliases for example with content such as: alias lsa="ls -a" directly: $ ./aliases it don't create the alias (may be only in script context). But if I run it with command "source": $ source aliases it do the work? I mean after execution the alias "lsa" existing in context of command shell? "man source" give: "No manual entry for source", and in google I just found that it runs Tcl, but why Tcl influence shell context and bush not?

    Read the article

  • Recover not properly burned DVD from camcoder

    - by tomo
    Can anybody suggest me any good and preferably free software - working on Vista / 7 - for recovering content from DVD disks? A few DVD-R VOB files cannot be read from disk by Windows. Probably the camera failed to burn it correctly. What I want to achieve is to skip a few invalid frames in VOB files and recreate proper MPEG stream - without re-encoding whole stream and loosing the quality.

    Read the article

  • Mails are coming from mail server to my account automatically...???

    - by Jayakrishnan T
    Hi all, i am getting same mail from admin account of my mail server every day automatically.The content of the mail is given below. Click here to access your spam quarantine. The spam quarantine contains emails that are being held from your email account. Quarantined emails can be released to your inbox or deleted using the spam quarantine link. Please give me an advice to solve this problem.

    Read the article

  • Where should I configure software installed by 3rd-party chef recipes?

    - by FRKT
    I'm provisioning a Vagrant virtual machine with Chef and it's amazing, but I'm unsure where I should put code to configure software installed by 3rd-party chef recipes. For example, I'm installing NGINX with this recipe but I need to configure the default virtual host to serve content from /vagrant/public instead of /var/www/nginx-default. Should I change the template of the 3rd-party recipe, or create another recipe that reconfigures it?

    Read the article

  • IIS, SSL, and Virtual Directories

    - by yodie
    I'm running a webserver on WS 2k3, IIS 6.0. Some of the content is on that server, but most is in a virtual directory linked to another server. Everything works (almost) fine when no SSL is used. However, when using SSL, I cannot access the files in the virtual directory. Instead I get a generic error 500. Any advice?

    Read the article

  • Gzip not working in browser

    - by Cathal
    According to whatsmyip.org none of my browsers (Firefox, Chrome etc) on W7 are gzip enabled, it's saying 'NO, your browser is not requesting compressed content' which agrees with Chrome developer tools as I was testing a site and it was complaining that the page and css etc weren't compressed. I've searched for an answer but cannot find anything for this. I've tested from another pc connected to the router and that works fine, something on this pc is broke.... Any help tia

    Read the article

  • Cisco 861 Router forces one-to-one NAT

    - by Slurpee
    I have a cisco 861 router that only allows one-to-one NATs in order to access the Internet. I would like for computers to get an address via DHCP from this router, and be able to access the Internet without needing to set a static NAT to one of my public IPs. What is wrong with the configuration? I have a basic understanding of the IOS CLI, most of the configuration file (edited for content) was created by my company's long gone Senior Network Engineer.

    Read the article

  • Force www. on multi domain site and retain http or https [closed]

    - by John Isaacks
    I am using CakePHP which already contains an .htaccess file that looks like: <IfModule mod_rewrite.c> RewriteEngine on RewriteRule ^$ app/webroot/ [L] RewriteRule (.*) app/webroot/$1 [L] </IfModule> I want to force www. (unless it is a subdomain) to avoid duplicate content penalties. It needs to retain http or https Also This application will have multiple domains pointing to it. So the code needs to be able to work with any domain.

    Read the article

  • How can I configure OSX/Windows7 to send ALL traffic though VPN tunnel?

    - by lrrrgg
    While connected to a VPN (SwissVPN service), a content filter at a site I'm working at blocked a web page. This was perplexing, since the local site's filter should not be able to see my traffic, right? So I assume my web browsing activity was not going through the VPN tunnel. How can I configure the OS to send ALL traffic though the currently connected VPN tunnel? I'm using OSX Lion and Windows 7. Thanks!

    Read the article

  • Encrypt windows 8 file history

    - by SnippetSpace
    File history is great but it saves your files on the external drive without any encryption and stores them using the exact same folder structure as the originals. If a bad guy gets his hands on the hard drive it could basically not be easier to get to your important files. Is there any way to encrypt the file history backup without breaking its functionality and without having to encrypt the original content itself? Thanks for your input!

    Read the article

  • Streaming from a second computer

    - by techgod52
    I play games on my laptop, and they run at about 30-45 fps, which is bearable for me. But when I try to stream, the frame rate drops to 20 or lower, which is unplayable for me. I have a second computer though (a Mac, the laptop is Win7), and I'm wondering if there is anyway to stream the game content (onto Twitch.tv) from my laptop using my Mac. Is this possible, and how would I go about doing it?

    Read the article

  • How to allow only specific directories to use htaccess?

    - by DisgruntledGoat
    Currently in apache2.conf I have AllowOverride all set for /var/www which simply allows htaccess for all the sites on the server (which is Ubuntu, 9.04). However, I'd rather only allow overrides in each site root directory and nothing else. In other words, /var/www/site1, /var/www/site2, etc. can have a htaccess, but all other directories including /var/www and /var/www/site1/content cannot. Is there a way to do this without having to write a rule for every site on the server?

    Read the article

  • Copying SharePoint DB to a new SharePoint 2010 server

    - by LJe
    Hi - we would like to know what is the best and easy way to configure a new SharePoint 2010 Server, we have backup the existing DB of SharePoint 2007 (up and running). We would like to mirror the same settings and content of our current SharePoint setup to the new server using the SharePoint 2010.

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • Java application delivery through CDN

    - by tuler
    We have a java application bundled as an applet or as webstart. The client java plugin caches the jar files on the client machine and downloads a new version if there is one. Is it possible to deliver this jar files using a CDN? What are the issues involved? Which CDNs would work for jar delivery? Is this different from static content delivery like images or video?

    Read the article

  • How to schedule server jobs more intelligently than with cron?

    - by John
    I run a job every minute to reindex my site's content. Today, the search engine died, and when I logged in there were hundreds of orphan processes that had been started by cron. Is there another way using some kind of existing software that will let me execute a job every minute, but that won't launch another instance if that job doesn't return (i.e. because the search engine process has failed)?

    Read the article

  • Windows XP restarts itself suddenly

    - by LaD
    My computer (Windows XP sp3) gets stuck suddenly and restarts itself. When Windows loads I get the following message: error Signature: BCCode : 100000d1 BCP1 : 0000674B BCP2 : 00000002 BCP3 : 00000000 BCP4 : BA9910DC OSVer : 5_1_2600 SP : 3_0 Product : 256_1 error report content: C:\DOCUME~1\ADMINI~1\LOCALS~1\Temp\WER811d.dir00\Mini090909-02.dmp C:\DOCUME~1\ADMINI~1\LOCALS~1\Temp\WER811d.dir00\sysdata.xml Help! Thanks.

    Read the article

  • Which guide do you recommend on setting up Nginx

    - by Saif Bechan
    I am setting up an LEMP (Nginx, MySQL, PHP on Linux) from scratch. There are a lot of guides available online in all different forms. Now I want a setup with virtual hosts, and only serve dynamic content (PHP). My static files(images,css,js) are on a CDN. Do you know of a good guide on setting up the LEMP installation.

    Read the article

  • How to append to a file as sudo? [closed]

    - by obvio171
    Possible Duplicate: sudo unable to write to /etc/profile I want to do: echo "something" >> /etc/config_file But, since only the root user has write permission to this file, I can't do that. But this: sudo echo "something" >> /etc/config_file also doesn't work. Is there any way to append to a file in that situation without having to first open it with a sudo'd editor and then appending the new content by hand?

    Read the article

  • How to register rss for a website?

    - by domainking
    I am not sure if I ask this question in the right place, because I am new to it. What I want to ask is, do I need to register/create RSS for my website? I have a website, lets say: [http://blog.domain.com] = its a 2.9.2 wordpress blog So, if I want to display the latest content in another subdomain, for example: [news.domain.com], how do I do that? I know a little bit of php and mysql.

    Read the article

  • How can I tell if I'm behind a portal or proxy

    - by user19269
    I'm testing out a Content management system on my computer and have emailed their support for a problem regarding login.. They've replied back and asked if my CMS is behind a portal or proxy. I feel kind of stupid for not knowing this, but how do I find out? Everything is local (eg, hosted on my computer, etc). Thanks in advance!

    Read the article

  • Invalid command 'SSLRequireSSL',

    - by Bad Programmer
    An svn server that I managed crashed. The server is up and running again, but I can't manage to get svn running anymore. I followed the instructions listed here: http://mark.koli.ch/2010/03/howto-setting-up-your-own-svn-server-using-apache-and-mod-dav-svn.html Yet when I try to start apache using /etc/init.d/httpd start I get a [FAILED] message. There is no content in the error logs. Any suggestions?

    Read the article

< Previous Page | 612 613 614 615 616 617 618 619 620 621 622 623  | Next Page >