Search Results

Search found 81719 results on 3269 pages for 'remote file copy'.

Page 62/3269 | < Previous Page | 58 59 60 61 62 63 64 65 66 67 68 69  | Next Page >

  • Flash AS3 load file xml

    - by Elias
    Hello, I'm just trying to load an xml file witch can be anywere in the hdd, this is what I have done to browse it, but later when I'm trying to load the file it would only look in the same path of the swf file here is the code package { import flash.display.Sprite; import flash.events.; import flash.net.; public class cargadorXML extends Sprite { public var cuadro:Sprite = new Sprite(); public var file:FileReference; public var req:URLRequest; public var xml:XML; public var xmlLoader:URLLoader = new URLLoader(); public function cargadorXML() { cuadro.graphics.beginFill(0xFF0000); cuadro.graphics.drawRoundRect(0,0,100,100,10); cuadro.graphics.endFill(); cuadro.addEventListener(MouseEvent.CLICK,browser); addChild(cuadro); } public function browser(e:Event) { file = new FileReference(); file.addEventListener(Event.SELECT,bien); file.browse(); } public function bien(e:Event) { xmlLoader.addEventListener(Event.COMPLETE, loadXML); req=new URLRequest(file.name); xmlLoader.load(req); } public function loadXML(e:Event) { xml=new XML(e.target.data); //xml.name=file.name; trace(xml); } } } when I open a xml file that isnt it the same directory as the swf, it gives me an unfound file error. is there anything I can do? cause for example for mp3 there is an especial class for loading the file, see http://www.flexiblefactory.co.uk/flexible/?p=46 thanks

    Read the article

  • Unable to access Java-created file -- sometimes

    - by BlairHippo
    In Java, I'm working with code running under WinXP that creates a file like this: public synchronized void store(Properties props, byte[] data) { try { File file = filenameBasedOnProperties(props); if ( file.exists() ) { return; } File temp = File.createTempFile("tempfile", null); FileOutputStream out = new FileOutputStream(temp); out.write(data); out.flush(); out.close(); file.getParentFile().mkdirs(); temp.renameTo(file); } catch (IOException ex) { // Complain and whine and stuff } } Sometimes, when a file is created this way, it's just about totally inaccessible from outside the code (though the code responsible for opening and reading the file has no problem), even when the application isn't running. When accessed via Windows Explorer, I can't move, rename, delete, or even open the file. Under Cygwin, I get the following when I ls -l the directory: ls: cannot access [big-honkin-filename] total 0 ?????????? ? ? ? ? ? [big-honkin-filename] As implied, the filenames are big, but under the 260-character max for XP (though they are slightly over 200 characters). To further add to the sense the my computer just wants me to feel stupid, sometimes the files created by this code are perfectly normal. The only pattern I've spotted is that once one file in the directory "locks", the rest are screwed. Anybody ever run into something like this before, or have any insights into what's going on here?

    Read the article

  • Modifying File while in use using Java

    - by Marquinio
    Hi all, I have this recurrent Java JAR program tasks that tries to modify a file every 60seconds. Problem is that if user is viewing the file than Java program will not be able to modify the file. I get the typical IOException. Anyone knows if there is a way in Java to modify a file currently in use? Or anyone knows what would be the best way to solve this problem? I was thinking of using the File canRead(), canWrite() methods to check if file is in use. If file is in use then I'm thinking of making a backup copy of data that could not be written. Then after 60 seconds add some logic to check if backup file is empty or not. If backup file is not empty then add its contents to main file. If empty then just add new data to main file. Of course, the first thing I will always do is check if file is in use. Thanks for all your ideas.

    Read the article

  • How to compare two file structures in PHP?

    - by OM The Eternity
    I have a function which gives me the complete file structure upto n-level, function getDirectory($path = '.', $ignore = '') { $dirTree = array (); $dirTreeTemp = array (); $ignore[] = '.'; $ignore[] = '..'; $dh = @opendir($path); while (false !== ($file = readdir($dh))) { if (!in_array($file, $ignore)) { if (!is_dir("$path/$file")) { //display of file and directory name with their modification time $stat = stat("$path/$file"); $statdir = stat("$path"); $dirTree["$path"][] = $file. " === ". date('Y-m-d H:i:s', $stat['mtime']) . " Directory == ".$path."===". date('Y-m-d H:i:s', $statdir['mtime']) ; } else { $dirTreeTemp = getDirectory("$path/$file", $ignore); if (is_array($dirTreeTemp))$dirTree = array_merge($dirTree, $dirTreeTemp); } } } closedir($dh); return $dirTree; } $ignore = array('.htaccess', 'error_log', 'cgi-bin', 'php.ini', '.ftpquota'); //function call $dirTree = getDirectory('.', $ignore); //file structure array print print_r($dirTree); Now here my requirement is , I have two sites The Development/Test Site- where i do testing of all the changes The Production Site- where I finally post all the changes as per test in development site Now, for example, I have tested an image upload in the Development/test site, and i found it appropriate to publish on Production site then i will completely transfer the Development/Test DB detail to Production DB, but now I want to compare the files structure as well to transfer the corresponding image file to Production folder. There could be the situation when I update the image by editing the image and upload it with same name, now in this case the image file would be already present there, which will restrict the use of "file_exist" logic, so for these type of situations....HOW CAN I COMPARE THE TWO FILE STRUCTURE TO GET THE SYNCHRONIZATION DONE AS PER REQUIREMENT??

    Read the article

  • File mkdirs() method not working in android/java

    - by Leif Andersen
    I've been pulling out my hair on this for a while now. The following method is supposed to download a file, and save it to the location specified on the hard drive. private static void saveImage(Context context, boolean backgroundUpdate, URL url, File file) { if (!Tools.checkNetworkState(context, backgroundUpdate)) return; // Get the image try { // Make the file file.getParentFile().mkdirs(); // Set up the connection URLConnection uCon = url.openConnection(); InputStream is = uCon.getInputStream(); BufferedInputStream bis = new BufferedInputStream(is); // Download the data ByteArrayBuffer baf = new ByteArrayBuffer(50); int current = 0; while ((current = bis.read()) != -1) { baf.append((byte) current); } // Write the bits to the file OutputStream os = new FileOutputStream(file); os.write(baf.toByteArray()); os.close(); } catch (Exception e) { // Any exception is probably a newtork faiilure, bail return; } } Also, if the file doesn't exist, it is supposed to make the directory for the file. (And if there is another file already in that spot, it should just not do anything). However, for some reason, the mkdirs() method never makes the directory. I've tried everything from explicit parentheses, to explicitly making the parent file class, and nothing seems to work. I'm fairly certain that the drive is writable, as it's only called after that has already been determined, also that is true after running through it while debugging. So the method fails because the parent directories aren't made. Can anyone tell me if there is anything wrong with the way I'm calling it? Also, if it helps, here is the source for the file I'm calling it in: https://github.com/LeifAndersen/NetCatch/blob/master/src/net/leifandersen/mobile/android/netcatch/services/RSSService.java Thank you

    Read the article

  • How is the "change password at next logon" requirement supposed to work with RDP using Network Level Authentication?

    - by NReilingh
    We have a Windows server (2008 R2) with the "Remote Desktop Services" feature installed and no Active Directory domain. Remote desktop is set up to "Allow connections only from computers running Remote Desktop with Network Level Authentication (more secure)". This means that before the remote screen is displayed, the connection is authenticated in a "Windows Security: Enter your credentials" window. The only two role services installed on this server is the RD Session Host and Licensing. When the "User must change password at next logon" checkbox is selected in the properties for a local user on this server, the following displays on a client computer after attempting to connect using the credentials that were last valid: On some other servers using RDP for admin access (but without the Remote Desktop Services role installed), the behavior is different -- the session begins and the user is given a change password prompt on the remote screen. What do I need to do to replicate this behavior on the Remote Desktop Services server?

    Read the article

  • Copy Thunderbird accounts and preferences from Linux to Mac/Windows

    - by Josh
    This is similar to this question but not exactly a duplicate. My Linux laptop has recently been hanging for no apparent reason, and so I have been using a Mac OS X laptop in the meantime. I just installed Thunderbird and wanted to copy all my preferences and account settings to the new laptop. All email accounts are IMAP based. Can I simply copy the data, or does Thunderbird for OS X store data in a different format from OS X? What about if I wanted to copy the preferences to Thunderbird under Windows? Finally, what files do I copy? I haven't powered up the Linux laptop yet but I'm guessing there's a ~/.thunderbird/ directory, can I just copy this to the Mac?

    Read the article

  • Unset the system immutable bit in Mac OS X

    - by skylarking
    In theory I believe you can unlock and remove the system immutable bit with: chflags noschg /Path/To/File But how can you do this when you've set the bit as root? I have a file that is locked, and even running this command as root will not work as the operation is not permitted. I tried logging in as Single-User mode to no avail. I seem to remember that even though you are in as root you are in at level '1'. And to be able to remove the system-immutable flag you need to be logged in at level '0'. Does this have something to do with this issue?

    Read the article

  • ssh asks for password despite ssh-copy-id

    - by Aliud Alius
    I've been using public key authentication on a remote server for some time now for remote shell use as well as for sshfs mounts. After forcing a umount of my sshfs directory, I noticed that ssh began to prompt me for a password. I tried purging the remote .ssh/authorized_keys from any mention the local machine, and I cleaned the local machine from references to the remote machine. I then repeated my ssh-copy-id, it prompted me for a password, and returned normally. But lo and behold, when I ssh to the remote server I am still prompted for a password. I'm a little confused as to what the issue could be, any suggestions?

    Read the article

  • SVN: Working with branches using the same working copy

    - by uXuf
    We've just moved to SVN from CVS. We have a small team and everyone checks in code on the trunk and we have never ever used branches for development. We each have directories on a remote dev server with the codebase checked out. Each developer works on their own sandbox with an associated URL to pull up the app in a browser (something like the setup here: Trade-offs of local vs remote development workflows for a web development team). I've decided that for my current project, I'll use a branch because it would span multiple releases. I've already cut a branch out, but I am using the same directory as the one originally checked out (i.e. for the trunk). Since it's the same directory (or working copy) for both the branch and the trunk, if for e.g. a bug pops up in the app I switch to the trunk and commit the change there, and then switch back to my branch for my project development. My questions are: Is this a sane way to work with branches? Are there any pitfalls that I need to be aware of? What would be the optimal way to work with branches if separate working copies are out of the question? I haven't had issues yet as I have just started doing this way but all the tutorials/books/blog posts I have seen about branching with SVN imply working with different working copies (or perhaps I haven't come across an explanation of mixed working copies in plain English). I just don't want to be sorry three months down the road when its time to integrate the branch back to the trunk.

    Read the article

  • Copy Excel Formatting the Easy Way with Format Painter

    - by DigitalGeekery
    The Format Painter in Excel makes it easy to copy the formatting of a cell and apply it to another. With just a few clicks you can reproduce formatting such as fonts, alignment, text size, border, and background color. On any Excel worksheet, click on the cell with the formatting you’d like to copy.  You will see dashed lines around the selected cell. Then select the Home tab and click on the Format Painter.   You’ll see your cursor now includes a paintbrush graphic. Move to the cell where you’d like to apply the formatting and click on it. Your target cell will now have the new formatting.   If you double-clicking on Format Painter you can then click on multiple individual files to which to apply the format. Or, you can click and drag across a group of cells. When you are finished applying formats, click on Format Painter again, or on the Esc key, to turn it off. The Format Painter is a very simple, but extremely useful and time saving tool when creating complex worksheets. Similar Articles Productive Geek Tips Use Conditional Formatting to Find Duplicate Data in Excel 2007Remove Text Formatting in Firefox the Easy WayMake Excel 2007 Always Save in Excel 2003 FormatUsing Conditional Cell Formatting in Excel 2007Make Word 2007 Always Save in Word 2003 Format TouchFreeze Alternative in AutoHotkey The Icy Undertow Desktop Windows Home Server – Backup to LAN The Clear & Clean Desktop Use This Bookmarklet to Easily Get Albums Use AutoHotkey to Assign a Hotkey to a Specific Window Latest Software Reviews Tinyhacker Random Tips DVDFab 6 Revo Uninstaller Pro Registry Mechanic 9 for Windows PC Tools Internet Security Suite 2010 New Firefox release 3.6.3 fixes 1 Critical bug Dark Side of the Moon (8-bit) Norwegian Life If Web Browsers Were Modes of Transportation Google Translate (for animals) Roadkill’s Scan Port scans for open ports

    Read the article

  • Win a Free Copy of Windows Presentation Foundation 4.5 Cookbook

    - by Ricardo Peres
    Win A free copy of the 'Windows Presentation Foundation 4.5 Cookbook', just by commenting! For the contest, Packt Publishing has two eBook copies of Windows Presentation Foundation 4.5 Cookbookto be given away to two lucky winners. How you can win: To win your copy of this book, all you need to do is come up with a comment below highlighting the reason "why you would like to win this book”. Duration of the contest & selection of winners: The contest is valid for 7 days (until November 26), and is open to everyone. Winners will be selected on the basis of their comment posted. Windows Presentation Foundation 4.5 Cookbookis written by Pavel Yosifovich, the CTO of CodeValue (http://www.codevalue.net), a software development, consulting, and training company, based in Israel. This book is written in an easy-to-read style, with a strong emphasis on real-world, practical examples. Step-by-step explanations are provided for performing important tasks. This book is the best guide for C# developer who is looking forward to increase understanding and knowledge of WPF. Using this book, readers will learn to build complex and flexible user interfaces using XAML, perform lengthy operations asynchronously while keeping the UI responsive, get well-versed with WPF features such as data binding, layout, resources, templates, and styles and also customize a control’s template to alter appearance but preserve behavior. In the next days I will post my review on this book. In the meantime, here’s the table of contents: Preface Chapter 1: Foundations Chapter 2: Resources Chapter 3: Layout and Panels Chapter 4: Using Standard Controls Chapter 5: Application and Windows Chapter 6: Data Binding Chapter 7: Commands and MVVM Chapter 8: Styles, Triggers, and Control Templates Chapter 9: Graphics and Animation Chapter 10: Custom Elements Chapter 11: Threading Index I’m waiting for your comments!

    Read the article

  • How to create a copy of an instance without having access to private variables

    - by Jamie
    Im having a bit of a problem. Let me show you the code first: public class Direction { private CircularList xSpeed, zSpeed; private int[] dirSquare = {-1, 0, 1, 0}; public Direction(int xSpeed, int zSpeed){ this.xSpeed = new CircularList(dirSquare, xSpeed); this.zSpeed = new CircularList(dirSquare, zSpeed); } public Direction(Point dirs){ this(dirs.x, dirs.y); } public void shiftLeft(){ xSpeed.shiftLeft(); zSpeed.shiftRight(); } public void shiftRight(){ xSpeed.shiftRight(); zSpeed.shiftLeft(); } public int getXSpeed(){ return this.xSpeed.currentValue(); } public int getZSpeed(){ return this.zSpeed.currentValue(); } } Now lets say i have an instance of Direction: Direction dir = new Direction(0, 0); As you can see in the code of Direction, the arguments fed to the constructor, are passed directly to some other class. One cannot be sure if they stay the same because methods shiftRight() and shiftLeft could have been called, which changes thos numbers. My question is, how do i create a completely new instance of Direction, that is basically copy(not by reference) of dir? The only way i see it, is to create public methods in both CircularList(i can post the code of this class, but its not relevant) and Direction that return the variables needed to create a copy of the instance, but this solution seems really dirty since those numbers are not supposed to be touched after beeing fed to the constructor, and therefore they are private.

    Read the article

  • Copy Ubuntu distro with all settings from one computer to a different one

    - by theFisher86
    I'd like to copy my exact setup from my computer at work to my computer at home. I'm trying to figure out how to go about doing that. So far I've figured this much out. On the source computer run dpkg --get-selections > installed-software and backup the installed-software file Backup /etc/apt/sources.list Backup /usr/share/applications/ to save all my custom Quicklists Backup /etc/fstab to save all my network mounts Backup /usr/share/themes/ to save the customization I've done to my themes I'm also going to backup my entire HOME directory. Once I get to the destination computer I'm going to first do just a fresh install of 11.10 Then I'll copy over my HOME directory, /etc/apt/sources.list, /usr/share/appications, /etc/fstab and /usr/share/themes/ Then I'm going to run dpkg --set-selections < installed-software Followed by dselect That should install all of my apps for me. I'm wondering if there's a way/need to backup dconf and gconf settings from the source computer? I guess that's my ultimate question. I'd also like any notes on anything else that might need backed up as well before I undertake this project. I hope this post is legit, I figured other people would be interested in knowing this process and I don't see any other questions that seem to really document this on here. I'd also like to further this project and have each computer routinely backup all the necessary files so that both computer are basically identical at all times. That's stage 2 though...

    Read the article

  • Efficient way to copy a collection of Nodes, treat them, and then serialize?

    - by Danjah
    Hi all, I initially thought a regex to remove YUI3 classNames (or whole class attributes) and id attributes from a serialized DOM string was a sound enough approach - but now I'm not sure, given various warnings about using regex on HTML. I'm toying with the idea of making a copy of the DOM structure in question, performing: var nodeStructure = Y.one('#wrap').all('*'); // A YUI3 NodeList // Remove unwanted classNames.. I'd need to maintain a list of them to remove :/ nodeStructure.removeClass('unwantedClassName'); and then: // I believe this can be done on a NodeList collection... nodeStructure.removeAttribute('id'); I'm not quite sure about what I'd need to do to 'copy' a collection of Nodes anyway, as I don't actually want to do the above to my living markup, as its only being saved - not 'closed' or 'exited', a user could continue to change the markup, and then save again. The above doesn't make a copy, I know. Is this efficient? Is there a better way to 'sanitize' my live markup of framework additions to the DOM (and maybe other things too at a later point), before saving it as a string? If it is a good approach, what's a safe way to go about copying my collection of Nodes for safe cleaning? Thanks! d

    Read the article

  • How to check successful copy() function execution in php?

    - by OM The Eternity
    How to check successful copy() function execution in php? I am using the following code: <? function full_copy( $source, $target ) { if ( is_dir( $source ) ) { @mkdir( $target ); $d = dir( $source ); while ( FALSE !== ( $entry = $d->read() ) ) { if ( $entry == '.' || $entry == '..' ) { continue; } $Entry = $source . '/' . $entry; if ( is_dir( $Entry ) ) { full_copy( $Entry, $target . '/' . $entry ); continue; } copy( $Entry, $target . '/' . $entry ); } $d->close(); }else { copy( $source, $target ); } } $source ='.'; $destination = '/html/parth/'; full_copy($source, $destination); ?> I do not get anything in my parth folder. Why? I am using Windows, Script is executed on fedora system (its my server)...

    Read the article

  • No native symbols in symbol file

    - by Martin
    I am trying to remote debug a Windows Form app with VS2008. Attaching to process works fine (Remote (Native only with no authentication)), but when I open the modules window and try to load symbols I get No native symbols in symbol file. I realise it has something to do with how the app was build but cannot figure out what ?

    Read the article

  • How to kill msvsmon.exe when finished remote debugging?

    - by dferraro
    Hi, We are a .NET LOB shop using MS CRM as our CRM platform. To this end, we many times a day during development phases are using remote debugging due to 2 connection limit to the server. We are able to setup remote debugging without logging onto the machine by using PsExec. This works great - but how the heck do we kill the remote debugger for that user, once we are finished debugging? In fact, not even sure how to kill the remote debugger in general, even when manually opening it... without remoting into server and using task manager, or keeping the server open and doing File-Exit on the debugger. Any advice?

    Read the article

  • Remote desktop type software that the client need not install anything...

    - by allentown
    I am primarily a Macintosh user, and can usually walk a client though any troubles they may have because I have a Macintosh in front of me. If they are on a different OS, things are close enough, or I cam remember, that I can get by. When trying to help clients on Windows, I get stuck. I do not have access to windows, and even if I did, there are far too many versions of Outlook, all with their various esoteric settings and checkboxes, that I could never see exactly what they are seeing. I mostly need to just help them with email setup. Something like copilot.com may do the trick. What is the simplest remote control software out there, ideally, it would accomplish these: No software needed on remote end, or, a single .exe that they can toss when done. I need Mac based software on my end. I do have ARD, which support VNC Free :) If possible, it would be really nice Needs a port forwarding proxy run by the company. There is no way I can get the user to alter their router, or to even plug directly into their WAN for a short time. On the Mac, I just have them open iChat, and this is all built in, proxying through AIM, looking for the same for Windows and Mac.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • What are the requirements for Windows Remote Assistance over Teredo?

    - by Jens
    I try to get the Windows 7 (or Vista) remote assistance feature to work, without using UPnP on the novices computer. After enabling Teredo on the expert's computer (that is in a corporate network, and therefore has teredo disabled by default), I tried to connect to the novice both using Easy Connect and the invitation file with no success. My triubleshooting included the following (so far). A connection to the novice from my home pc was successful, hinting at a misconfiguration on the experts side. Both computers have a "qualified" connection to the Teredo Server. Both computers have a valid Teredo IP, access to the Global_ PNRP cloud and can resolve names registered with PNRP on the other computer. The expert can resolve the PNRP Id automatically generated with an Easy Connect help request Both computers can ping the other's PNRP name. Both computers can ping the other's Teredo IP Address using ping -6 Now, I am a little stumped. I expected Remote Assistance to work at this point, since my corporate firewall has no Teredo filtering. What could RA cause not to work in this setting? Thanks in advance!

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

< Previous Page | 58 59 60 61 62 63 64 65 66 67 68 69  | Next Page >