Search Results

Search found 58396 results on 2336 pages for 'system admin and developer'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 621/2336 | < Previous Page | 617 618 619 620 621 622 623 624 625 626 627 628  | Next Page >

  • How to find all the file handles by a process programmatically?

    - by kumar
    I have a process "x" which uses "system" C function to start ntpd daemon. I observed that ntpd are passed the open file descriptors of "x". ntpd holds on to the file descriptors even after original file is deleted. for ex: Some log files used by "x" are rotated out after sometime, but "ntpd" has file handle opened for these deleted files. Will it cause any problem? Alternatively I thought of setting "FD_CLOEXEC" flag for all the file descriptors before calling "system" function. But as we are running as an extension library to third process "x"( "x" loads our library based on some condition), there is no easy way to know about all the file descriptors process has opened. One way is to read /proc//fd and set "FD_CLOEXEC" for each file handle and reset it back after "system" function returns. I'm using Linux 2.16. Is there any other easy way to find all the file handlers? Thanks,

    Read the article

  • Generate SQL Server Express database from Entity Framework 4 model

    - by Cranialsurge
    I am able to auto-generate a SQL Server CE 4.0 *.sdf file using code-first generation as explained by Scott Guthrie here. The connection string for the same is as follows: <add name="NerdDinners" providerName="System.Data.SqlServerCe.4.0" connectionString="data source=|DataDirectory|NerdDinner.sdf"/> However if I try to generate an mdf instead using the following connection string, it fails to do so with the following error - "The provider did not return a ProviderManifestToken string.". <add name="NerdDinners" providerName="System.Data.SqlClient" connectionString="data source=|DataDirectory|NerdDinner.mdf"/> Even directly hooking into a SQLEXPRESS instance using the following connection string fails <add name="NerdDinners" providerName="System.Data.SqlClient" connectionString="Data Source=.\SQLEXPRESS;Initial Catalog=NerdDinner;Integrated Security=True"/> Does EF 4 only support SQL CE 4.0 for database creation from a model for now or am I doing something wrong here?

    Read the article

  • Traditional ASP.NET application in subdirectory of an MVC application

    - by David
    Windows Server 2003, IIS6. We're trying to deploy a non-MVC ASP.NET web application as a subdirectory of an MVC application. However the ASP.NET application in the subdirectory is failing with the message "Could not load file or assembly 'System.Web.Mvc, Version=1.0.0.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35' or one of its dependencies. The system cannot find the file specified." which is bizarre because it's not an MVC application.

    Read the article

  • mvc components in codeigniter?

    - by ajsie
    in yii i could have mvc components (acts like an own application). could i have this too in codeigniter? eg. in SYSTEM/APPLICATION have a folder called COMPONENTS and in there i put stand-alone applications that would be a part of the application. components like ADDRESS BOOK, MAIL, TWITTER and so on. every component folder has folders like: models, views, controllers, config etc. so a component model extends the application model which in turn extends system's (code igniter) model. the same goes for view and controller. i've already got a lot of these components which i want to use in codeigniter. is it good idea to place them as i said in SYSTEM/APPLICATION/COMPONENTS or is there best practice for this?

    Read the article

  • Shipping Integration into a Rails App

    - by MikeH
    I'm working on integrating a shipping solution into a Rails ecommerce app. We're only going to use one shipping provider. So the question is: Fedex or UPS? I'm wondering what Rails developers think about the tech side of this question. What do you think about the APIs, ease of integration, focus on developer's needs between Fedex and UPS? I was leaning towards Fedex, but from looking at the developers resources sections of both sites, it seems that UPS might be more developer friendly. Also, I'm going to be using Shopify's active_shipping gem: http://github.com/Shopify/active_shipping And I also based my app off the Spree Ecommerce solution, but I don't think that's particularly relevant to the question. Spree wrote a wrapper to integrate active_shipping with the Spree system. I gave away all my points, so SO wont' let me post another link in this question. But if you google "Spree active-shipping", their wrapper on github is the first result. Thanks.

    Read the article

  • Assigning the Tag Property of a Control in WPF

    - by jmayor
    If I have 7 checkBoxes, one for each day of the week, Can I assing in XAML the Tag property to each one of the the System.DayOfWeek enumeration value? <StackPanel > <StackPanel.Resources> <system:DayOfWeek x:Key="Monday" >Monday</system:DayOfWeek> </StackPanel.Resources> <CheckBox Name="chkMo" Tag="{StaticResource Monday}">Mo</CheckBox> ... </StackPanel> Is there a way to assign directly the enum value to the tag without using resources?

    Read the article

  • Writing Facebook apps in C#

    - by Water Cooler v2
    Hi, I am a C# developer and fancy the idea of writing a C# app or two to integrate with the Facebook API. I read from this page: http://wiki.developers.facebook.com/index.php/User:C_Sharp that there's this Microsoft SDK for Facebook Platform that has binary assemblies that I can use to write my C# app. As a start, I want to try out the example mentioned on the above-mentioned page -- one that gets me a friend list. The problem is: I am completely new to this Facebook development thing and I see I am going to need, at the very least, an API Key and some Facebook service Secret key or some such, to begin writing some code. Do I also need a developer account? Where do I get all these things from?

    Read the article

  • Can computer crashes and reboots mean weak power supply?

    - by TomA
    Recently I replaced the videocard in my PC for a newer, faster one. All games work perfectly but I get random system crashes and reboots. This happens even when the system is almost idle (browsing, playing music). It never happened with the old card. All drivers are up-to-date. Is it possible that the power supply is not powerful enough for the new card?

    Read the article

  • Forbid access to DVD/CD/USB for some users

    - by alex2k8
    I need to forbid all users except administrators to write into DVD/CD/USB drives on Windows XP. Googled around and there is a way to disable devices completely: Cdrom: HKEY_LOCAL_MACHINE\SYSTEM\CurrentControlSet\Services\cdrom\Start (from 1 to 4) Usb: HKEY_LOCAL_MACHINE\SYSTEM\CurrentControlSet\Services\USBSTOR (from 3 to 4) but I need to disable them only for particular users.

    Read the article

  • Measuring device drivers CPU/IO utilization caused by my program

    - by Lior Kogan
    Sometimes code can utilize device drivers up to the point where the system is unresponsive. Lately I've optimized a WIN32/VC++ code which made the system almost unresponsive. The CPU usage, however, was very low. The reason was 1000's of creations and destruction of GDI objects (pens, brushes, etc.). Once I refactored the code to create all objects only once - the system became responsive again. This leads me to the question: Is there a way to measure CPU/IO usage of device drivers (GPU/disk/etc) for a given program / function / line of code?

    Read the article

  • Problem with running c# application on another PC

    - by draghia-aurelian
    I wrote a Windows Form Application in C# and it works well for my computer. But on another PC, an error occurs when i try to do some stuff. code 1 private void rUNToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in rUNToolStripMenuItem_Click!"); ... } code 2 private void dataPositionToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in dataPositionToolStripMenuItem_Click!"); ... } Running on my computer: code1: MessageBox appears! code2: MessageBox appears! Running on another computer: code1: MessageBox doesn't appear and the error happens! code2: MessageBox appears! The error is: Method not found: "Void Microsoft.CSharp.RuntimeBinder.CSharpGetMemberBider..ctor(System.String.System.Type, System.Collections.Generic.IEnumerable'1)'. This is the PrintScreen with error: Please help me to solve the problem!

    Read the article

  • Problem regarding listShuttle component in richFaces ?

    - by Hari
    I am a newbee for Richfaces components, When i am using the <rich:listShuttle> the Arraylist specified in the targetValue is now getting updated with the latest data? Kindly help MyJSF File <a4j:region> <rich:listShuttle sourceValue="#{bean.selectItems}" id="one" targetValue="#{bean.selectItemsone}" var="items" listsHeight="150" sourceListWidth="130" targetListWidth="130" sourceCaptionLabel="Intial Items" targetCaptionLabel="Selected Items" converter="Listconverter"> <rich:column> <h:outputText value="#{items.value}"></h:outputText> </rich:column> </rich:listShuttle> </a4j:region> <a4j:region> <a4j:commandButton value="Submit" action="#{bean.action}" /> </a4j:region> My Managed Bean enter code here private List<String> selectedData; private List<BeanItems> selectItems; private List<BeanItems> selectItemsone; public String action() { System.out.println(selectItems); System.out.println(selectItemsone); System.out.println("Select Item List"); Iterator<BeanItems> iterator = selectItems.iterator(); while (iterator.hasNext()) { BeanItems item = (BeanItems) iterator.next(); System.out.println(item.getValue()); } System.out.println("/nSelect Item one list "); Iterator<BeanItems> iterator2 = selectItemsone.iterator(); while (iterator2.hasNext()) { BeanItems item = (BeanItems) iterator2.next(); System.out.println(item.getValue()); } return ""; } public void setSelectedData(List<String> selectedData) { this.selectedData = selectedData; } public List<String> getSelectedData() { return selectedData; } /** * @return the selectItems */ public List<BeanItems> getSelectItems() { if (selectItems == null) { selectItems = new ArrayList<BeanItems>(); selectItems.add(new BeanItems("value4", "label4")); selectItems.add(new BeanItems("value5", "label5")); selectItems.add(new BeanItems("value6", "label6")); selectItems.add(new BeanItems("value7", "label7")); selectItems.add(new BeanItems("value8", "label8")); selectItems.add(new BeanItems("value9", "label9")); selectItems.add(new BeanItems("value10", "label10")); } return selectItems; } /** * @return the selectItemsone */ public List<BeanItems> getSelectItemsone() { if (selectItemsone == null) { selectItemsone = new ArrayList<BeanItems>(); selectItemsone.add(new BeanItems("value1", "label1")); selectItemsone.add(new BeanItems("value2", "label2")); selectItemsone.add(new BeanItems("value3", "label3")); } return selectItemsone; } My Converter Class enter code here public Object getAsObject(FacesContext context, UIComponent component,String value) { int index = value.indexOf(':'); return new BeanItems(value.substring(0, index), value.substring(index + 1)); } public String getAsString(FacesContext context, UIComponent component,Object value) { BeanItems beanItems = (BeanItems) value; return beanItems.getValue() + ":" + beanItems.getData(); } My BeanItems Class enter code here private String data; //Getter & setter private String value; //Getter & setter public BeanItems() { } public BeanItems(String value, String data) { this.value = value; this.data = data; } public int hashCode() { final int prime = 31; int result = 1; result = prime * result + ((data == null) ? 0 : data.hashCode()); result = prime * result + ((value == null) ? 0 : value.hashCode()); return result; } public boolean equals(Object obj) { if (this == obj) return true; if (obj == null) return false; if (getClass() != obj.getClass()) return false; final BeanItems other = (BeanItems) obj; if (data == null) { if (other.data != null) return false; } else if (!data.equals(other.data)) return false; if (value == null) { if (other.value != null) return false; } else if (!value.equals(other.value)) return false; return true; }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • building mono from svn - android target

    - by Jeremy Bell
    There were patches made to mono on trunk svn to support android. My understanding is that essentially instead of Koush's system which builds mono using the android NDK build system directly, these patches add support for the android NDK using the regular mono configure.sh process. I'd like to play around with this patch, but not being an expert in the mono build system, I have no idea how to tell it to target the android NDK, or even where to look. I've been able to build mono from SVN using the default target (linux) on Ubuntu, but no documentation on how to target android was given with the patches. Since anyone not submitting or reviewing a patch is generally ignored on the mono mailing list, I figured I'd post the question here.

    Read the article

  • What is the Worst Depiction of Computer Use in a Movie

    - by Robert Cartaino
    You know the type: "It's a Unix system. I know this" -- in Jurassic park where a computer-genius girl sees a computer and quickly takes over like a 3-D video game, flying through the file system to shut down the park. [video link to the scene] So what's your favorite movie gaff that shows Hollywood can be completely clueless when it comes to portraying technology?

    Read the article

  • Enable access for assistive device programmatically

    - by Dheeraj
    Hi All, I want to enable Access for assistive devices in System Preferences programmatically. But Problem is that my application is not running as root user and i do not want my application to be as root user and also should not ask for any authentication in between. I want to tap all keyboard events globally. I am using CGEventTapCreate() for the same.In the documentation of CGEventTapCreate() API it is mentioned that, Event taps receive key up and key down events if one of the following conditions is true: The current process is running as the root user. Access for assistive devices is enabled. In Mac OS X v10.4 & later, you can enable this feature using System Preferences, Universal Access panel, Keyboard view. I tried manually by checking the Enable Access for assistive devices from System Preference and it gives me expected output. So is there any way to do the same via program without asking for authentication and also application is not running as root user? Thanks, Dheeraj.

    Read the article

  • NDepend: How to not display 'tier' assemblies in dependency graph?

    - by Edward Buatois
    I was able to do this in an earlier version of nDepend by going to tools-options and setting which assemblies would be part of the analysis (and ignore the rest). The latest version of the trial version of nDepend lets me set it, but it seems to ignore the setting and always analyze all assemblies whether I want it to or not. I tried to delete the "tier" assemblies by moving them over to the "application assemblies" list, but when I delete them out of there, they just get added back to the "tier" list, which I can't ignore. I don't want my dependency graph to contain assemblies like "system," "system.xml," and "system.serialization!" I want only MY assemblies in the dependency graph! Or is that a paid-version feature now? Is there a way to do what I'm talking about?

    Read the article

  • WxPython Incompatible With Snow Leopard?

    - by Alex
    Hello all, Recently I upgraded to Snow Leopard, and now I can't run programs built with wxPython. The errors I get are (from Eclipse + PyDev): import wx File "/var/tmp/wxWidgets/wxWidgets-13~231/2.6/DSTROOT/System/Library/Frameworks /Python.framework/Versions/2.6/Extras/lib/ python/wx-2.8-mac-unicode/wx/__init__.py", line 45, in <module> File "/var/tmp/wxWidgets/wxWidgets-13~231/2.6/DSTROOT /System/Library/Frameworks/Python.framework/Versions/2.6/Extras/lib /python/wx-2.8-mac-unicode/wx/_core.py", line 4, in <module> ImportError:/System/Library/Frameworks /Python.framework/Versions/2.6/Extras/lib/python /wx-2.8-mac-unicode/wx/_core_.so: no appropriate 64-bit architecture (see "man python" for running in 32-bit mode) I don't really understand them and would appreciate if you could help me to do so, also, if you do know what's going on, how can I go about fixing them? Maybe this has something to do with the fact that Snow Leopard is 64-bit? Thanks!!

    Read the article

  • Make a Phone ring from BASH through a HUAWEI e220

    - by microspino
    Hello, I have a Debian Linux system with a HUAWEI e220 on /dev/ttyUSB0. I'd like to make It ring a generic GSM phone for just one time. I'm doing this because I'd like to build an embedded system that fires some special behavior by a single GSM phone ring. How can I do It? I've tried wvdial but I receive always a "NO CARRIER" answer when I try to send It an "ATDT XXX-phone-number-to-dial-XXX" command.

    Read the article

  • missing entry in launchctl after restart

    - by Nobik
    I have a deamon which is registered with launchctl to run as system-wide-daemon and to load automatically with every system startup or if the daemon crashes. I have registered this daemon with: sudo launchctl load -w /Library/LaunchDaemons/plist.file Everything works fine. My daemon is registered and with sudo launchctl list I can find the entry at launchctl But on some Macs after the user restarts the system, my daemon is not running. And with the command sudo launchctl list I can't find the entry anymore. Any ideas, why the entry is missing???

    Read the article

  • SSH Advanced Logging

    - by Radek Šimko
    I've installed OpenSUSE on my server and want to set ssh to log every command, which is send to system over it. I've found this in my sshd_config: # Logging # obsoletes QuietMode and FascistLogging #SyslogFacility AUTH #LogLevel INFO I guess that both of those directives has to be uncommented, but I'd like to log every command, not only authorization (login/logout via SSH). I just want to know, if someone breaks into my system, what did he do.

    Read the article

  • What's wrong with this SQL Server query ?

    - by ClixNCash
    What's wrong this T-SQL query : Protected Sub Button1_Click(ByVal sender As Object, ByVal e As System.EventArgs) Handles Button1.Click Dim SQLData As New System.Data.SqlClient.SqlConnection("Data Source=.\SQLEXPRESS;AttachDbFilename=|DataDirectory|\Database.mdf;Integrated Security=True;User Instance=True") Dim cmdSelect As New System.Data.SqlClient.SqlCommand("SELECT COUNT(*) FROM Table1 WHERE Name ='" + TextBox1.Text + "'", SQLData) SQLData.Open() If cmdSelect.ExecuteScalar > 0 Then Label1.Text = "You have already voted this service" Return End If Dim con As New SqlConnection Dim cmd As New SqlCommand con.Open() cmd.Connection = con cmd.CommandText = "INSERT INTO Tabel1 (Name) VALUES('" & Trim(Label1.Text) & "')" cmd.ExecuteNonQuery() Label1.Text = "Thank You !" SQLData.Close() End Sub

    Read the article

  • Storing millions of URLs in a database for fast pattern matching

    - by Paras Chopra
    I am developing a web analytics kind of system which needs to log referring URL, landing page URL and search keywords for every visitor on the website. What I want to do with this collected data is to allow end-user to query the data such as "Show me all visitors who came from Bing.com searching for phrase that contains 'red shoes'" or "Show me all visitors who landed on URL that contained 'campaign=twitter_ad'", etc. Because this system will be used on many big websites, the amount of data that needs to log will grow really, really fast. So, my question: a) what would be the best strategy for logging so that scaling the system doesn't become a pain; b) how to use that architecture for rapid querying of arbitrary requests? Is there a special method of storing URLs so that querying them gets faster? In addition to MySQL database that I use, I am exploring (and open to) other alternatives better suited for this task.

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 617 618 619 620 621 622 623 624 625 626 627 628  | Next Page >