Search Results

Search found 23567 results on 943 pages for 'max link'.

Page 626/943 | < Previous Page | 622 623 624 625 626 627 628 629 630 631 632 633  | Next Page >

• QNAP TS-419p as a VPN Gateway?

  - by heisenberg

  Hello, I am hoping one of you might be able to help. I want to make files stored on shared folders on a QNAP TS-409p available to users over a VPN link. How is the possible? Can someone explain what I need to do. What do I need to do at the router and what do I need to do on the QNAP NAS? Effectively, what I want do do is use the built in Windows vpn client to connect to my home network and then be able to browse the shared folders. Thanks in advance.

  Read the article

• moving my site, IP change worries...

  - by Sherif Buzz

  Hi all, my site has outgrown the shared hosting account it's on and i've setup a VPS that i'll be moving to soon. I cannot keep the same IP between my new account and the old one and I'm a bit at loss as to how to minimize user downtime while the new IP is reflected in all DNS caches. Note I cannot have the site running on both accounts at the same time as it's a dating site and this would cause data inconsistency. Here's what i am planning to do : Put up a 'under maintenance' page on old host Get the site up and running on new host, and update domain to point to new host. Hope downtime isn't too long. Would it be a good idea to have a link on the page in (1) that opens the new site but using it's ip ? Or even redirect all requests at the old host, to the new one (again by ip) ? Any advice much appreciated.

  Read the article

• Problem accessing the remote working space on my new SBS 2008 box

  - by Dabblernl

  This supposedly easy to install OS is starting to drive me nuts... SYMPTOMS: When trying to connect to the remote workplace I get (and ignore) the security warning because I am currently testing with the self issued certificate. After loggin in the remote workplace's main screen displays but the images on it do not load. When I try to click the email link I am thrown back to the login screen. If I try the login to exchange directly by typing in the remote.mydomain.com/owa address I get a 403 error that I am denied access. The problem occurs on both a vista and a win 7 machine. It seems that some security setting is playing tricks with me. How can I troubleshoot this?

  Read the article

• Little server for a little network: Asus TS Mini + Windows Home Server or other?

  - by microspino

  Hello, I'm building a little network with 4 computer a plotter, 3 printers an a HP Fax/Scan/Copy/Print machine. The network is connected to the web by a D-Link router/firewall. I would like to add little server to have file sharing (reachable via VPN from outside by a single user-road-warrior), automatic backups. I would like to avoid big electrics bills or, to say It in a green way, I would like to avoid useless power consumption made by a big server with hot-plug, Raid, double PSU because I don't need all this stuff. The server must work 24/7 and the budget is between 400€ and 1000€. I'm evaluating the Asus EEE Box (with XP), a TranquilPC (with XP), a FitPC (again with XP), and an Asus TS Mini (with Windows Home Server). I like the latter but since I'm Europe I don't know where I can buy It. Do you have any suggestion/experience to share with me about: which hardware do I have to buy ? which O.S. ?

  Read the article

• Trouble getting PHP, Apache, and Zend talking to eachother (localhost)

  - by Joel

  Hi guys, I've searched through several other questions, but haven't found my solution. THe main reason is that I'm not even sure if I have all these things properly installed. I have a hosting account, and have always just deployed everything into the internets, but I'm finally trying to figure out how to get my desktop set up right for learning Zend Framework. I have Apache Server 2.2, PHP, And Zend Framework installed. I'm trying to do this tutorial: http://akrabat.com/wp-content/uploads/Getting-Started-with-Zend-Framework.pdf The problem is when I click on the link: http://localhost/zf-tutorial/public I get an Error 404. If I type in http://www.localhost I get "It Works!" in the browser. I'm thinking this means I have Apache installed correctly, but am not pointing correctly to the Zend tutorial? Thanks for any help!

  Read the article

• Remote desktop connection over internet without port forwarding?

  - by hellbell.myopenid.com

  Hello, let's say that we have this situation. I want to remote desktop connection to my friend over the internet, but I don't have premission for port forwarding on the router, and my friend also can't configure his router. So the question is how to connect to computer without port forwarding, I know that is out there some programs like teamviewer, or some else that solve that task, but what I looking for is the some free site that can make "bridge" between are two computer, or is it possible to install on computer some program that simulate virtual router or something like this http://www.youtube.com/watch?v=SIof7kFTgJE .... I need this cause I have my own simple remote desktop connection program, but I can't connect to other computer outside network cause don't have premission to configure router :( any comment, link, advice, or tutorials will be very helpful :)

  Read the article

• How can I prevent JungleDisk/MacOS X (10.6) creating a local volume for a removed external drive?

  - by Rew

  Ok, here is situation: I use JungleDisk to sync an online folder on to a external drive connected to my Mac. If I right click Finder, click Go to Folder... then type /Volumes/ I see the drive linked here. Once I remove the external drive, an actual folder is created here in the name of the external drive, JungleDisk continues to copy files to this folder, rather than stop. Is this a feature of Mac OS X? Can I turn if off? After I re-connect my external drive, the link to the drive is appended with a 1 (so if I called the drive SpareDrive it becomes SpareDrive 1 as the newly created folder is called SpareDrive. I realise my explanation isn't very clear, but anyone understand this, and knows how to prevent it happening please let me know. PS: I have a low reputation as I don't use this often, I tend to use stackoverflow, but will check back here for answers.

  Read the article

• Install Problems on ASUS X401A Notebook

  - by tired_of_trying

  okay... I tried many approaches to install Ubuntu 12.xxx on my new Asus notebook with varying degrees of failure... First: I'm not a newbie but I'm as frustrated as one! Install background: Install from USB DVD drive: The install went well. Re-booted machine. choose ubuntu and it errors with a MBR file error (can't remember the exact wording - something to do with missing the file. Choosing to boot W7 works fine. Install from USB Stick: Couldn't get machine to recognize the .iso Install into Oracle's Vbox: Got the boot splash screen, then hangs with a zillion errors. Note: I didn't have any problems installing ubuntu in Vbox on my iMac and it run's great. Installed using wubi: Installed fine but get errors when booting ubuntu (it doesn't find the needed wubi files). I downloaded to the C: drive and tried installing from there - no luck. For kicks: I tried running Slax Linux .iso from a USB stick and it runs fine. Some Questions: Did I use the correct .iso? (I tried 12.04.0 and 12.04.1 both 32 and 64 bit versions. I simply downloaded them from the download link and didn't use/look for an alternate version. Do I need to do something special when burning the .iso to disc? What? I did read tons of posts but, no luck with finding the solution. Any help is appreciated... thanks

  Read the article

• Is Apache ReverseProxy to Passenger Standalone an acceptable production deployment?

  - by davetron5000

  I have the need to deploy Rails 3 apps, using RVM and gemsets, and am expecting “public” traffic (i.e. this is not an internal-only app). I also must use Apache as the public interface to my app. I understand that Passenger Standalone can help accomplish the rails/RVM end, and I have successfully set it up in my development environment. My question is how viable this setup is for a production deployment. Is deploying via Apache configured to ReverseProxy to my passenger-powered Rails app going to create problems? Since I'm designing the production deployment now, I want to understand if I should spend the additional time to set up Passenger connected to Apache and have that Passenger communicate with Passenger Standalone instance running my Rails app. So, I'm looking for one of I guess three answers: Apache Reverse Proxy to Passenger Standalone will be generally fine You should not use the Apache/Passenger Standalone configuration, but set up Passenger on the Apache side as well Your entire setup is just Wrong, please RTFM (and include link to "FM")

  Read the article

• Redirection & SEO related stuff while moving to a new blog

  - by Karshim Kanwar

  I have a WordPress blog and recently I have setup a new blog lets call the old blog as blog old and new blog as blog new. What I did is moved the content, photos, pictures and all 250 posts from blog old to blog new. Both the blog name are changed as they are pointing to different domain names! I read helpful things in this site itself at here. I will no longer use blog old, moreover I am concerned about the SEO of the blog new. The blog new is fairly new (just 24 hours and no pages have been indexed in Google). I have done the following stuff: Deleted all the post share at Facebook fan Page, Twitter profile, Google+ page and Finally deleted the fan page/Twitter, Google+ page. Edited the link backs of old blog in the blog new. The question I have is: How do I prevent duplicate content issues? Do I go straightaway and delete all the posts in blog old? Should I start sharing the blog posts in blog new? Should I submit the new site to Webmaster Tools or wait for few weeks? Every comment here is appreciated! What issues can I face relating to SEO?

  Read the article

• why page is automatically redirecting to some other sites

  - by raj

  In my browser (Firefox 10.0.7) the page is automatically redirect to some other sites without clicking any link. If I enter the superuser.com url after pressing Enter button, It redirect to some other sites. sometimes while refreshing also the page is redirect to some other site. It's redirecting to this sites http://result.seenfind.com/ncp/Default.aspx?term=gatlinburg%20cabin&u=1000670913 http://search.cpvee.com/search.php?q=gatlinburg+cabin&y=&f=2168&s= http://www.insidecelebritygossip.com/ I cleared all history and all but still same problem. I am using CentOS 6.3

  Read the article

• model association or controller?

  - by andybritton

  I'm trying to create a rails app that allows users to submit information about their pets. I've come to a point where my knowledge is limited and I don't know enough about what/how this could be done so I'm hoping this will be relatively easy to answer. At the moment I have a model called Pet, this model currently stores basic information like name, picture etc but it also holds more specific data like type, breed, date of birth etc. What I would like to be able to do is create a page that can match various records without having to be manually categorized if that makes sense so a users pet could be matched to other pets with the same breed, age etc. I've read about nested models as I understand this information could be submitted to 2 models in one form but I am not sure whether this could be done directly in a separate controller which would only be visible to users with pets in these matched "groups" if that makes sense. So in essence is it best practice to use 1 table to store all the information and just use a controller to match pets based on rows having the same values or would it be far simpler to have a form with a nested model and link 2 tables together? The main feature needs to be matching without a user having to create a group or categorize pets so the second model would need to add id's to an array instead of just creating more and more rows.

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Why is my email server in AT&T's blacklist?

  - by legoscia

  I just got this bounce message: <¦¦¦¦¦¦¦¦@att.net>: host scc-mailrelay.att.net[204.127.208.75] said: 521-88.208.246.34 blocked by sbc:blacklist.mailrelay.att.net. 521 DNSRBL: Blocked for abuse. See http://att.net/blocks (in reply to MAIL FROM command) So I'm trying to figure out why our server ended up on their blacklist. The web page link doesn't tell me why, as far as I can see. From a few multi-RBL tools I conclude that our IP is only on the collateral damage lists of uceprotect.net (you can be exempt from that with a paid subscription), and I dearly hope that AT&T doesn't use that. From the mail server logs I see that an email to another @att.net address went through two days ago without being blocked. Does anyone have any ideas how I can find out what went wrong?

  Read the article

• What is your approach to draw a representation of your network ?

  - by Kartoch

  Hello, I'm looking to the community to see how people are drawing their networks, i.e. using symbols to represent complex topology. You can have hardware approach, where every hardware unit are represented. You can also have "entity" approach, where each "service" is shown. Both are interesting but it is difficult to have both on the same schema (but this is needed, especially using virtualization environment). Furthermore, it is difficult to have complex informations on such representation. For instance security parameters (encrypted link, need for authentication) or specific details (protocol type, ports, encapsulation). So my question is: where your are drawing a representation of your network, what is your approach ? Are you using methodology and/or specific softwares ? What is your recommendations for information to put (or not) ? How to deal with the complexity when the network becomes large and/or you want to put a lot of information on it ? Examples and links to good references will be appreciated.

  Read the article

• My Router is fast when i reset it but slows down seconds later

  - by hglocke

  I have a Belkin N wireless router which until recently worked perfectly fine. Now i have to reset the router every few minutes, otherwise it slows down to a crawl. What can I do? I have tried turning the routers firewall off, but it does not make any difference. As far as I'm aware there have been no recent firmware updates. EDIT: The other devices on my network (laptop and iphone) do not have this problem. I connect to the router using a TP-Link wireless network card and I have already tried uninstalling and installing the driver. Hopefully this will narrow down the problem significantly.

  Read the article

• mod_rewrite hide subdirectory in return url part2

  - by user64790

  Hi I am having an issue trying to get my mod_rewrite configuration correctly i have a site: 0.0.0.0/oldname/directories/index.php I would like to rename "oldname" to "newname" resulting in: 0.0.0.0/newname/directories/index.php etc.. So when a user navigates to 0.0.0.0 my site will automatically send them to 0.0.0.0/oldname/index.php I'm not planning on moving my content marketing have asked me to rename the site folder I would like to mask the request of 0.0.0.0/oldname/index.php to 0.0.0.0/newname/index.php Also if a user navigates from index.php to an link of say /oldname/project1/index.Php the final browsers returned URL will be /newname/project1.php without having to move or edit site links. I also understand my hyperlinks will refer to /oldname but this is acceptable any help would be highly appreciated. Regards

  Read the article

• Create Adjustable Depth of Field Photos with a DSLR

  - by Jason Fitzpatrick

  If you’re fascinating by the Lytro camera–a camera that let’s you change the focus after you’ve taken the photo–this DSLR hack provides a similar post-photo focus processing without the $400 price tag. Photography tinkers at The Chaos Collective came up with a clever way of mimicking the adjustable depth-of-field adjustment effect from the Lytro camera. The secret sauce in their technique is setting the camera to manual focus and capturing a short 2-3 second video clip while they rotate the focus through the entire focal range. From there, they use a simple applet to separate out each frame of the video. Check out the interactive demo below: Anywhere you click in the photo shifts the focus to that point, just like the post processing in the Lytro camera. It’s a different approach to the problem but it yields roughly the same output. Hit up the link below for the full run down on their technique and how you can get started using it with your own video-enabled DLSR. Camera HACK: DOF-Changeable Photos with an SLR [via Hack A Day] Secure Yourself by Using Two-Step Verification on These 16 Web Services How to Fix a Stuck Pixel on an LCD Monitor How to Factory Reset Your Android Phone or Tablet When It Won’t Boot

  Read the article

• South Florida Code Camp and Other Events

  - by MOSSLover

  My grandmother wanted me to make her a video when she heard I got MVP in SharePoint Server of one of my sessions.  I decided I haven’t visited in two years, so maybe I can do an in person session.  I googled around and found South Florida Code Camp, which will be Saturday, February 12th.  I will be doing a session at 9:50 in the morning on Silverlight just for my grandmother and whoever shows up.  Here is the link for more information: http://www.fladotnet.com/codecamp/. In the upcoming months I plan to return to SharePoint Saturday speaking.  We are also organizing another New York event on Saturday, July 30th.  We will open up submissions for sponsors and speakers somewhere after Best Practices Conference in LaJolla.  I will be speaking at Best Practices LaJolla and the The Expert’s Conference in the upcoming months.  I am really sorry for the lack of updates it’s just been incredibly crazy going back and forth to DC and not having internet on weekdays or having the slowest internet in the world has just not helped.  I am also trying to attend Coders 4 Charity this year, so I can visit some people in St. Louis.  I’ve already got an incredibly crazy schedule going for the year.  I might be helping organize more events.  I’m going to volunteer at New York Code Camp too doing whatever they need this year.  Check back for more updates. Technorati Tags: SharePoint Conferences 2011,Events 2011

  Read the article

• aptana/eclipse blocks other apps

  - by waquner

  Hi, I've got a fresh win7 installation, the only apps installed so far are aptana (beta 3)/eclipse and firefox + chrome (except antivirus and drivers) Every time I start aptana, chrome and firefox are blocked, so firefox can't load a webpage (or sometimes takes veeeery long) and chrome doesn't even take care of events (so for example hovering over a link doesn't change the cursor and a click does...nothing or typing in an url, press enter - nothing happens) First I thought, aptana downloads something and blocks my internet connection... but IE works well and also there are no signs in the taskmanager (cpu%, network or memory) When I close Aptana, all works as before. I tried updating Java, which didn't help... On my office-computer I use the same apps and it works perfect. Got any ideas? TIA, waquner

  Read the article

• invite: PARTNER WEBCAST: INNOVATIONS IN PRODUCTS - PROGRAM

  - by mseika

  PARTNER WEBCAST: INNOVATIONS IN PRODUCTS - PROGRAMOCTOBER 1ST, 2012 AT 04:00 PM CET (03:00 PM GMT)Dear partner I am pleased to invite you to join the Innovations in Products – webcast. Innovations in Products will present Oracle Product's new functions and features including sales positioning. The key objectives of these webcasts are to inspire System Integrator's implementation personnel to conduct successful after sales in their Customer projects. Innovations in Products will be presented on the 1st Monday of each quarter after the billable day (4:00 to 5:00 PM CET). The webcast is intended for System Integrator's Implementation Certified Specialists but Innovations in Products is open for other system Integrator's personnel as well. At first, two Oracle representatives will discuss Oracle's contribution to partners. Then you will see product breakout session followed by Q&A with Oracle Experts. Each session will last for maximum 1 hour. A Q&A document covering all questions and answers will be made available after the webcast. What are the Benefits for partners? Find out how Innovations in Products helps you to improve your after sales Discover new functions and features so you can enrich your Customers's solution Learn more about Oracle products, especially sales positioning Hear crucial questions raised by colleague alike, learn from their interest Engage and present your questions to subject experts Be inspired of the richness of Oracle's product portfolio – for your and your customer’s benefit. Note: Should you already be familiar with a specific Product, then choose another one. Doing so you would expand your knowledge of the overall product portfolio. Some presentations contain product demonstration, although these presentations are not intended to be extremely detailed technical presentations. Product breakout sessions available on October 1st - please click here.  To access previously presented 23 Applications Products presentations and 6 Public Sector Value Proposition presentations, please click here. You might want to bookmark the overall registration page Innovations in Products October 1st and the global event calendar page events.oracle.com. Delivery Format Innovations in Products – program is a series of FREE prerecorded Oracle product presentations followed by Q&A. It will be delivered over the Web. Participants have the opportunity to submit questions during the web cast via chat and subject matter experts will provide verbal answers live. Innovations in Products consists of several parallel prerecorded product breakout sessions, each lasting for max. 1 hour. At first, two Oracle representatives will discuss Oracle’s contribution to Partners. Then you’ll see the product breakout sessions followed by Q&A with Oracle Experts. A Q&A document covering all questions and answers will be made available after the webcast. You can also see Innovations in Products afterwards as its content will be available online for the next 6-12 months.The next Innovations in Products web casts will be presented as follows: October 1st 2012 January 14th 2013 April 8th 2013. Note: Depending on local network bandwidth please allow some seconds time the presentations to download. You might want to refresh your screen by pressing F5. DurationMaximum 1 hour For further information please contact me Markku Rouhiainen. Best regards Markku RouhiainenDirector, Applications Partner Enablement EMEA

  Read the article

• Compilation problem [closed]

  - by Misery

  I am trying to compile a program called Triangle Mesh Generator. It is an open source code written in ANSI C. I need it to bo a callable lib so I am using a switch (#define) created by it's Author. However I get this error: /usr/lib/gcc/x86_64-linux-gnu/4.6/../../../x86_64-linux-gnu/crt1.o: In function `_start': collect2: ld returned 1 exit status make: *** [triangle] Error 1 I am not sure why such an error occurs. Worth adding is that compiling it as a stand alone program is succesful. I am using GCC on 12.04. The lines quoted above constitute the total output. What I put in the terminal is just make in the proper folder. There are no other errors, warnings, or other messages. Link to the sources I found some additional instructions. I'll get back after reading them :] EDIT: I have found some additional instructions that let me compile it. Thanks for help. I am closing question right now. Regards

  Read the article

• How to enable winhlp on Windows7 64bit?

  - by BGM

  Salvete! I just discovered that winhlp32.exe won't run on Windows7 64bit. I can't run the application, and I can't run hlp files either (but .chm files run fine). How do I make this work? I have downloaded the Microsoft fix here and restarted my computer, but to no avail. I can see the file winhlp32.exe in my c:\windows directory, but cannot run it. When I do run it, I get Windows' own "Help and Support" entitled, "Why can't I get Help from this program?" which sends me to the link above! How can I make it work?

  Read the article

• Community TFS Build Manager available for Visual Studio 2012 RC

  - by Jakob Ehn

  I finally got around to push out a version of the Community TFS Build Manager that is compatible with Visual Studio 2012 RC. Unfortunately I had to do this as a separate extension, it references different versions of the TFS assemblies and also some properties and methods that the 2010 version uses are now obsolete in the TFS 2012 API. To download it, just open the Extension Manager, select Online and search for TFS Build:   You can also download it from this link: http://visualstudiogallery.msdn.microsoft.com/cfdb84b4-285e-4eeb-9fa9-dad9bfe2cd10 The functionality is identical to the 2010 version, the only difference is that you can’t start it from the Team Explorer Builds node (since the TE has been completely rewritten and the extension API’s are not yet published). So, to start it you must use the Tools menu: We will continue shipping updates to both versions in the future, as long as it functionality that is compatible with both TFS 2010 and TFS 2012. You might also note that the color scheme used for the build manager doesn’t look as good with the VS2012 theme….   Hope you will enjoy the tool in Visual Studio 2012 as well. I want to thank all the people who have downloaded and used the 2010 version! For feedback, feature requests, bug reports please post this to the CodePlex site: http://tfsbuildextensions.codeplex.com

  Read the article

• Installing multiple versions of a shared library

  - by nsfyn55

  I am running ubuntu 10.04 and I want to use tmux 1.6. tmux has a dependency on libevent 2. My solution was to compile libevent2 and drop into /usr/local/lib then compile tmux against this lib and drop into /usr/local/bin. This works great until...I restart. This is just an assumption on my part but it seems that other binaries are now linking to the libevent2 library presumably because its on the library path. Because there are 60+ packages with libevent1 dependencies this causes my install to basically lose its mind. Is there an idiomatic way to approach running an application that has a core library dependency on a different version? Should I just statically link the lib?

  Read the article

< Previous Page | 622 623 624 625 626 627 628 629 630 631 632 633  | Next Page >