Search Results

Search found 7793 results on 312 pages for 'vijay dev'.

Page 64/312 | < Previous Page | 60 61 62 63 64 65 66 67 68 69 70 71  | Next Page >

  • How to get a cell value in JQGrid?

    - by dev
    How to get a cell value in JQGrid? If I use the following syntax – var ret = jQuery("#MyGrid").jqGrid('getRowData', id); ret = ret.ProductId; it returns the following HTML. I actually need the value of the cell. Thanks. Dev

    Read the article

  • can't use periods in ServerName [Lion Apache installation]

    - by punchfacechamp
    I can access my host like this… http://keggyshop but can't use periods… http://keggyshop.dev here's my virtual host directive… <VirtualHost *:80> ServerName keggyshop ServerAlias keggyshop.dev DocumentRoot "~/sites/2012/keggy/web/pages/keggy/120528/sandbox/public" <Directory "~/sites/2012/keggy/web/pages/keggy/120528/sandbox/public"> Options Includes FollowSymLinks AllowOverride All Order allow,deny Allow from all </Directory> </VirtualHost> host file 127.0.0.1 keggyshop 127.0.0.1 keggyshop.dev traceroute for keggyshop… user$ traceroute keggyshop traceroute to keggyshop (192.168.1.184), 64 hops max, 52 byte packets 1 keggyshop (192.168.1.184) 1.188 ms 0.683 ms 0.747 ms traceroute for keggyshop.dev… user$ traceroute keggyshop.dev traceroute: Warning: keggyshop.dev has multiple addresses; using 184.106.15.239 traceroute to keggyshop.dev (184.106.15.239), 64 hops max, 52 byte packets 1 * 192.168.1.1 (192.168.1.1) 0.856 ms 0.568 ms 2 10.81.192.1 (10.81.192.1) 15.232 ms 7.002 ms 7.936 ms 3 gig-0-3-0-6-nycmnya-rtr2.nyc.rr.com (24.29.97.122) 7.962 ms 7.813 ms 7.712 ms 4 bun101.nycmnytg-rtr001.nyc.rr.com (184.152.112.107) 10.999 ms 14.001 ms 15.466 ms 5 bun6-nycmnytg-rtr002.nyc.rr.com (24.29.148.250) 11.231 ms 17.321 ms 12.745 ms 6 107.14.19.24 (107.14.19.24) 13.972 ms 11.704 ms 16.477 ms 7 ae-1-0.pr0.nyc30.tbone.rr.com (66.109.6.161) 9.237 ms 11.896 ms 107.14.19.153 (107.14.19.153) 7.481 ms 8 xe-5-0-6.ar2.ewr1.us.nlayer.net (69.31.94.57) 16.682 ms 11.791 ms 11.981 ms 9 ae3-90g.cr1.ewr1.us.nlayer.net (69.31.94.117) 12.977 ms 15.706 ms 9.709 ms 10 xe-5-0-0.cr1.ord1.us.nlayer.net (69.22.142.74) 30.473 ms 30.497 ms 31.750 ms 11 ae1-20g.ar1.ord6.us.nlayer.net (69.31.110.250) 36.699 ms 50.785 ms 35.957 ms 12 as19994.xe-1-0-7.ar1.ord6.us.nlayer.net (69.31.110.242) 34.723 ms 31.118 ms 29.967 ms 13 coreb.ord1.rackspace.net (184.106.126.138) 30.471 ms corea.ord1.rackspace.net (184.106.126.136) 33.392 ms 35.210 ms 14 core1-coreb.ord1.rackspace.net (184.106.126.129) 32.453 ms core1-corea.ord1.rackspace.net (184.106.126.125) 32.020 ms core1-coreb.ord1.rackspace.net (184.106.126.129) 32.417 ms 15 core1-aggr401a-3.ord1.rackspace.net (173.203.0.157) 31.274 ms 34.854 ms 30.194 ms

    Read the article

  • How do I tell mdadm to start using a missing disk in my RAID5 array again?

    - by Jon Cage
    I have a 3-disk RAID array running in my Ubuntu server. This has been running flawlessly for over a year but I was recently forced to strip, move and rebuild the machine. When I had it all back together and ran up Ubuntu, I had some problems with disks not being detected. A couple of reboots later and I'd solved that issue. The problem now is that the 3-disk array is showing up as degraded every time I boot up. For some reason it seems that Ubuntu has made a new array and added the missing disk to it. I've tried stopping the new 1-disk array and adding the missing disk, but I'm struggling. On startup I get this: root@uberserver:~# cat /proc/mdstat Personalities : [linear] [multipath] [raid0] [raid1] [raid6] [raid5] [raid4] [raid10] md_d1 : inactive sdf1[2](S) 1953511936 blocks md0 : active raid5 sdg1[2] sdc1[3] sdb1[1] sdh1[0] 2930279808 blocks level 5, 64k chunk, algorithm 2 [4/4] [UUUU] I have two RAID arrays and the one that normally pops up as md1 isn't appearing. I read somewhere that calling mdadm --assemble --scan would re-assemble the missing array so I've tried first stopping the existing array that ubuntu started: root@uberserver:~# mdadm --stop /dev/md_d1 mdadm: stopped /dev/md_d1 ...and then tried to tell ubuntu to pick the disks up again: root@uberserver:~# mdadm --assemble --scan mdadm: /dev/md/1 has been started with 2 drives (out of 3). So that's started md1 again but it's not picking up the disk from md_d1: root@uberserver:~# cat /proc/mdstat Personalities : [linear] [multipath] [raid0] [raid1] [raid6] [raid5] [raid4] [raid10] md1 : active raid5 sde1[1] sdf1[2] 3907023872 blocks level 5, 64k chunk, algorithm 2 [3/2] [_UU] md_d1 : inactive sdd1[0](S) 1953511936 blocks md0 : active raid5 sdg1[2] sdc1[3] sdb1[1] sdh1[0] 2930279808 blocks level 5, 64k chunk, algorithm 2 [4/4] [UUUU] What's going wrong here? Why is Ubuntu trying to pick up sdd into a different array? How do I get that missing disk back home again? [Edit] - After adding the md1 to mdadm.conf it now tries to mount the array on startup but it's still missing the disk. If I tell it to try and assemble automatically I get the impression it know it needs sdd but can't use it: root@uberserver:~# mdadm --assemble --scan /dev/md1: File exists mdadm: /dev/md/1 already active, cannot restart it! mdadm: /dev/md/1 needed for /dev/sdd1... What am I missing?

    Read the article

  • Recover harddrive data

    - by gameshints
    I have a dell laptop that recently "died" (It would get the blue screen of death upon starting) and the hard drive would make a weird cyclic clicking noises. I wanted to see if I could use some tools on my linux machine to recover the data, so I plugged it into there. If I run "fdisk" I get: Disk /dev/sdb: 20.0 GB, 20003880960 bytes 64 heads, 32 sectors/track, 19077 cylinders Units = cylinders of 2048 * 512 = 1048576 bytes Disk identifier: 0x64651a0a Disk /dev/sdb doesn't contain a valid partition table Fine, the partition table is messed up. However if I run "testdisk" in attempt to fix the table, it freezes at this point, making the same cyclical clicking noises: Disk /dev/sdb - 20 GB / 18 GiB - CHS 19078 64 32 Analyse cylinder 158/19077: 00% I don't really care about the hard drive working again, and just the data, so I ran "gpart" to figure out where the partitions used to be. I got this: dev(/dev/sdb) mss(512) chs(19077/64/32)(LBA) #s(39069696) size(19077mb) * Warning: strange partition table magic 0x2A55. Primary partition(1) type: 222(0xDE)(UNKNOWN) size: 15mb #s(31429) s(63-31491) chs: (0/1/1)-(3/126/63)d (0/1/32)-(15/24/4)r hex: 00 01 01 00 DE 7E 3F 03 3F 00 00 00 C5 7A 00 00 Primary partition(2) type: 007(0x07)(OS/2 HPFS, NTFS, QNX or Advanced UNIX) (BOOT) size: 19021mb #s(38956987) s(31492-38988478) chs: (4/0/1)-(895/126/63)d (15/24/5)-(19037/21/31)r hex: 80 00 01 04 07 7E FF 7F 04 7B 00 00 BB 6F 52 02 So I tried to mount just to the old NTFS partition, but got an error: sudo mount -o loop,ro,offset=16123904 -t ntfs /dev/sdb /mnt/usb NTFS signature is missing. Ugh. Okay. But then I tried to get a raw data dump by running dd if=/dev/sdb of=/home/erik/brokenhd skip=31492 count=38956987 But the file got up to 59885568 bytes, and made the same cyclical clicking noises. Obviously there is a bad sector, but I don't know what to do about it! The data is still there... if I view that 57MB file in textpad... I can see raw data from files. How can I get my data back? Thanks for any suggestions, Solution: I was able to recover about 90% of my data: Froze harddrive in freezer Used Ddrescue to make a copy of the drive Since Ddrescue wasn't able to get enough of my drive to use testdisk to recover my partitions/file system, I ended up using photorec to recover most of my files

    Read the article

  • AST generation for a an application developed both in visual basic and c#

    - by Dev
    Hi, I'm currently understanding one application developed both in visual basic and c#. Running through the code is getting tough as code is around 50KLOC. So i'm planning for generation of AST (abstract syntax tree). Will it be possible to generate for both language together. Atleast a call graph generation will be helpful (but can't find any tool which works for both languages) Please let me know if this question is confusing. Thanks in Advance Dev

    Read the article

  • USB hard drive not recognized

    - by user318772
    Until recently I was using the portable USB hard drive in my win 7 laptop and ubuntu laptop. Suddenly now none of the laptops recognize it. This is the message i get by doing lsusb... Bus 001 Device 004: ID 1058:1010 Western Digital Technologies, Inc. Elements External HDD Bus 001 Device 001: ID 1d6b:0002 Linux Foundation 2.0 root hub Bus 005 Device 001: ID 1d6b:0001 Linux Foundation 1.1 root hub Bus 004 Device 001: ID 1d6b:0001 Linux Foundation 1.1 root hub Bus 003 Device 003: ID 0b97:7762 O2 Micro, Inc. Oz776 SmartCard Reader Bus 003 Device 002: ID 0b97:7761 O2 Micro, Inc. Oz776 1.1 Hub Bus 003 Device 001: ID 1d6b:0001 Linux Foundation 1.1 root hub Bus 002 Device 002: ID 413c:a005 Dell Computer Corp. Internal 2.0 Hub Bus 002 Device 001: ID 1d6b:0001 Linux Foundation 1.1 root hub fdisk doesn't show the external hard drive Disk /dev/sda: 80.0 GB, 80026361856 bytes 255 heads, 63 sectors/track, 9729 cylinders, total 156301488 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x0004a743 Device Boot Start End Blocks Id System /dev/sda1 * 2048 152111103 76054528 83 Linux /dev/sda2 152113150 156301311 2094081 5 Extended /dev/sda5 152113152 156301311 2094080 82 Linux swap / Solaris when i do testdisk TestDisk 6.14, Data Recovery Utility, July 2013 Christophe GRENIER <[email protected]> http://www.cgsecurity.org TestDisk is free software, and comes with ABSOLUTELY NO WARRANTY. Select a media (use Arrow keys, then press Enter): >Disk /dev/sda - 80 GB / 74 GiB - ST980825AS Disk /dev/sdb - 2199 GB / 2048 GiB testdisk-> Intel->analyse I get partition error Disk /dev/sdb - 2199 GB / 2048 GiB - CHS 2097152 64 32 Current partition structure: Partition Start End Size in sectors Partition: Read error Here is the output of dmesg [11948.549171] Add. Sense: Invalid command operation code [11948.549177] sd 2:0:0:0: [sdb] CDB: [11948.549181] Read(16): 88 00 00 00 00 00 00 00 00 00 00 00 00 08 00 00 [11948.550489] sd 2:0:0:0: [sdb] Invalid command failure [11948.550495] sd 2:0:0:0: [sdb] [11948.550499] Result: hostbyte=DID_OK driverbyte=DRIVER_SENSE [11948.550505] sd 2:0:0:0: [sdb] [11948.550508] Sense Key : Illegal Request [current] [11948.550514] Info fld=0x0 [11948.550519] sd 2:0:0:0: [sdb] [11948.550525] Add. Sense: Invalid command operation code [11948.550531] sd 2:0:0:0: [sdb] CDB: [11948.550534] Read(16): 88 00 00 00 00 00 00 00 00 00 00 00 00 08 00 00 [11948.551870] sd 2:0:0:0: [sdb] Invalid command failure [11948.551876] sd 2:0:0:0: [sdb] [11948.551880] Result: hostbyte=DID_OK driverbyte=DRIVER_SENSE [11948.551885] sd 2:0:0:0: [sdb] [11948.551888] Sense Key : Illegal Request [current] [11948.551895] Info fld=0x0 [11948.551900] sd 2:0:0:0: [sdb] [11948.551905] Add. Sense: Invalid command operation code [11948.551911] sd 2:0:0:0: [sdb] CDB: [11948.551914] Read(16): 88 00 00 00 00 00 00 00 00 00 00 00 00 08 00 00 If possible i want to retrive at least some data from this hard drive. If thats not possible I would like to format it and use it. Any help will be greatly appreciated Thanks

    Read the article

  • Can not get sound over hdmi in kubuntu 9.10

    - by user32509
    I have used a hdmi cable to connect my lcd (which is connected with my speakers) with my nvida 275 gtx grafic card. I can not get the sound output to work. The hardware itself is working probably - I tested it under windows. Currently I am running Kubuntu 9.10 64 with Nvidia 190.53. The sound output worked fine before I installed the hdmi connection. (German output - i can change it, if you tell me how :)) aplay -l **** Liste von PLAYBACK Geräten **** Karte 0: Intel [HDA Intel], Gerät 0: ALC889A Analog [ALC889A Analog] Untergeordnete Geräte: 1/1 Untergeordnetes Gerät '0: subdevice #0 Karte 0: Intel [HDA Intel], Gerät 1: ALC889A Digital [ALC889A Digital] Untergeordnete Geräte: 1/1 Untergeordnetes Gerät '0: subdevice #0 aplay -L front:CARD=Intel,DEV=0 HDA Intel, ALC889A Analog Front speakers surround40:CARD=Intel,DEV=0 HDA Intel, ALC889A Analog 4.0 Surround output to Front and Rear speakers surround41:CARD=Intel,DEV=0 HDA Intel, ALC889A Analog 4.1 Surround output to Front, Rear and Subwoofer speakers surround50:CARD=Intel,DEV=0 HDA Intel, ALC889A Analog 5.0 Surround output to Front, Center and Rear speakers surround51:CARD=Intel,DEV=0 HDA Intel, ALC889A Analog 5.1 Surround output to Front, Center, Rear and Subwoofer speakers surround71:CARD=Intel,DEV=0 HDA Intel, ALC889A Analog 7.1 Surround output to Front, Center, Side, Rear and Woofer speakers iec958:CARD=Intel,DEV=0 HDA Intel, ALC889A Digital IEC958 (S/PDIF) Digital Audio Output null Discard all samples (playback) or generate zero samples (capture) pulse Playback/recording through the PulseAudio sound server And i disabled mute in kmix an all channels :) Edit: lspci -v ... 00:1b.0 Audio device: Intel Corporation 82801I (ICH9 Family) HD Audio Controller (rev 02) Subsystem: Giga-byte Technology Device a022 Flags: bus master, fast devsel, latency 0, IRQ 22 Memory at ea400000 (64-bit, non-prefetchable) [size=16K] Capabilities: [50] Power Management version 2 Capabilities: [60] Message Signalled Interrupts: Mask- 64bit+ Queue=0/0 Enable- Capabilities: [70] Express Root Complex Integrated Endpoint, MSI 00 Capabilities: [100] Virtual Channel <?> Capabilities: [130] Root Complex Link <?> Kernel driver in use: HDA Intel Kernel modules: snd-hda-intel ... cat /proc/asound/version Advanced Linux Sound Architecture Driver Version 1.0.20. lsmod | grep snd_hda_intel snd_hda_intel 31880 2 snd_hda_codec 87584 2 snd_hda_codec_realtek,snd_hda_intel snd_pcm 93160 3 snd_hda_intel,snd_hda_codec,snd_pcm_oss snd 77096 16 snd_hda_codec_realtek,snd_hda_intel,snd_hda_codec,snd_hwdep,snd_pcm_oss,snd_mixer_oss,snd_pcm,snd_seq_oss,snd_rawmidi,snd_seq,snd_timer,snd_seq_device snd_page_alloc 10928 2 snd_hda_intel,snd_pcm I think I am missing the something-hdmi module? Is there such a thing?

    Read the article

  • How to connect PHPMyadmin DB by creating the batch file.

    - by Dev
    Hi All, I have created the sql file to create table in DB, I am using PHPMYAdmin But i am not able to connect to the DB, I want to run this as Batch file. If i try to MYSQL from command prompt it give error as 'mysql' is not recognized as an internal or external command, operable program or batch file. Regards, Dev

    Read the article

  • mdadm raid1 fails to resync

    - by JuanD
    Hello, I'm trying to solve this problem I'm having with an mdadm raid1. I have an ubuntu 9.04 server running on a software 2-drive raid1 with mdadm. Yesterday, one of the drives failed, and so I replaced it with a brand new drive of the same size. I removed the faulty drive, copied the partition from the remaining good drive to the new drive and then added it to the raid. It re-synced and the system worked fine, until the drive that hadn't failed, was also labeled failed. Now I had the raid running solely on the new drive. So I purchased another drive and repeated the procedure above. So now I had 2 brand new drives and the raid was syncing. However, after a few minutes I checked /proc/mdstat and the raid was no longer syncing. mdadm --detail /dev/md1 shows: (sdb is the first new drive, and sdc is the second new drive) root@dola:/home/jjaramillo# mdadm --detail /dev/md1 /dev/md1: Version : 00.90 Creation Time : Sat Dec 20 00:42:05 2008 Raid Level : raid1 Array Size : 974711680 (929.56 GiB 998.10 GB) Used Dev Size : 974711680 (929.56 GiB 998.10 GB) Raid Devices : 2 Total Devices : 2 Preferred Minor : 1 Persistence : Superblock is persistent Update Time : Wed Jun 2 10:09:35 2010 State : clean, degraded Active Devices : 1 Working Devices : 2 Failed Devices : 0 Spare Devices : 1 UUID : bba497c6:5029ba0b:bfa4f887:c0dc8f3d Events : 0.5395594 Number Major Minor RaidDevice State 2 8 35 0 spare rebuilding /dev/sdc3 1 8 19 1 active sync /dev/sdb3 I've tried removing and re-adding the drive a few times, but the same thing happens. The raid fails to resync. I've looked at /var/log/messages, and found the following: Jun 2 07:57:36 dola kernel: [35708.917337] sd 5:0:0:0: [sdb] Unhandled sense code Jun 2 07:57:36 dola kernel: [35708.917339] sd 5:0:0:0: [sdb] Result: hostbyte=DID_OK driverbyte=DRIVER_SENSE Jun 2 07:57:36 dola kernel: [35708.917342] sd 5:0:0:0: [sdb] Sense Key : Medium Error [current] [descriptor] Jun 2 07:57:36 dola kernel: [35708.917346] Descriptor sense data with sense descriptors (in hex): Jun 2 07:57:36 dola kernel: [35708.917348] 72 03 11 04 00 00 00 0c 00 0a 80 00 00 00 00 00 Jun 2 07:57:36 dola kernel: [35708.917357] 00 43 9e 47 Jun 2 07:57:36 dola kernel: [35708.917360] sd 5:0:0:0: [sdb] Add. Sense: Unrecovered read error - auto reallocate failed So it looks like there's some kind of error on sdb (the first new drive). My question is, what would be the best approach to get the raid up and running again? I've thought about dd'ing the /dev/md1 to a blank hard drive, then re-doing the raid from scratch and loading the data back, but there could be an easier solution.. Any help would be appreciated.

    Read the article

  • ASP.NET MVC subdomain shows folder name

    - by Paul
    Hi, I'm using godaddy shared hosting, with IIS7, Integrated mode, and published up a bog standard MVC2 app to dev.lazygekko.com created with Visual Web Developer 2010. It all works, however when any of the links are clicked, they point to dev.lazygekko.com/dev/..., dev being the folder it is pointing at. Can anyone shed some light on what I may be doing wrong? Many thanks.

    Read the article

  • Linux fsck.ext3 says "Device or resource busy" although I did not mount the disk.

    - by matnagel
    I am running an ubuntu 8.04 server instance with a 8GB virtual disk on vmware 1.0.9. For disk maintenance I made a copy of the virtual disk (by making a copy of the 2 vmdk files of sda on the stopped vm on the host) and added it to the original vm. Now this vm has it's original virtual disk sda plus a 1:1 copy (sdd). There are 2 additional disk sdb and sdc which I ignore.) I would expect sdb not to be mounted when I start the vm. So I try tp do a ext2 fsck on sdd from the running vm, but it reports fsck reported that sdb was mounted. $ sudo fsck.ext3 -b 8193 /dev/sdd e2fsck 1.40.8 (13-Mar-2008) fsck.ext3: Device or resource busy while trying to open /dev/sdd Filesystem mounted or opened exclusively by another program? The "mount" command does not tell me sdd is mounted: $ sudo mount /dev/sda1 on / type ext3 (rw,relatime,errors=remount-ro) proc on /proc type proc (rw,noexec,nosuid,nodev) /sys on /sys type sysfs (rw,noexec,nosuid,nodev) varrun on /var/run type tmpfs (rw,noexec,nosuid,nodev,mode=0755) varlock on /var/lock type tmpfs (rw,noexec,nosuid,nodev,mode=1777) udev on /dev type tmpfs (rw,mode=0755) devshm on /dev/shm type tmpfs (rw) devpts on /dev/pts type devpts (rw,gid=5,mode=620) /dev/sdc1 on /mnt/r1 type ext3 (rw,relatime,errors=remount-ro) /dev/sdb1 on /mnt/k1 type ext3 (rw,relatime,errors=remount-ro) securityfs on /sys/kernel/security type securityfs (rw) When I ignore the warning and continue the fsck, it reported many errors. How do I get this under control? Is there a better way to figure out if sdd is mounted? Or how is it "busy? How to unmount it then? How to prevent ubuntu from automatically mounting. Or is there something else I am missing? Also from /var/log/syslog I cannot see it is mounted, this is the last part of the startup sequence: kernel: [ 14.229494] ACPI: Power Button (FF) [PWRF] kernel: [ 14.230326] ACPI: AC Adapter [ACAD] (on-line) kernel: [ 14.460136] input: PC Speaker as /devices/platform/pcspkr/input/input3 kernel: [ 14.639366] udev: renamed network interface eth0 to eth1 kernel: [ 14.670187] eth1: link up kernel: [ 16.329607] input: ImPS/2 Generic Wheel Mouse as /devices/platform/i8042/serio1/ kernel: [ 16.367540] parport_pc 00:08: reported by Plug and Play ACPI kernel: [ 16.367670] parport0: PC-style at 0x378, irq 7 [PCSPP,TRISTATE] kernel: [ 19.425637] NET: Registered protocol family 10 kernel: [ 19.437550] lo: Disabled Privacy Extensions kernel: [ 24.328857] loop: module loaded kernel: [ 24.449293] lp0: using parport0 (interrupt-driven). kernel: [ 26.075499] EXT3 FS on sda1, internal journal kernel: [ 28.380299] kjournald starting. Commit interval 5 seconds kernel: [ 28.381706] EXT3 FS on sdc1, internal journal kernel: [ 28.381747] EXT3-fs: mounted filesystem with ordered data mode. kernel: [ 28.444867] kjournald starting. Commit interval 5 seconds kernel: [ 28.445436] EXT3 FS on sdb1, internal journal kernel: [ 28.445444] EXT3-fs: mounted filesystem with ordered data mode. kernel: [ 31.309766] eth1: no IPv6 routers present kernel: [ 35.054268] ip_tables: (C) 2000-2006 Netfilter Core Team mysqld_safe[4367]: started mysqld[4370]: 100124 14:40:21 InnoDB: Started; log sequence number 0 10130914 mysqld[4370]: 100124 14:40:21 [Note] /usr/sbin/mysqld: ready for connections. mysqld[4370]: Version: '5.0.51a-3ubuntu5.4' socket: '/var/run/mysqld/mysqld.sock' port: 3 /etc/mysql/debian-start[4417]: Upgrading MySQL tables if necessary. /etc/mysql/debian-start[4422]: Looking for 'mysql' in: /usr/bin/mysql /etc/mysql/debian-start[4422]: Looking for 'mysqlcheck' in: /usr/bin/mysqlcheck /etc/mysql/debian-start[4422]: This installation of MySQL is already upgraded to 5.0.51a, u /etc/mysql/debian-start[4436]: Checking for insecure root accounts. /etc/mysql/debian-start[4444]: Checking for crashed MySQL tables.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Why is my mdadm raid-1 recovery so slow?

    - by dimmer
    On a system I'm running Ubuntu 10.04. My raid-1 restore started out fast but quickly became ridiculously slow (at this rate the restore will take 150 days!): dimmer@paimon:~$ cat /proc/mdstat Personalities : [linear] [multipath] [raid0] [raid1] [raid6] [raid5] [raid4] [raid10] md0 : active raid1 sdc1[2] sdb1[1] 1953513408 blocks [2/1] [_U] [====>................] recovery = 24.4% (477497344/1953513408) finish=217368.0min speed=113K/sec unused devices: <none> Eventhough I have set the kernel variables to reasonably quick values: dimmer@paimon:~$ cat /proc/sys/dev/raid/speed_limit_min 1000000 dimmer@paimon:~$ cat /proc/sys/dev/raid/speed_limit_max 100000000 I am using 2 2.0TB Western Digital Hard Disks, WDC WD20EARS-00M and WDC WD20EARS-00J. I believe they have been partitioned such that their sectors are aligned. dimmer@paimon:/sys$ sudo parted /dev/sdb GNU Parted 2.2 Using /dev/sdb Welcome to GNU Parted! Type 'help' to view a list of commands. (parted) p Model: ATA WDC WD20EARS-00M (scsi) Disk /dev/sdb: 2000GB Sector size (logical/physical): 512B/512B Partition Table: gpt Number Start End Size File system Name Flags 1 1049kB 2000GB 2000GB ext4 (parted) unit s (parted) p Number Start End Size File system Name Flags 1 2048s 3907028991s 3907026944s ext4 (parted) q dimmer@paimon:/sys$ sudo parted /dev/sdc GNU Parted 2.2 Using /dev/sdc Welcome to GNU Parted! Type 'help' to view a list of commands. (parted) p Model: ATA WDC WD20EARS-00J (scsi) Disk /dev/sdc: 2000GB Sector size (logical/physical): 512B/4096B Partition Table: gpt Number Start End Size File system Name Flags 1 1049kB 2000GB 2000GB ext4 I am beginning to think that I have a hardware problem, otherwise I can't imagine why the mdadm restore should be so slow. I have done a benchmark on /dev/sdc using Ubuntu's disk utility GUI app, and the results looked normal so I know that sdc has the capability to write faster than this. I also had the same problem on a similar WD drive that I RMAd because of bad sectors. I suppose it's possible they sent me a replacement with bad sectors too, although there are no SMART values showing them yet. Any ideas? Thanks. As requested, output of top sorted by cpu usage (notice there is ~0 cpu usage). iowait is also zero which seems strange: top - 11:35:13 up 2 days, 9:40, 3 users, load average: 2.87, 2.58, 2.30 Tasks: 142 total, 1 running, 141 sleeping, 0 stopped, 0 zombie Cpu(s): 0.0%us, 0.2%sy, 0.0%ni, 99.8%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Mem: 3096304k total, 1482164k used, 1614140k free, 617672k buffers Swap: 1526132k total, 0k used, 1526132k free, 535416k cached PID USER PR NI VIRT RES SHR S %CPU %MEM TIME+ COMMAND 45 root 20 0 0 0 0 S 0 0.0 2:17.02 scsi_eh_0 1 root 20 0 2808 1752 1204 S 0 0.1 0:00.46 init 2 root 20 0 0 0 0 S 0 0.0 0:00.00 kthreadd 3 root RT 0 0 0 0 S 0 0.0 0:00.02 migration/0 4 root 20 0 0 0 0 S 0 0.0 0:00.17 ksoftirqd/0 5 root RT 0 0 0 0 S 0 0.0 0:00.00 watchdog/0 6 root RT 0 0 0 0 S 0 0.0 0:00.02 migration/1 ... dmesg errors, definitely looking like hardware: [202884.000157] ata5.00: exception Emask 0x0 SAct 0x0 SErr 0x0 action 0x6 frozen [202884.007015] ata5.00: failed command: FLUSH CACHE EXT [202884.013728] ata5.00: cmd ea/00:00:00:00:00/00:00:00:00:00/a0 tag 0 [202884.013730] res 40/00:00:ff:59:2e/00:00:35:00:00/e0 Emask 0x4 (timeout) [202884.033667] ata5.00: status: { DRDY } [202884.040329] ata5: hard resetting link [202889.400050] ata5: link is slow to respond, please be patient (ready=0) [202894.048087] ata5: COMRESET failed (errno=-16) [202894.054663] ata5: hard resetting link [202899.412049] ata5: link is slow to respond, please be patient (ready=0) [202904.060107] ata5: COMRESET failed (errno=-16) [202904.066646] ata5: hard resetting link [202905.840056] ata5: SATA link up 3.0 Gbps (SStatus 123 SControl 300) [202905.849178] ata5.00: configured for UDMA/133 [202905.849188] ata5: EH complete [203899.000292] ata5.00: exception Emask 0x0 SAct 0x0 SErr 0x0 action 0x6 frozen [203899.007096] ata5.00: failed command: IDENTIFY DEVICE [203899.013841] ata5.00: cmd ec/00:01:00:00:00/00:00:00:00:00/00 tag 0 pio 512 in [203899.013843] res 40/00:00:ff:f9:f6/00:00:38:00:00/e0 Emask 0x4 (timeout) [203899.041232] ata5.00: status: { DRDY } [203899.048133] ata5: hard resetting link [203899.816134] ata5: SATA link up 3.0 Gbps (SStatus 123 SControl 300) [203899.826062] ata5.00: configured for UDMA/133 [203899.826079] ata5: EH complete [204375.000200] ata5.00: exception Emask 0x0 SAct 0x0 SErr 0x0 action 0x6 frozen [204375.007421] ata5.00: failed command: IDENTIFY DEVICE [204375.014799] ata5.00: cmd ec/00:01:00:00:00/00:00:00:00:00/00 tag 0 pio 512 in [204375.014800] res 40/00:00:ff:0c:0f/00:00:39:00:00/e0 Emask 0x4 (timeout) [204375.044374] ata5.00: status: { DRDY } [204375.051842] ata5: hard resetting link [204380.408049] ata5: link is slow to respond, please be patient (ready=0) [204384.440076] ata5: SATA link up 3.0 Gbps (SStatus 123 SControl 300) [204384.449938] ata5.00: configured for UDMA/133 [204384.449955] ata5: EH complete [204395.988135] ata5.00: exception Emask 0x0 SAct 0x0 SErr 0x0 action 0x6 frozen [204395.988140] ata5.00: failed command: IDENTIFY DEVICE [204395.988147] ata5.00: cmd ec/00:01:00:00:00/00:00:00:00:00/00 tag 0 pio 512 in [204395.988149] res 40/00:00:ff:0c:0f/00:00:39:00:00/e0 Emask 0x4 (timeout) [204395.988151] ata5.00: status: { DRDY } [204395.988156] ata5: hard resetting link [204399.320075] ata5: SATA link up 3.0 Gbps (SStatus 123 SControl 300) [204399.330487] ata5.00: configured for UDMA/133 [204399.330503] ata5: EH complete

    Read the article

  • Why would autoconf/automake project link against installed library instead of local development libr

    - by Beau Simensen
    I'm creating a library libgdata that has some tests and non-installed programs. I am running into the problem that once I've installed the library once, the programs seem to be linking to the installed version and not the local version in ../src/libgdata.la any longer. What could cause this? Am I doing something horribly wrong? Here is what my test/Makefile.am looks like: INCLUDES = -I$(top_srcdir)/src/ -I$(top_srcdir)/test/ # libapiutil contains all of our dependencies! AM_CXXFLAGS = $(APIUTIL_CFLAGS) AM_LDFLAGS = $(APIUTIL_LIBS) LDADD = $(top_builddir)/src/libgdata.la noinst_PROGRAMS = gdatacalendar gdatayoutube gdatacalendar_SOURCES = gdatacalendar.cc gdatayoutube_SOURCES = gdatayoutube.cc TESTS = check_bare check_PROGRAMS = $(TESTS) check_bare_SOURCES = check_bare.cc (libapiutil is another library that has some helper stuff for dealing with libcurl and libxml++) So, for instance, if I run the tests without having installed anything, everything works fine. I can make changes locally and they are picked up by these programs right away. If I install the package, these programs will compile (it seems like it does actually look locally for the headers), but once I run the program it complains about missing symbols. As far as I can tell, it is linking against the newly built library (../src/libgdata.la) based on the make output, so I'm not sure why this would be happening. If i remove the installed files, the local changes to src/* are picked up just fine. I've included the make output for gdatacalendar below. g++ -DHAVE_CONFIG_H -I. -I.. -I../src/ -I../test/ -I/home/altern8/workspaces/4355/dev-install/include -I/usr/include/libxml++-2.6 -I/usr/lib/libxml++-2.6/include -I/usr/include/libxml2 -I/usr/include/glibmm-2.4 -I/usr/lib/glibmm-2.4/include -I/usr/include/sigc++-2.0 -I/usr/lib/sigc++-2.0/include -I/usr/include/glib-2.0 -I/usr/lib/glib-2.0/include -g -O2 -MT gdatacalendar.o -MD -MP -MF .deps/gdatacalendar.Tpo -c -o gdatacalendar.o gdatacalendar.cc mv -f .deps/gdatacalendar.Tpo .deps/gdatacalendar.Po /bin/bash ../libtool --tag=CXX --mode=link g++ -I/home/altern8/workspaces/4355/dev-install/include -I/usr/include/libxml++-2.6 -I/usr/lib/libxml++-2.6/include -I/usr/include/libxml2 -I/usr/include/glibmm-2.4 -I/usr/lib/glibmm-2.4/include -I/usr/include/sigc++-2.0 -I/usr/lib/sigc++-2.0/include -I/usr/include/glib-2.0 -I/usr/lib/glib-2.0/include -g -O2 -L/home/altern8/workspaces/4355/dev-install/lib -lapiutil -lcurl -lgssapi_krb5 -lxml++-2.6 -lxml2 -lglibmm-2.4 -lgobject-2.0 -lsigc-2.0 -lglib-2.0 -o gdatacalendar gdatacalendar.o ../src/libgdata.la mkdir .libs g++ -I/home/altern8/workspaces/4355/dev-install/include -I/usr/include/libxml++-2.6 -I/usr/lib/libxml++-2.6/include -I/usr/include/libxml2 -I/usr/include/glibmm-2.4 -I/usr/lib/glibmm-2.4/include -I/usr/include/sigc++-2.0 -I/usr/lib/sigc++-2.0/include -I/usr/include/glib-2.0 -I/usr/lib/glib-2.0/include -g -O2 -o .libs/gdatacalendar gdatacalendar.o -L/home/altern8/workspaces/4355/dev-install/lib /home/altern8/workspaces/4355/dev-install/lib/libapiutil.so /usr/lib/libcurl.so -lgssapi_krb5 /usr/lib/libxml++-2.6.so /usr/lib/libxml2.so /usr/lib/libglibmm-2.4.so /usr/lib/libgobject-2.0.so /usr/lib/libsigc-2.0.so /usr/lib/libglib-2.0.so ../src/.libs/libgdata.so -Wl,--rpath -Wl,/home/altern8/workspaces/4355/dev-install/lib creating gdatacalendar Help. :) UPDATE I get the following messages when I try to run the calendar program when I've added the addCommonRequestHeader() method to the Service class after I had installed the library without the addCommonRequestHeader() method. /home/altern8/workspaces/4355/libgdata/test/.libs/lt-gdatacalendar: symbol lookup error: /home/altern8/workspaces/4355/libgdata/test/.libs/lt-gdatacalendar: undefined symbol: _ZN55gdata7service7Service22addCommonRequestHeaderERKSsS4_ Eugene's suggestion to try setting the $LD_LIBRARY_PATH variable did not help. UPDATE 2 I did two tests. First, I did this after blowing away my dev-install directory (--prefix) and in that case, it creates test/.libs/lt-gdatacalendar. Once I have installed the library, though, it creates test/.libs/gdatacalendar instead. The output of ldd is the same for both with one exception: # before install # ldd test/.libs/lt-gdatacalendar libgdata.so.0 => /home/altern8/workspaces/4355/libgdata/src/.libs/libgdata.so.0 (0xb7c32000) # after install # ldd test/.libs/gdatacalendar libgdata.so.0 => /home/altern8/workspaces/4355/dev-install/lib/libgdata.so.0 (0xb7c87000) What would cause this to create lt-gdatacalendar in one case but gdatacalendar in another? The output of ldd on libgdata is: altern8@goldfrapp:~/workspaces/4355/libgdata$ ldd /home/altern8/workspaces/4355/libgdata/src/.libs/libgdata.so.0 linux-gate.so.1 => (0xb7f7c000) libgcc_s.so.1 => /lib/libgcc_s.so.1 (0xb7f3b000) libc.so.6 => /lib/tls/i686/cmov/libc.so.6 (0xb7dec000) /lib/ld-linux.so.2 (0xb7f7d000)

    Read the article

  • SQLAuthority News – TechEd India – April 12-14, 2010 Bangalore – An Unforgettable Experience – An Op

    - by pinaldave
    TechEd India was one of the largest Technology events in India led by Microsoft. This event was attended by more than 3,000 technology enthusiasts, making it one of the most well-organized events of the year. Though I attempted to attend almost all the technology events here, I have not seen any bigger or better event in Indian subcontinents other than this. There are 21 Technical Tracks at Tech·Ed India 2010 that span more than 745 learning opportunities. I was fortunate enough to be a part of this whole event as a speaker and a delegate, as well. TechEd India Speaker Badge and A Token of Lifetime Hotel Selection I presented three different sessions at TechEd India and was also a part of panel discussion. (The details of the sessions are given at the end of this blog post.) Due to extensive traveling, I stay away from my family occasionally. For this reason, I took my wife – Nupur and daughter Shaivi (8 months old) to the event along with me. We stayed at the same hotel where the event was organized so as to maximize my time bonding with my family and to have more time in networking with technology community, at the same time. The hotel Lalit Ashok is the largest and most luxurious venue one can find in Bangalore, located in the middle of the city. The cost of the hotel was a bit pricey, but looking at all the advantages, I had decided to ask for a booking there. Hotel Lalit Ashok Nupur Dave and Shaivi Dave Arrival Day – DAY 0 – April 11, 2010 I reached the event a day earlier, and that was one wise decision for I was able to relax a bit and go over my presentation for the next day’s course. I am a kind of person who likes to get everything ready ahead of time. I was also able to enjoy a pleasant evening with several Microsoft employees and my family friends. I even checked out the location where I would be doing presentations the next day. I was fortunate enough to meet Bijoy Singhal from Microsoft who helped me out with a few of the logistics issues that occured the day before. I was not aware of the fact that the very next day he was going to be “The Man” of the TechEd 2010 event. Vinod Kumar from Microsoft was really very kind as he talked to me regarding my subsequent session. He gave me some suggestions which were really helpful that I was able to incorporate them during my presentation. Finally, I was able to meet Abhishek Kant from Microsoft; his valuable suggestions and unlimited passion have inspired many people like me to work with the Community. Pradipta from Microsoft was also around, being extremely busy with logistics; however, in those busy times, he did find some good spare time to have a chat with me and the other Community leaders. I also met Harish Ranganathan and Sachin Rathi, both from Microsoft. It was so interesting to listen to both of them talking about SharePoint. I just have no words to express my overwhelmed spirit because of all these passionate young guys - Pradipta,Vinod, Bijoy, Harish, Sachin and Ahishek (of course!). Map of TechEd India 2010 Event Day 1 – April 12, 2010 From morning until night time, today was truly a very busy day for me. I had two presentations and one panel discussion for the day. Needless to say, I had a few meetings to attend as well. The day started with a keynote from S. Somaseger where he announced the launch of Visual Studio 2010. The keynote area was really eye-catching because of the very large, bigger-than- life uniform screen. This was truly one to show. The title music of the keynote was very interesting and it featured Bijoy Singhal as the model. It was interesting to talk to him afterwards, when we laughed at jokes together about his modeling assignment. TechEd India Keynote Opening Featuring Bijoy TechEd India 2010 Keynote – S. Somasegar Time: 11:15pm – 11:45pm Session 1: True Lies of SQL Server – SQL Myth Buster Following the excellent keynote, I had my very first session on the subject of SQL Server Myth Buster. At first, I was a bit nervous as right after the keynote, for this was my very first session and during my presentation I saw lots of Microsoft Product Team members. Well, it really went well and I had a really good discussion with attendees of the session. I felt that a well begin was half-done and my confidence was regained. Right after the session, I met a few of my Community friends and had meaningful discussions with them on many subjects. The abstract of the session is as follows: In this 30-minute demo session, I am going to briefly demonstrate few SQL Server Myths and their resolutions as I back them up with some demo. This demo presentation is a must-attend for all developers and administrators who would come to the event. This is going to be a very quick yet fun session. Pinal Presenting session at TechEd India 2010 Time: 1:00 PM – 2:00 PM Lunch with Somasegar After the session I went to see my daughter, and then I headed right away to the lunch with S. Somasegar – the keynote speaker and senior vice president of the Developer Division at Microsoft. I really thank to Abhishek who made it possible for us. Because of his efforts, all the MVPs had the opportunity to meet such a legendary person and had to talk with them on Microsoft Technology. Though Somasegar is currently holding such a high position in Microsoft, he is very polite and a real gentleman, and how I wish that everybody in industry is like him. Believe me, if you spread love and kindness, then that is what you will receive back. As soon as lunch time was over, I ran to the session hall as my second presentation was about to start. Time: 2:30pm – 3:30pm Session 2: Master Data Services in Microsoft SQL Server 2008 R2 Business Intelligence is a subject which was widely talked about at TechEd. Everybody was interested in this subject, and I did not excuse myself from this great concept as well. I consider myself fortunate as I was presenting on the subject of Master Data Services at TechEd. When I had initially learned this subject, I had a bit of confusion about the usage of this tool. Later on, I decided that I would tackle about how we all developers and DBAs are not able to understand something so simple such as this, and even worst, creating confusion about the technology. During system designing, it is very important to have a reference material or master lookup tables. Well, I talked about the same subject and presented the session keeping that as my center talk. The session went very well and I received lots of interesting questions. I got many compliments for talking about this subject on the real-life scenario. I really thank Rushabh Mehta (CEO, Solid Quality Mentors India) for his supportive suggestions that helped me prepare the slide deck, as well as the subject. Pinal Presenting session at TechEd India 2010 The abstract of the session is as follows: SQL Server Master Data Services will ship with SQL Server 2008 R2 and will improve Microsoft’s platform appeal. This session provides an in-depth demonstration of MDS features and highlights important usage scenarios. Master Data Services enables consistent decision-making process by allowing you to create, manage and propagate changes from a single master view of your business entities. Also, MDS – Master Data-hub which is a vital component, helps ensure the consistency of reporting across systems and deliver faster and more accurate results across the enterprise. We will talk about establishing the basis for a centralized approach to defining, deploying, and managing master data in the enterprise. Pinal Presenting session at TechEd India 2010 The day was still not over for me. I had ran into several friends but we were not able keep our enthusiasm under control about all the rumors saying that SQL Server 2008 R2 was about to be launched tomorrow in the keynote. I then ran to my third and final technical event for the day- a panel discussion with the top technologies of India. Time: 5:00pm – 6:00pm Panel Discussion: Harness the power of Web – SEO and Technical Blogging As I have delivered two technical sessions by this time, I was a bit tired but  not less enthusiastic when I had to talk about Blog and Technology. We discussed many different topics there. I told them that the most important aspect for any blog is its content. We discussed in depth the issues with plagiarism and how to avoid it. Another topic of discussion was how we technology bloggers can create awareness in the Community about what the right kind of blogging is and what morally and technically wrong acts are. A couple of questions were raised about what type of liberty a person can have in terms of writing blogs. Well, it was generically agreed that a blog is mainly a representation of our ideas and thoughts; it should not be governed by external entities. As long as one is writing what they really want to say, but not providing incorrect information or not practicing plagiarism, a blogger should be allowed to express himself. This panel discussion was supposed to be over in an hour, but the interest of the participants was remarkable and so it was extended for 30 minutes more. Finally, we decided to bring to a close the discussion and agreed that we will continue the topic next year. TechEd India Panel Discussion on Web, Technology and SEO Surprisingly, the day was just beginning after doing all of these. By this time, I have almost met all the MVP who arrived at the event, as well as many Microsoft employees. There were lots of Community folks present, too. I decided that I would go to meet several friends from the Community and continue to communicate with me on SQLAuthority.com. I also met Abhishek Baxi and had a good talk with him regarding Win Mobile and Twitter. He also took a very quick video of me wherein I spoke in my mother’s tongue, Gujarati. It was funny that I talked in Gujarati almost all the day, but when I was talking in the interview I could not find the right Gujarati words to speak. I think we all think in English when we think about Technology, so as to address universality. After meeting them, I headed towards the Speakers’ Dinner. Time: 8:00 PM – onwards Speakers Dinner The Speakers’ dinner was indeed a wonderful opportunity for all the speakers to get together and relax. We talked so many different things, from XBOX to Hindi Movies, and from SQL to Samosas. I just could not express how much fun I had. After a long evening, when I returned tmy room and met Shaivi, I just felt instantly relaxed. Kids are really gifts from God. Today was a really long but exciting day. So many things happened in just one day: Visual Studio Lanch, lunch with Somasegar, 2 technical sessions, 1 panel discussion, community leaders meeting, speakers dinner and, last but not leas,t playing with my child! A perfect day! Day 2 – April 13, 2010 Today started with a bang with the excellent keynote by Kamal Hathi who launched SQL Server 2008 R2 in India and demonstrated the power of PowerPivot to all of us. 101 Million Rows in Excel brought lots of applause from the audience. Kamal Hathi Presenting Keynote at TechEd India 2010 The day was a bit easier one for me. I had no sessions today and no events planned. I had a few meetings planned for the second day of the event. I sat in the speaker’s lounge for half a day and met many people there. I attended nearly 9 different meetings today. The subjects of the meetings were very different. Here is a list of the topics of the Community-related meetings: SQL PASS and its involvement in India and subcontinents How to start community blogging Forums and developing aptitude towards technology Ahmedabad/Gandhinagar User Groups and their developments SharePoint and SQL Business Meeting – a client meeting Business Meeting – a potential performance tuning project Business Meeting – Solid Quality Mentors (SolidQ) And family friends Pinal Dave at TechEd India The day passed by so quickly during this meeting. In the evening, I headed to Partners Expo with friends and checked out few of the booths. I really wanted to talk about some of the products, but due to the freebies there was so much crowd that I finally decided to just take the contact details of the partner. I will now start sending them with my queries and, hopefully, I will have my questions answered. Nupur and Shaivi had also one meeting to attend; it was with our family friend Vijay Raj. Vijay is also a person who loves Technology and loves it more than anybody. I see him growing and learning every day, but still remaining as a ‘human’. I believe that if someone acquires as much knowledge as him, that person will become either a computer or cyborg. Here, Vijay is still a kind gentleman and is able to stay as our close family friend. Shaivi was really happy to play with Uncle Vijay. Pinal Dave and Vijay Raj Renuka Prasad, a Microsoft MVP, impressed me with his passion and knowledge of SQL. Every time he gives me credit for his success, I believe that he is very humble. He has way more certifications than me and has worked many more years with SQL compared to me. He is an excellent photographer as well. Most of the photos in this blog post have been taken by him. I told him if ever he wants to do a part time job, he can do the photography very well. Pinal Dave and Renuka Prasad I also met L Srividya from Microsoft, whom I was looking forward to meet. She is a bundle of knowledge that everyone would surely learn a lot from her. I was able to get a few minutes from her and well, I felt confident. She enlightened me with SQL Server BI concepts, domain management and SQL Server security and few other interesting details. I also had a wonderful time talking about SharePoint with fellow Solid Quality Mentor Joy Rathnayake. He is very passionate about SharePoint but when you talk .NET and SQL with him, he is still overwhelmingly knowledgeable. In fact, while talking to him, I figured out that the recent training he delivered was on SQL Server 2008 R2. I told him a joke that it hurts my ego as he is more popular now in SQL training and consulting than me. I am sure all of you agree that working with good people is a gift from God. I am fortunate enough to work with the best of the best Industry experts. It was a great pleasure to hang out with my Community friends – Ahswin Kini, HimaBindu Vejella, Vasudev G, Suprotim Agrawal, Dhananjay, Vikram Pendse, Mahesh Dhola, Mahesh Mitkari,  Manu Zacharia, Shobhan, Hardik Shah, Ashish Mohta, Manan, Subodh Sohani and Sanjay Shetty (of course!) .  (Please let me know if I have met you at the event and forgot your name to list here). Time: 8:00 PM – onwards Community Leaders Dinner After lots of meetings, I headed towards the Community Leaders dinner meeting and met almost all the folks I met in morning. The discussion was almost the same but the real good thing was that we were enjoying it. The food was really good. Nupur was invited in the event, but Shaivi could not come. When Nupur tried to enter the event, she was stopped as Shaivi did not have the pass to enter the dinner. Nupur expressed that Shaivi is only 8 months old and does not eat outside food as well and could not stay by herself at this age, but the door keeper did not agree and asked that without the entry details Shaivi could not go in, but Nupur could. Nupur called me on phone and asked me to help her out. By the time, I was outside; the organizer of the event reached to the door and happily approved Shaivi to join the party. Once in the party, Shaivi had lots of fun meeting so many people. Shaivi Dave and Abhishek Kant Dean Guida (Infragistics President and CEO) and Pinal Dave (SQLAuthority.com) Day 3 – April 14, 2010 Though, it was last day, I was very much excited today as I was about to present my very favorite session. Query Optimization and Performance Tuning is my domain expertise and I make my leaving by consulting and training the same. Today’s session was on the same subject and as an additional twist, another subject about Spatial Database was presented. I was always intrigued with Spatial Database and I have enjoyed learning about it; however, I have never thought about Spatial Indexing before it was decided that I will do this session. I really thank Solid Quality Mentor Dr. Greg Low for his assistance in helping me prepare the slide deck and also review the content. Furthermore, today was really what I call my ‘learning day’ . So far I had not attended any session in TechEd and I felt a bit down for that. Everybody spends their valuable time & money to learn something new and exciting in TechEd and I had not attended a single session at the moment thinking that it was already last day of the event. I did have a plan for the day and I attended two technical sessions before my session of spatial database. I attended 2 sessions of Vinod Kumar. Vinod is a natural storyteller and there was no doubt that his sessions would be jam-packed. People attended his sessions simply because Vinod is syhe speaker. He did not have a single time disappointed audience; he is truly a good speaker. He knows his stuff very well. I personally do not think that in India he can be compared to anyone for SQL. Time: 12:30pm-1:30pm SQL Server Query Optimization, Execution and Debugging Query Performance I really had a fun time attending this session. Vinod made this session very interactive. The entire audience really got into the presentation and started participating in the event. Vinod was presenting a small problem with Query Tuning, which any developer would have encountered and solved with their help in such a fashion that a developer feels he or she have already resolved it. In one question, I was the only one who was ready to answer and Vinod told me in a light tone that I am now allowed to answer it! The audience really found it very amusing. There was a huge crowd around Vinod after the session. Vinod – A master storyteller! Time: 3:45pm-4:45pm Data Recovery / consistency with CheckDB This session was much heavier than the earlier one, and I must say this is my most favorite session I EVER attended in India. In this TechEd I have only attended two sessions, but in my career, I have attended numerous technical sessions not only in India, but all over the world. This session had taken my breath away. One by one, Vinod took the different databases, and started to corrupt them in different ways. Each database has some unique ways to get corrupted. Once that was done, Vinod started to show the DBCC CEHCKDB and demonstrated how it can solve your problem. He finally fixed all the databases with this single tool. I do have a good knowledge of this subject, but let me honestly admit that I have learned a lot from this session. I enjoyed and cheered during this session along with other attendees. I had total satisfaction that, just like everyone, I took advantage of the event and learned something. I am now TECHnically EDucated. Pinal Dave and Vinod Kumar After two very interactive and informative SQL Sessions from Vinod Kumar, the next turn me presenting on Spatial Database and Indexing. I got once again nervous but Vinod told me to stay natural and do my presentation. Well, once I got a huge stage with a total of four projectors and a large crowd, I felt better. Time: 5:00pm-6:00pm Session 3: Developing with SQL Server Spatial and Deep Dive into Spatial Indexing Pinal Presenting session at TechEd India 2010 Pinal Presenting session at TechEd India 2010 I kicked off this session with Michael J Swart‘s beautiful spatial image. This session was the last one for the day but, to my surprise, I had more than 200+ attendees. Slowly, the rain was starting outside and I was worried that the hall would not be full; despite this, there was not a single seat available in the first five minutes of the session. Thanks to all of you for attending my presentation. I had demonstrated the map of world (and India) and quickly explained what  Geographic and Geometry data types in Spatial Database are. This session had interesting story of Indexing and Comparison, as well as how different traditional indexes are from spatial indexing. Pinal Presenting session at TechEd India 2010 Due to the heavy rain during this event, the power went off for about 22 minutes (just an accident – nobodies fault). During these minutes, there were no audio, no video and no light. I continued to address the mass of 200+ people without any audio device and PowerPoint. I must thank the audience because not a single person left from the session. They all stayed in their place, some moved closure to listen to me properly. I noticed that the curiosity and eagerness to learn new things was at the peak even though it was the very last session of the TechEd. Everybody wanted get the maximum knowledge out of this whole event. I was touched by the support from audience. They listened and participated in my session even without any kinds of technology (no ppt, no mike, no AC, nothing). During these 22 minutes, I had completed my theory verbally. Pinal Presenting session at TechEd India 2010 After a while, we got the projector back online and we continued with some exciting demos. Many thanks to Microsoft people who worked energetically in background to get the backup power for project up. I had a very interesting demo wherein I overlaid Bangalore and Hyderabad on the India Map and find their aerial distance between them. After finding the aerial distance, we browsed online and found that SQL Server estimates the exact aerial distance between these two cities, as compared to the factual distance. There was a huge applause from the crowd on the subject that SQL Server takes into the count of the curvature of the earth and finds the precise distances based on details. During the process of finding the distance, I demonstrated a few examples of the indexes where I expressed how one can use those indexes to find these distances and how they can improve the performance of similar query. I also demonstrated few examples wherein we were able to see in which data type the Index is most useful. We finished the demos with a few more internal stuff. Pinal Presenting session at TechEd India 2010 Despite all issues, I was mostly satisfied with my presentation. I think it was the best session I have ever presented at any conference. There was no help from Technology for a while, but I still got lots of appreciation at the end. When we ended the session, the applause from the audience was so loud that for a moment, the rain was not audible. I was truly moved by the dedication of the Technology enthusiasts. Pinal Dave After Presenting session at TechEd India 2010 The abstract of the session is as follows: The Microsoft SQL Server 2008 delivers new spatial data types that enable you to consume, use, and extend location-based data through spatial-enabled applications. Attend this session to learn how to use spatial functionality in next version of SQL Server to build and optimize spatial queries. This session outlines the new geography data type to store geodetic spatial data and perform operations on it, use the new geometry data type to store planar spatial data and perform operations on it, take advantage of new spatial indexes for high performance queries, use the new spatial results tab to quickly and easily view spatial query results directly from within Management Studio, extend spatial data capabilities by building or integrating location-enabled applications through support for spatial standards and specifications and much more. Time: 8:00 PM – onwards Dinner by Sponsors After the lively session during the day, there was another dinner party courtesy of one of the sponsors of TechEd. All the MVPs and several Community leaders were present at the dinner. I would like to express my gratitude to Abhishek Kant for organizing this wonderful event for us. It was a blast and really relaxing in all angles. We all stayed there for a long time and talked about our sweet and unforgettable memories of the event. Pinal Dave and Bijoy Singhal It was really one wonderful event. After writing this much, I say that I have no words to express about how much I enjoyed TechEd. However, it is true that I shared with you only 1% of the total activities I have done at the event. There were so many people I have met, yet were not mentioned here although I wanted to write their names here, too . Anyway, I have learned so many things and up until now, I am not able to get over all the fun I had in this event. Pinal Dave at TechEd India 2010 The Next Days – April 15, 2010 – till today I am still not able to get my mind out of the whole experience I had at TechEd India 2010. It was like a whole Microsoft Family working together to celebrate a happy occasion. TechEd India – Truly An Unforgettable Experience! Reference : Pinal Dave (http://blog.SQLAuthority.com) Filed under: About Me, MVP, Pinal Dave, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, SQLAuthority Author Visit, SQLAuthority News, SQLServer, T SQL, Technology Tagged: TechEd, TechEdIn

    Read the article

  • SQLAuthority News – TechEd India – April 12-14, 2010 Bangalore – An Unforgettable Experience – An Op

    - by pinaldave
    TechEd India was one of the largest Technology events in India led by Microsoft. This event was attended by more than 3,000 technology enthusiasts, making it one of the most well-organized events of the year. Though I attempted to attend almost all the technology events here, I have not seen any bigger or better event in Indian subcontinents other than this. There are 21 Technical Tracks at Tech·Ed India 2010 that span more than 745 learning opportunities. I was fortunate enough to be a part of this whole event as a speaker and a delegate, as well. TechEd India Speaker Badge and A Token of Lifetime Hotel Selection I presented three different sessions at TechEd India and was also a part of panel discussion. (The details of the sessions are given at the end of this blog post.) Due to extensive traveling, I stay away from my family occasionally. For this reason, I took my wife – Nupur and daughter Shaivi (8 months old) to the event along with me. We stayed at the same hotel where the event was organized so as to maximize my time bonding with my family and to have more time in networking with technology community, at the same time. The hotel Lalit Ashok is the largest and most luxurious venue one can find in Bangalore, located in the middle of the city. The cost of the hotel was a bit pricey, but looking at all the advantages, I had decided to ask for a booking there. Hotel Lalit Ashok Nupur Dave and Shaivi Dave Arrival Day – DAY 0 – April 11, 2010 I reached the event a day earlier, and that was one wise decision for I was able to relax a bit and go over my presentation for the next day’s course. I am a kind of person who likes to get everything ready ahead of time. I was also able to enjoy a pleasant evening with several Microsoft employees and my family friends. I even checked out the location where I would be doing presentations the next day. I was fortunate enough to meet Bijoy Singhal from Microsoft who helped me out with a few of the logistics issues that occured the day before. I was not aware of the fact that the very next day he was going to be “The Man” of the TechEd 2010 event. Vinod Kumar from Microsoft was really very kind as he talked to me regarding my subsequent session. He gave me some suggestions which were really helpful that I was able to incorporate them during my presentation. Finally, I was able to meet Abhishek Kant from Microsoft; his valuable suggestions and unlimited passion have inspired many people like me to work with the Community. Pradipta from Microsoft was also around, being extremely busy with logistics; however, in those busy times, he did find some good spare time to have a chat with me and the other Community leaders. I also met Harish Ranganathan and Sachin Rathi, both from Microsoft. It was so interesting to listen to both of them talking about SharePoint. I just have no words to express my overwhelmed spirit because of all these passionate young guys - Pradipta,Vinod, Bijoy, Harish, Sachin and Ahishek (of course!). Map of TechEd India 2010 Event Day 1 – April 12, 2010 From morning until night time, today was truly a very busy day for me. I had two presentations and one panel discussion for the day. Needless to say, I had a few meetings to attend as well. The day started with a keynote from S. Somaseger where he announced the launch of Visual Studio 2010. The keynote area was really eye-catching because of the very large, bigger-than- life uniform screen. This was truly one to show. The title music of the keynote was very interesting and it featured Bijoy Singhal as the model. It was interesting to talk to him afterwards, when we laughed at jokes together about his modeling assignment. TechEd India Keynote Opening Featuring Bijoy TechEd India 2010 Keynote – S. Somasegar Time: 11:15pm – 11:45pm Session 1: True Lies of SQL Server – SQL Myth Buster Following the excellent keynote, I had my very first session on the subject of SQL Server Myth Buster. At first, I was a bit nervous as right after the keynote, for this was my very first session and during my presentation I saw lots of Microsoft Product Team members. Well, it really went well and I had a really good discussion with attendees of the session. I felt that a well begin was half-done and my confidence was regained. Right after the session, I met a few of my Community friends and had meaningful discussions with them on many subjects. The abstract of the session is as follows: In this 30-minute demo session, I am going to briefly demonstrate few SQL Server Myths and their resolutions as I back them up with some demo. This demo presentation is a must-attend for all developers and administrators who would come to the event. This is going to be a very quick yet fun session. Pinal Presenting session at TechEd India 2010 Time: 1:00 PM – 2:00 PM Lunch with Somasegar After the session I went to see my daughter, and then I headed right away to the lunch with S. Somasegar – the keynote speaker and senior vice president of the Developer Division at Microsoft. I really thank to Abhishek who made it possible for us. Because of his efforts, all the MVPs had the opportunity to meet such a legendary person and had to talk with them on Microsoft Technology. Though Somasegar is currently holding such a high position in Microsoft, he is very polite and a real gentleman, and how I wish that everybody in industry is like him. Believe me, if you spread love and kindness, then that is what you will receive back. As soon as lunch time was over, I ran to the session hall as my second presentation was about to start. Time: 2:30pm – 3:30pm Session 2: Master Data Services in Microsoft SQL Server 2008 R2 Business Intelligence is a subject which was widely talked about at TechEd. Everybody was interested in this subject, and I did not excuse myself from this great concept as well. I consider myself fortunate as I was presenting on the subject of Master Data Services at TechEd. When I had initially learned this subject, I had a bit of confusion about the usage of this tool. Later on, I decided that I would tackle about how we all developers and DBAs are not able to understand something so simple such as this, and even worst, creating confusion about the technology. During system designing, it is very important to have a reference material or master lookup tables. Well, I talked about the same subject and presented the session keeping that as my center talk. The session went very well and I received lots of interesting questions. I got many compliments for talking about this subject on the real-life scenario. I really thank Rushabh Mehta (CEO, Solid Quality Mentors India) for his supportive suggestions that helped me prepare the slide deck, as well as the subject. Pinal Presenting session at TechEd India 2010 The abstract of the session is as follows: SQL Server Master Data Services will ship with SQL Server 2008 R2 and will improve Microsoft’s platform appeal. This session provides an in-depth demonstration of MDS features and highlights important usage scenarios. Master Data Services enables consistent decision-making process by allowing you to create, manage and propagate changes from a single master view of your business entities. Also, MDS – Master Data-hub which is a vital component, helps ensure the consistency of reporting across systems and deliver faster and more accurate results across the enterprise. We will talk about establishing the basis for a centralized approach to defining, deploying, and managing master data in the enterprise. Pinal Presenting session at TechEd India 2010 The day was still not over for me. I had ran into several friends but we were not able keep our enthusiasm under control about all the rumors saying that SQL Server 2008 R2 was about to be launched tomorrow in the keynote. I then ran to my third and final technical event for the day- a panel discussion with the top technologies of India. Time: 5:00pm – 6:00pm Panel Discussion: Harness the power of Web – SEO and Technical Blogging As I have delivered two technical sessions by this time, I was a bit tired but  not less enthusiastic when I had to talk about Blog and Technology. We discussed many different topics there. I told them that the most important aspect for any blog is its content. We discussed in depth the issues with plagiarism and how to avoid it. Another topic of discussion was how we technology bloggers can create awareness in the Community about what the right kind of blogging is and what morally and technically wrong acts are. A couple of questions were raised about what type of liberty a person can have in terms of writing blogs. Well, it was generically agreed that a blog is mainly a representation of our ideas and thoughts; it should not be governed by external entities. As long as one is writing what they really want to say, but not providing incorrect information or not practicing plagiarism, a blogger should be allowed to express himself. This panel discussion was supposed to be over in an hour, but the interest of the participants was remarkable and so it was extended for 30 minutes more. Finally, we decided to bring to a close the discussion and agreed that we will continue the topic next year. TechEd India Panel Discussion on Web, Technology and SEO Surprisingly, the day was just beginning after doing all of these. By this time, I have almost met all the MVP who arrived at the event, as well as many Microsoft employees. There were lots of Community folks present, too. I decided that I would go to meet several friends from the Community and continue to communicate with me on SQLAuthority.com. I also met Abhishek Baxi and had a good talk with him regarding Win Mobile and Twitter. He also took a very quick video of me wherein I spoke in my mother’s tongue, Gujarati. It was funny that I talked in Gujarati almost all the day, but when I was talking in the interview I could not find the right Gujarati words to speak. I think we all think in English when we think about Technology, so as to address universality. After meeting them, I headed towards the Speakers’ Dinner. Time: 8:00 PM – onwards Speakers Dinner The Speakers’ dinner was indeed a wonderful opportunity for all the speakers to get together and relax. We talked so many different things, from XBOX to Hindi Movies, and from SQL to Samosas. I just could not express how much fun I had. After a long evening, when I returned tmy room and met Shaivi, I just felt instantly relaxed. Kids are really gifts from God. Today was a really long but exciting day. So many things happened in just one day: Visual Studio Lanch, lunch with Somasegar, 2 technical sessions, 1 panel discussion, community leaders meeting, speakers dinner and, last but not leas,t playing with my child! A perfect day! Day 2 – April 13, 2010 Today started with a bang with the excellent keynote by Kamal Hathi who launched SQL Server 2008 R2 in India and demonstrated the power of PowerPivot to all of us. 101 Million Rows in Excel brought lots of applause from the audience. Kamal Hathi Presenting Keynote at TechEd India 2010 The day was a bit easier one for me. I had no sessions today and no events planned. I had a few meetings planned for the second day of the event. I sat in the speaker’s lounge for half a day and met many people there. I attended nearly 9 different meetings today. The subjects of the meetings were very different. Here is a list of the topics of the Community-related meetings: SQL PASS and its involvement in India and subcontinents How to start community blogging Forums and developing aptitude towards technology Ahmedabad/Gandhinagar User Groups and their developments SharePoint and SQL Business Meeting – a client meeting Business Meeting – a potential performance tuning project Business Meeting – Solid Quality Mentors (SolidQ) And family friends Pinal Dave at TechEd India The day passed by so quickly during this meeting. In the evening, I headed to Partners Expo with friends and checked out few of the booths. I really wanted to talk about some of the products, but due to the freebies there was so much crowd that I finally decided to just take the contact details of the partner. I will now start sending them with my queries and, hopefully, I will have my questions answered. Nupur and Shaivi had also one meeting to attend; it was with our family friend Vijay Raj. Vijay is also a person who loves Technology and loves it more than anybody. I see him growing and learning every day, but still remaining as a ‘human’. I believe that if someone acquires as much knowledge as him, that person will become either a computer or cyborg. Here, Vijay is still a kind gentleman and is able to stay as our close family friend. Shaivi was really happy to play with Uncle Vijay. Pinal Dave and Vijay Raj Renuka Prasad, a Microsoft MVP, impressed me with his passion and knowledge of SQL. Every time he gives me credit for his success, I believe that he is very humble. He has way more certifications than me and has worked many more years with SQL compared to me. He is an excellent photographer as well. Most of the photos in this blog post have been taken by him. I told him if ever he wants to do a part time job, he can do the photography very well. Pinal Dave and Renuka Prasad I also met L Srividya from Microsoft, whom I was looking forward to meet. She is a bundle of knowledge that everyone would surely learn a lot from her. I was able to get a few minutes from her and well, I felt confident. She enlightened me with SQL Server BI concepts, domain management and SQL Server security and few other interesting details. I also had a wonderful time talking about SharePoint with fellow Solid Quality Mentor Joy Rathnayake. He is very passionate about SharePoint but when you talk .NET and SQL with him, he is still overwhelmingly knowledgeable. In fact, while talking to him, I figured out that the recent training he delivered was on SQL Server 2008 R2. I told him a joke that it hurts my ego as he is more popular now in SQL training and consulting than me. I am sure all of you agree that working with good people is a gift from God. I am fortunate enough to work with the best of the best Industry experts. It was a great pleasure to hang out with my Community friends – Ahswin Kini, HimaBindu Vejella, Vasudev G, Suprotim Agrawal, Dhananjay, Vikram Pendse, Mahesh Dhola, Mahesh Mitkari,  Manu Zacharia, Shobhan, Hardik Shah, Ashish Mohta, Manan, Subodh Sohani and Sanjay Shetty (of course!) .  (Please let me know if I have met you at the event and forgot your name to list here). Time: 8:00 PM – onwards Community Leaders Dinner After lots of meetings, I headed towards the Community Leaders dinner meeting and met almost all the folks I met in morning. The discussion was almost the same but the real good thing was that we were enjoying it. The food was really good. Nupur was invited in the event, but Shaivi could not come. When Nupur tried to enter the event, she was stopped as Shaivi did not have the pass to enter the dinner. Nupur expressed that Shaivi is only 8 months old and does not eat outside food as well and could not stay by herself at this age, but the door keeper did not agree and asked that without the entry details Shaivi could not go in, but Nupur could. Nupur called me on phone and asked me to help her out. By the time, I was outside; the organizer of the event reached to the door and happily approved Shaivi to join the party. Once in the party, Shaivi had lots of fun meeting so many people. Shaivi Dave and Abhishek Kant Dean Guida (Infragistics President and CEO) and Pinal Dave (SQLAuthority.com) Day 3 – April 14, 2010 Though, it was last day, I was very much excited today as I was about to present my very favorite session. Query Optimization and Performance Tuning is my domain expertise and I make my leaving by consulting and training the same. Today’s session was on the same subject and as an additional twist, another subject about Spatial Database was presented. I was always intrigued with Spatial Database and I have enjoyed learning about it; however, I have never thought about Spatial Indexing before it was decided that I will do this session. I really thank Solid Quality Mentor Dr. Greg Low for his assistance in helping me prepare the slide deck and also review the content. Furthermore, today was really what I call my ‘learning day’ . So far I had not attended any session in TechEd and I felt a bit down for that. Everybody spends their valuable time & money to learn something new and exciting in TechEd and I had not attended a single session at the moment thinking that it was already last day of the event. I did have a plan for the day and I attended two technical sessions before my session of spatial database. I attended 2 sessions of Vinod Kumar. Vinod is a natural storyteller and there was no doubt that his sessions would be jam-packed. People attended his sessions simply because Vinod is syhe speaker. He did not have a single time disappointed audience; he is truly a good speaker. He knows his stuff very well. I personally do not think that in India he can be compared to anyone for SQL. Time: 12:30pm-1:30pm SQL Server Query Optimization, Execution and Debugging Query Performance I really had a fun time attending this session. Vinod made this session very interactive. The entire audience really got into the presentation and started participating in the event. Vinod was presenting a small problem with Query Tuning, which any developer would have encountered and solved with their help in such a fashion that a developer feels he or she have already resolved it. In one question, I was the only one who was ready to answer and Vinod told me in a light tone that I am now allowed to answer it! The audience really found it very amusing. There was a huge crowd around Vinod after the session. Vinod – A master storyteller! Time: 3:45pm-4:45pm Data Recovery / consistency with CheckDB This session was much heavier than the earlier one, and I must say this is my most favorite session I EVER attended in India. In this TechEd I have only attended two sessions, but in my career, I have attended numerous technical sessions not only in India, but all over the world. This session had taken my breath away. One by one, Vinod took the different databases, and started to corrupt them in different ways. Each database has some unique ways to get corrupted. Once that was done, Vinod started to show the DBCC CEHCKDB and demonstrated how it can solve your problem. He finally fixed all the databases with this single tool. I do have a good knowledge of this subject, but let me honestly admit that I have learned a lot from this session. I enjoyed and cheered during this session along with other attendees. I had total satisfaction that, just like everyone, I took advantage of the event and learned something. I am now TECHnically EDucated. Pinal Dave and Vinod Kumar After two very interactive and informative SQL Sessions from Vinod Kumar, the next turn me presenting on Spatial Database and Indexing. I got once again nervous but Vinod told me to stay natural and do my presentation. Well, once I got a huge stage with a total of four projectors and a large crowd, I felt better. Time: 5:00pm-6:00pm Session 3: Developing with SQL Server Spatial and Deep Dive into Spatial Indexing Pinal Presenting session at TechEd India 2010 Pinal Presenting session at TechEd India 2010 I kicked off this session with Michael J Swart‘s beautiful spatial image. This session was the last one for the day but, to my surprise, I had more than 200+ attendees. Slowly, the rain was starting outside and I was worried that the hall would not be full; despite this, there was not a single seat available in the first five minutes of the session. Thanks to all of you for attending my presentation. I had demonstrated the map of world (and India) and quickly explained what  Geographic and Geometry data types in Spatial Database are. This session had interesting story of Indexing and Comparison, as well as how different traditional indexes are from spatial indexing. Pinal Presenting session at TechEd India 2010 Due to the heavy rain during this event, the power went off for about 22 minutes (just an accident – nobodies fault). During these minutes, there were no audio, no video and no light. I continued to address the mass of 200+ people without any audio device and PowerPoint. I must thank the audience because not a single person left from the session. They all stayed in their place, some moved closure to listen to me properly. I noticed that the curiosity and eagerness to learn new things was at the peak even though it was the very last session of the TechEd. Everybody wanted get the maximum knowledge out of this whole event. I was touched by the support from audience. They listened and participated in my session even without any kinds of technology (no ppt, no mike, no AC, nothing). During these 22 minutes, I had completed my theory verbally. Pinal Presenting session at TechEd India 2010 After a while, we got the projector back online and we continued with some exciting demos. Many thanks to Microsoft people who worked energetically in background to get the backup power for project up. I had a very interesting demo wherein I overlaid Bangalore and Hyderabad on the India Map and find their aerial distance between them. After finding the aerial distance, we browsed online and found that SQL Server estimates the exact aerial distance between these two cities, as compared to the factual distance. There was a huge applause from the crowd on the subject that SQL Server takes into the count of the curvature of the earth and finds the precise distances based on details. During the process of finding the distance, I demonstrated a few examples of the indexes where I expressed how one can use those indexes to find these distances and how they can improve the performance of similar query. I also demonstrated few examples wherein we were able to see in which data type the Index is most useful. We finished the demos with a few more internal stuff. Pinal Presenting session at TechEd India 2010 Despite all issues, I was mostly satisfied with my presentation. I think it was the best session I have ever presented at any conference. There was no help from Technology for a while, but I still got lots of appreciation at the end. When we ended the session, the applause from the audience was so loud that for a moment, the rain was not audible. I was truly moved by the dedication of the Technology enthusiasts. Pinal Dave After Presenting session at TechEd India 2010 The abstract of the session is as follows: The Microsoft SQL Server 2008 delivers new spatial data types that enable you to consume, use, and extend location-based data through spatial-enabled applications. Attend this session to learn how to use spatial functionality in next version of SQL Server to build and optimize spatial queries. This session outlines the new geography data type to store geodetic spatial data and perform operations on it, use the new geometry data type to store planar spatial data and perform operations on it, take advantage of new spatial indexes for high performance queries, use the new spatial results tab to quickly and easily view spatial query results directly from within Management Studio, extend spatial data capabilities by building or integrating location-enabled applications through support for spatial standards and specifications and much more. Time: 8:00 PM – onwards Dinner by Sponsors After the lively session during the day, there was another dinner party courtesy of one of the sponsors of TechEd. All the MVPs and several Community leaders were present at the dinner. I would like to express my gratitude to Abhishek Kant for organizing this wonderful event for us. It was a blast and really relaxing in all angles. We all stayed there for a long time and talked about our sweet and unforgettable memories of the event. Pinal Dave and Bijoy Singhal It was really one wonderful event. After writing this much, I say that I have no words to express about how much I enjoyed TechEd. However, it is true that I shared with you only 1% of the total activities I have done at the event. There were so many people I have met, yet were not mentioned here although I wanted to write their names here, too . Anyway, I have learned so many things and up until now, I am not able to get over all the fun I had in this event. Pinal Dave at TechEd India 2010 The Next Days – April 15, 2010 – till today I am still not able to get my mind out of the whole experience I had at TechEd India 2010. It was like a whole Microsoft Family working together to celebrate a happy occasion. TechEd India – Truly An Unforgettable Experience! Reference : Pinal Dave (http://blog.SQLAuthority.com) Filed under: About Me, MVP, Pinal Dave, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, SQLAuthority Author Visit, SQLAuthority News, SQLServer, T SQL, Technology Tagged: TechEd, TechEdIn

    Read the article

  • Unity not Working 14.04

    - by Back.Slash
    I am using Ubuntu 14.04 LTS x64. I did a sudo apt-get upgrade yesterday and restarted my PC. Now my taskbar and panel are missing. When I try to restart Unity using unity --replace Then I get error: unity-panel-service stop/waiting compiz (core) - Info: Loading plugin: core compiz (core) - Info: Starting plugin: core unity-panel-service start/running, process 3906 compiz (core) - Info: Loading plugin: ccp compiz (core) - Info: Starting plugin: ccp compizconfig - Info: Backend : gsettings compizconfig - Info: Integration : true compizconfig - Info: Profile : unity compiz (core) - Info: Loading plugin: composite compiz (core) - Info: Starting plugin: composite compiz (core) - Info: Loading plugin: opengl compiz (core) - Info: Unity is fully supported by your hardware. compiz (core) - Info: Unity is fully supported by your hardware. compiz (core) - Info: Starting plugin: opengl libGL error: dlopen /usr/lib/x86_64-linux-gnu/dri/i965_dri.so failed (/usr/lib/x86_64-linux-gnu/dri/i965_dri.so: undefined symbol: _glapi_tls_Dispatch) libGL error: dlopen ${ORIGIN}/dri/i965_dri.so failed (${ORIGIN}/dri/i965_dri.so: cannot open shared object file: No such file or directory) libGL error: dlopen /usr/lib/dri/i965_dri.so failed (/usr/lib/dri/i965_dri.so: cannot open shared object file: No such file or directory) libGL error: unable to load driver: i965_dri.so libGL error: driver pointer missing libGL error: failed to load driver: i965 libGL error: dlopen /usr/lib/x86_64-linux-gnu/dri/swrast_dri.so failed (/usr/lib/x86_64-linux-gnu/dri/swrast_dri.so: undefined symbol: _glapi_tls_Dispatch) libGL error: dlopen ${ORIGIN}/dri/swrast_dri.so failed (${ORIGIN}/dri/swrast_dri.so: cannot open shared object file: No such file or directory) libGL error: dlopen /usr/lib/dri/swrast_dri.so failed (/usr/lib/dri/swrast_dri.so: cannot open shared object file: No such file or directory) libGL error: unable to load driver: swrast_dri.so libGL error: failed to load driver: swrast compiz (core) - Info: Loading plugin: compiztoolbox compiz (core) - Info: Starting plugin: compiztoolbox compiz (core) - Info: Loading plugin: decor compiz (core) - Info: Starting plugin: decor compiz (core) - Info: Loading plugin: vpswitch compiz (core) - Info: Starting plugin: vpswitch compiz (core) - Info: Loading plugin: snap compiz (core) - Info: Starting plugin: snap compiz (core) - Info: Loading plugin: mousepoll compiz (core) - Info: Starting plugin: mousepoll compiz (core) - Info: Loading plugin: resize compiz (core) - Info: Starting plugin: resize compiz (core) - Info: Loading plugin: place compiz (core) - Info: Starting plugin: place compiz (core) - Info: Loading plugin: move compiz (core) - Info: Starting plugin: move compiz (core) - Info: Loading plugin: wall compiz (core) - Info: Starting plugin: wall compiz (core) - Info: Loading plugin: grid compiz (core) - Info: Starting plugin: grid compiz (core) - Info: Loading plugin: regex compiz (core) - Info: Starting plugin: regex compiz (core) - Info: Loading plugin: imgpng compiz (core) - Info: Starting plugin: imgpng compiz (core) - Info: Loading plugin: session compiz (core) - Info: Starting plugin: session I/O warning : failed to load external entity "/home/sumeet/.compiz/session/10de541a813cc1a8fc140170575114755000000020350005" compiz (core) - Info: Loading plugin: gnomecompat compiz (core) - Info: Starting plugin: gnomecompat compiz (core) - Info: Loading plugin: animation compiz (core) - Info: Starting plugin: animation compiz (core) - Info: Loading plugin: fade compiz (core) - Info: Starting plugin: fade compiz (core) - Info: Loading plugin: unitymtgrabhandles compiz (core) - Info: Starting plugin: unitymtgrabhandles compiz (core) - Info: Loading plugin: workarounds compiz (core) - Info: Starting plugin: workarounds compiz (core) - Info: Loading plugin: scale compiz (core) - Info: Starting plugin: scale compiz (core) - Info: Loading plugin: expo compiz (core) - Info: Starting plugin: expo compiz (core) - Info: Loading plugin: ezoom compiz (core) - Info: Starting plugin: ezoom compiz (core) - Info: Loading plugin: unityshell compiz (core) - Info: Starting plugin: unityshell WARN 2014-06-02 18:46:23 unity.glib.dbus.server GLibDBusServer.cpp:579 Can't register object 'org.gnome.Shell' yet as we don't have a connection, waiting for it... ERROR 2014-06-02 18:46:23 unity.debug.interface DebugDBusInterface.cpp:216 Unable to load entry point in libxpathselect: libxpathselect.so.1.4: cannot open shared object file: No such file or directory compiz (unityshell) - Error: GL_ARB_vertex_buffer_object not supported ERROR 2014-06-02 18:46:23 unity.shell.compiz unityshell.cpp:3850 Impossible to delete the unity locked stamp file compiz (core) - Error: Plugin initScreen failed: unityshell compiz (core) - Error: Failed to start plugin: unityshell compiz (core) - Info: Unloading plugin: unityshell X Error of failed request: BadWindow (invalid Window parameter) Major opcode of failed request: 3 (X_GetWindowAttributes) Resource id in failed request: 0x3e000c9 Serial number of failed request: 10115 Current serial number in output stream: 10116 Any help would be highly appreciated. EDIT : My PC configuration description: Portable Computer product: Dell System XPS L502X (System SKUNumber) vendor: Dell Inc. version: 0.1 serial: 1006ZP1 width: 64 bits capabilities: smbios-2.6 dmi-2.6 vsyscall32 configuration: administrator_password=unknown boot=normal chassis=portable family=HuronRiver System frontpanel_password=unknown keyboard_password=unknown power-on_password=unknown sku=System SKUNumber uuid=44454C4C-3000-1030-8036-B1C04F5A5031 *-core description: Motherboard product: 0YR8NN vendor: Dell Inc. physical id: 0 version: A00 serial: .1006ZP1.CN4864314C0560. slot: Part Component *-firmware description: BIOS vendor: Dell Inc. physical id: 0 version: A11 date: 05/29/2012 size: 128KiB capacity: 2496KiB capabilities: pci pnp upgrade shadowing escd cdboot bootselect socketedrom edd int13floppy360 int13floppy1200 int13floppy720 int5printscreen int9keyboard int14serial int17printer int10video acpi usb ls120boot smartbattery biosbootspecification netboot *-cpu description: CPU product: Intel(R) Core(TM) i7-2630QM CPU @ 2.00GHz vendor: Intel Corp. physical id: 19 bus info: cpu@0 version: Intel(R) Core(TM) i7-2630QM CPU @ 2.00GHz serial: Not Supported by CPU slot: CPU size: 800MHz capacity: 800MHz width: 64 bits clock: 100MHz capabilities: x86-64 fpu fpu_exception wp vme de pse tsc msr pae mce cx8 apic sep mtrr pge mca cmov pat pse36 clflush dts acpi mmx fxsr sse sse2 ss ht tm pbe syscall nx rdtscp constant_tsc arch_perfmon pebs bts nopl xtopology nonstop_tsc aperfmperf eagerfpu pni pclmulqdq dtes64 monitor ds_cpl vmx est tm2 ssse3 cx16 xtpr pdcm pcid sse4_1 sse4_2 x2apic popcnt tsc_deadline_timer aes xsave avx lahf_lm ida arat epb xsaveopt pln pts dtherm tpr_shadow vnmi flexpriority ept vpid cpufreq configuration: cores=4 enabledcores=4 threads=8 *-cache:0 description: L1 cache physical id: 1a slot: L1-Cache size: 64KiB capacity: 64KiB capabilities: synchronous internal write-through data *-cache:1 description: L2 cache physical id: 1b slot: L2-Cache size: 256KiB capacity: 256KiB capabilities: synchronous internal write-through data *-cache:2 description: L3 cache physical id: 1c slot: L3-Cache size: 6MiB capacity: 6MiB capabilities: synchronous internal write-back unified *-memory description: System Memory physical id: 1d slot: System board or motherboard size: 6GiB *-bank:0 description: SODIMM DDR3 Synchronous 1333 MHz (0.8 ns) product: M471B5273DH0-CH9 vendor: Samsung physical id: 0 serial: 450F1160 slot: ChannelA-DIMM0 size: 4GiB width: 64 bits clock: 1333MHz (0.8ns) *-bank:1 description: SODIMM DDR3 Synchronous 1333 MHz (0.8 ns) product: HMT325S6BFR8C-H9 vendor: Hynix/Hyundai physical id: 1 serial: 0CA0E8E2 slot: ChannelB-DIMM0 size: 2GiB width: 64 bits clock: 1333MHz (0.8ns) *-pci description: Host bridge product: 2nd Generation Core Processor Family DRAM Controller vendor: Intel Corporation physical id: 100 bus info: pci@0000:00:00.0 version: 09 width: 32 bits clock: 33MHz *-pci:0 description: PCI bridge product: Xeon E3-1200/2nd Generation Core Processor Family PCI Express Root Port vendor: Intel Corporation physical id: 1 bus info: pci@0000:00:01.0 version: 09 width: 32 bits clock: 33MHz capabilities: pci pm msi pciexpress normal_decode bus_master cap_list configuration: driver=pcieport resources: irq:40 ioport:3000(size=4096) memory:f0000000-f10fffff ioport:c0000000(size=301989888) *-generic UNCLAIMED description: Unassigned class product: Illegal Vendor ID vendor: Illegal Vendor ID physical id: 0 bus info: pci@0000:01:00.0 version: ff width: 32 bits clock: 66MHz capabilities: bus_master vga_palette cap_list configuration: latency=255 maxlatency=255 mingnt=255 resources: memory:f0000000-f0ffffff memory:c0000000-cfffffff memory:d0000000-d1ffffff ioport:3000(size=128) memory:f1000000-f107ffff *-display description: VGA compatible controller product: 2nd Generation Core Processor Family Integrated Graphics Controller vendor: Intel Corporation physical id: 2 bus info: pci@0000:00:02.0 version: 09 width: 64 bits clock: 33MHz capabilities: msi pm vga_controller bus_master cap_list rom configuration: driver=i915 latency=0 resources: irq:52 memory:f1400000-f17fffff memory:e0000000-efffffff ioport:4000(size=64) *-communication description: Communication controller product: 6 Series/C200 Series Chipset Family MEI Controller #1 vendor: Intel Corporation physical id: 16 bus info: pci@0000:00:16.0 version: 04 width: 64 bits clock: 33MHz capabilities: pm msi bus_master cap_list configuration: driver=mei_me latency=0 resources: irq:50 memory:f1c05000-f1c0500f *-usb:0 description: USB controller product: 6 Series/C200 Series Chipset Family USB Enhanced Host Controller #2 vendor: Intel Corporation physical id: 1a bus info: pci@0000:00:1a.0 version: 05 width: 32 bits clock: 33MHz capabilities: pm debug ehci bus_master cap_list configuration: driver=ehci-pci latency=0 resources: irq:16 memory:f1c09000-f1c093ff *-multimedia description: Audio device product: 6 Series/C200 Series Chipset Family High Definition Audio Controller vendor: Intel Corporation physical id: 1b bus info: pci@0000:00:1b.0 version: 05 width: 64 bits clock: 33MHz capabilities: pm msi pciexpress bus_master cap_list configuration: driver=snd_hda_intel latency=0 resources: irq:53 memory:f1c00000-f1c03fff *-pci:1 description: PCI bridge product: 6 Series/C200 Series Chipset Family PCI Express Root Port 1 vendor: Intel Corporation physical id: 1c bus info: pci@0000:00:1c.0 version: b5 width: 32 bits clock: 33MHz capabilities: pci pciexpress msi pm normal_decode cap_list configuration: driver=pcieport resources: irq:16 *-pci:2 description: PCI bridge product: 6 Series/C200 Series Chipset Family PCI Express Root Port 2 vendor: Intel Corporation physical id: 1c.1 bus info: pci@0000:00:1c.1 version: b5 width: 32 bits clock: 33MHz capabilities: pci pciexpress msi pm normal_decode bus_master cap_list configuration: driver=pcieport resources: irq:17 memory:f1b00000-f1bfffff *-network description: Wireless interface product: Centrino Wireless-N 1030 [Rainbow Peak] vendor: Intel Corporation physical id: 0 bus info: pci@0000:03:00.0 logical name: mon.wlan0 version: 34 serial: bc:77:37:14:47:e5 width: 64 bits clock: 33MHz capabilities: pm msi pciexpress bus_master cap_list logical wireless ethernet physical configuration: broadcast=yes driver=iwlwifi driverversion=3.13.0-27-generic firmware=18.168.6.1 latency=0 link=no multicast=yes wireless=IEEE 802.11bgn resources: irq:51 memory:f1b00000-f1b01fff *-pci:3 description: PCI bridge product: 6 Series/C200 Series Chipset Family PCI Express Root Port 4 vendor: Intel Corporation physical id: 1c.3 bus info: pci@0000:00:1c.3 version: b5 width: 32 bits clock: 33MHz capabilities: pci pciexpress msi pm normal_decode bus_master cap_list configuration: driver=pcieport resources: irq:19 memory:f1a00000-f1afffff *-usb description: USB controller product: uPD720200 USB 3.0 Host Controller vendor: NEC Corporation physical id: 0 bus info: pci@0000:04:00.0 version: 04 width: 64 bits clock: 33MHz capabilities: pm msi msix pciexpress xhci bus_master cap_list configuration: driver=xhci_hcd latency=0 resources: irq:19 memory:f1a00000-f1a01fff *-pci:4 description: PCI bridge product: 6 Series/C200 Series Chipset Family PCI Express Root Port 5 vendor: Intel Corporation physical id: 1c.4 bus info: pci@0000:00:1c.4 version: b5 width: 32 bits clock: 33MHz capabilities: pci pciexpress msi pm normal_decode bus_master cap_list configuration: driver=pcieport resources: irq:16 memory:f1900000-f19fffff *-pci:5 description: PCI bridge product: 6 Series/C200 Series Chipset Family PCI Express Root Port 6 vendor: Intel Corporation physical id: 1c.5 bus info: pci@0000:00:1c.5 version: b5 width: 32 bits clock: 33MHz capabilities: pci pciexpress msi pm normal_decode bus_master cap_list configuration: driver=pcieport resources: irq:17 ioport:2000(size=4096) ioport:f1800000(size=1048576) *-network description: Ethernet interface product: RTL8111/8168/8411 PCI Express Gigabit Ethernet Controller vendor: Realtek Semiconductor Co., Ltd. physical id: 0 bus info: pci@0000:06:00.0 logical name: eth0 version: 06 serial: 14:fe:b5:a3:ac:40 size: 1Gbit/s capacity: 1Gbit/s width: 64 bits clock: 33MHz capabilities: pm msi pciexpress msix vpd bus_master cap_list ethernet physical tp mii 10bt 10bt-fd 100bt 100bt-fd 1000bt 1000bt-fd autonegotiation configuration: autonegotiation=on broadcast=yes driver=r8169 driverversion=2.3LK-NAPI duplex=full firmware=rtl_nic/rtl8168e-2.fw ip=172.19.167.151 latency=0 link=yes multicast=yes port=MII speed=1Gbit/s resources: irq:49 ioport:2000(size=256) memory:f1804000-f1804fff memory:f1800000-f1803fff *-usb:1 description: USB controller product: 6 Series/C200 Series Chipset Family USB Enhanced Host Controller #1 vendor: Intel Corporation physical id: 1d bus info: pci@0000:00:1d.0 version: 05 width: 32 bits clock: 33MHz capabilities: pm debug ehci bus_master cap_list configuration: driver=ehci-pci latency=0 resources: irq:23 memory:f1c08000-f1c083ff *-isa description: ISA bridge product: HM67 Express Chipset Family LPC Controller vendor: Intel Corporation physical id: 1f bus info: pci@0000:00:1f.0 version: 05 width: 32 bits clock: 33MHz capabilities: isa bus_master cap_list configuration: driver=lpc_ich latency=0 resources: irq:0 *-ide:0 description: IDE interface product: 6 Series/C200 Series Chipset Family 4 port SATA IDE Controller vendor: Intel Corporation physical id: 1f.2 bus info: pci@0000:00:1f.2 version: 05 width: 32 bits clock: 66MHz capabilities: ide pm bus_master cap_list configuration: driver=ata_piix latency=0 resources: irq:19 ioport:40b8(size=8) ioport:40cc(size=4) ioport:40b0(size=8) ioport:40c8(size=4) ioport:4090(size=16) ioport:4080(size=16) *-serial UNCLAIMED description: SMBus product: 6 Series/C200 Series Chipset Family SMBus Controller vendor: Intel Corporation physical id: 1f.3 bus info: pci@0000:00:1f.3 version: 05 width: 64 bits clock: 33MHz configuration: latency=0 resources: memory:f1c04000-f1c040ff ioport:efa0(size=32) *-ide:1 description: IDE interface product: 6 Series/C200 Series Chipset Family 2 port SATA IDE Controller vendor: Intel Corporation physical id: 1f.5 bus info: pci@0000:00:1f.5 version: 05 width: 32 bits clock: 66MHz capabilities: ide pm bus_master cap_list configuration: driver=ata_piix latency=0 resources: irq:19 ioport:40a8(size=8) ioport:40c4(size=4) ioport:40a0(size=8) ioport:40c0(size=4) ioport:4070(size=16) ioport:4060(size=16) *-scsi:0 physical id: 1 logical name: scsi0 capabilities: emulated *-disk description: ATA Disk product: SAMSUNG HN-M640M physical id: 0.0.0 bus info: scsi@0:0.0.0 logical name: /dev/sda version: 2AR1 serial: S2T3J1KBC00006 size: 596GiB (640GB) capabilities: partitioned partitioned:dos configuration: ansiversion=5 sectorsize=512 signature=6b746d91 *-volume:0 description: Windows NTFS volume physical id: 1 bus info: scsi@0:0.0.0,1 logical name: /dev/sda1 version: 3.1 serial: 0272-3e7f size: 348MiB capacity: 350MiB capabilities: primary bootable ntfs initialized configuration: clustersize=4096 created=2013-09-18 12:20:45 filesystem=ntfs label=System Reserved modified_by_chkdsk=true mounted_on_nt4=true resize_log_file=true state=dirty upgrade_on_mount=true *-volume:1 description: Extended partition physical id: 2 bus info: scsi@0:0.0.0,2 logical name: /dev/sda2 size: 116GiB capacity: 116GiB capabilities: primary extended partitioned partitioned:extended *-logicalvolume:0 description: Linux swap / Solaris partition physical id: 5 logical name: /dev/sda5 capacity: 6037MiB capabilities: nofs *-logicalvolume:1 description: Linux filesystem partition physical id: 6 logical name: /dev/sda6 logical name: / capacity: 110GiB configuration: mount.fstype=ext4 mount.options=rw,relatime,errors=remount-ro,data=ordered state=mounted *-volume:2 description: Windows NTFS volume physical id: 3 bus info: scsi@0:0.0.0,3 logical name: /dev/sda3 logical name: /media/os version: 3.1 serial: 4e7853ec-5555-a74d-82e0-9f49798d3772 size: 156GiB capacity: 156GiB capabilities: primary ntfs initialized configuration: clustersize=4096 created=2013-09-19 09:19:00 filesystem=ntfs label=OS mount.fstype=fuseblk mount.options=ro,nosuid,nodev,relatime,user_id=0,group_id=0,allow_other,blksize=4096 state=mounted *-volume:3 description: Windows NTFS volume physical id: 4 bus info: scsi@0:0.0.0,4 logical name: /dev/sda4 logical name: /media/data version: 3.1 serial: 7666d55f-e1bf-e645-9791-2a1a31b24b9a size: 322GiB capacity: 322GiB capabilities: primary ntfs initialized configuration: clustersize=4096 created=2013-09-17 23:27:01 filesystem=ntfs label=Data modified_by_chkdsk=true mount.fstype=fuseblk mount.options=rw,nosuid,nodev,relatime,user_id=0,group_id=0,allow_other,blksize=4096 mounted_on_nt4=true resize_log_file=true state=mounted upgrade_on_mount=true *-scsi:1 physical id: 2 logical name: scsi1 capabilities: emulated *-cdrom description: DVD-RAM writer product: DVD+-RW GT32N vendor: HL-DT-ST physical id: 0.0.0 bus info: scsi@1:0.0.0 logical name: /dev/cdrom logical name: /dev/sr0 version: A201 capabilities: removable audio cd-r cd-rw dvd dvd-r dvd-ram configuration: ansiversion=5 status=nodisc *-battery product: DELL vendor: SANYO physical id: 1 version: 2008 serial: 1.0 slot: Rear capacity: 57720mWh configuration: voltage=11.1V `

    Read the article

  • usb wifi dongle on ubuntu server, cannot install realtek driver RTL 8188cus

    - by Sandro Dzneladze
    I got cheap Ebay wifi dongle from HongKong, Im trying to set it up on my ubuntu server. Occasionally need to move server, so it cannot always be connected to router via lan. Anyhow, usb wifi came with a driver cd. I uploaded files to my home directory and tried to run install script (RTL 8188cus): sudo bash install.sh But I get error: Authentication requested [root] for make driver: make ARCH=x86_64 CROSS_COMPILE= -C /lib/modules/2.6.38-8-server/build M=/home/minime/RTL 8188cus/Linux/driver/rtl8192CU_linux_v2.0.1324.20110126 modules make[1]: Entering directory `/usr/src/linux-headers-2.6.38-8-server' make[1]: *** No rule to make target `8188cus/Linux/driver/rtl8192CU_linux_v2.0.1324.20110126'. Stop. make[1]: Leaving directory `/usr/src/linux-headers-2.6.38-8-server' make: *** [modules] Error 2 Compile make driver error: 2, Please check error Mesg Any ideas what Im doing wrong? There is another driver folder for linux called: RTL 81XX, which doesn't have install.sh at all! I tried to use make command, but I get: make: *** No targets specified and no makefile found. Stop. Any help? this is first time I'm installing driver from source. Im on Ubuntu 11.04 server. lsusb Bus 001 Device 002: ID 0bda:8176 Realtek Semiconductor Corp. lspci -nn 00:00.0 Host bridge [0600]: Intel Corporation N10 Family DMI Bridge [8086:a000] (rev 02) 00:02.0 VGA compatible controller [0300]: Intel Corporation N10 Family Integrated Graphics Controller [8086:a001] (rev 02) 00:1b.0 Audio device [0403]: Intel Corporation N10/ICH 7 Family High Definition Audio Controller [8086:27d8] (rev 02) 00:1c.0 PCI bridge [0604]: Intel Corporation N10/ICH 7 Family PCI Express Port 1 [8086:27d0] (rev 02) 00:1d.0 USB Controller [0c03]: Intel Corporation N10/ICH 7 Family USB UHCI Controller #1 [8086:27c8] (rev 02) 00:1d.1 USB Controller [0c03]: Intel Corporation N10/ICH 7 Family USB UHCI Controller #2 [8086:27c9] (rev 02) 00:1d.2 USB Controller [0c03]: Intel Corporation N10/ICH 7 Family USB UHCI Controller #3 [8086:27ca] (rev 02) 00:1d.3 USB Controller [0c03]: Intel Corporation N10/ICH 7 Family USB UHCI Controller #4 [8086:27cb] (rev 02) 00:1d.7 USB Controller [0c03]: Intel Corporation N10/ICH 7 Family USB2 EHCI Controller [8086:27cc] (rev 02) 00:1e.0 PCI bridge [0604]: Intel Corporation 82801 Mobile PCI Bridge [8086:2448] (rev e2) 00:1f.0 ISA bridge [0601]: Intel Corporation NM10 Family LPC Controller [8086:27bc] (rev 02) 00:1f.2 IDE interface [0101]: Intel Corporation N10/ICH7 Family SATA IDE Controller [8086:27c0] (rev 02) 00:1f.3 SMBus [0c05]: Intel Corporation N10/ICH 7 Family SMBus Controller [8086:27da] (rev 02) 01:00.0 Ethernet controller [0200]: Atheros Communications Device [1969:1083] (rev c0) sudo lshw description: Desktop Computer product: To Be Filled By O.E.M. (To Be Filled By O.E.M.) vendor: To Be Filled By O.E.M. version: To Be Filled By O.E.M. serial: To Be Filled By O.E.M. width: 64 bits capabilities: smbios-2.6 dmi-2.6 vsyscall64 vsyscall32 configuration: boot=normal chassis=desktop family=To Be Filled By O.E.M. sku=To Be Filled By O.E.M. uuid=00020003-0004-0005-0006-000700080009 *-core description: Motherboard product: AD525PV3 vendor: ASRock physical id: 0 *-firmware description: BIOS vendor: American Megatrends Inc. physical id: 0 version: P1.20 date: 04/01/2011 size: 64KiB capacity: 448KiB capabilities: pci upgrade shadowing cdboot bootselect socketedrom edd int13floppy1200 int13floppy720 int13floppy2880 int5printscreen int9keyboard int14serial int17printer int10video acpi usb ls120boot zipboot biosbootspecification netboot *-cpu description: CPU product: Intel(R) Atom(TM) CPU D525 @ 1.80GHz vendor: Intel Corp. physical id: 4 bus info: cpu@0 version: Intel(R) Atom(TM) CPU D525 @ 1.80GHz serial: To Be Filled By O.E.M. slot: CPUSocket size: 1800MHz capacity: 1800MHz width: 64 bits clock: 200MHz capabilities: x86-64 fpu fpu_exception wp vme de pse tsc msr pae mce cx8 apic sep mtrr pge mca cmov pat pse36 clflush dts acpi mmx fxsr sse sse2 ss ht tm pbe syscall nx constant_tsc arch_perfmon pebs bts rep_good nopl aperfmperf pni dtes64 monitor ds_cpl tm2 ssse3 cx16 xtpr pdcm movbe lahf_lm configuration: cores=2 enabledcores=2 threads=4 *-cache:0 description: L1 cache physical id: 5 slot: L1-Cache size: 48KiB capacity: 48KiB capabilities: internal write-back data *-cache:1 description: L2 cache physical id: 6 slot: L2-Cache size: 1MiB capacity: 1MiB capabilities: internal write-back unified *-memory description: System Memory physical id: c slot: System board or motherboard size: 2GiB *-bank:0 description: SODIMM DDR2 Synchronous 800 MHz (1.2 ns) product: ModulePartNumber00 vendor: Manufacturer00 physical id: 0 serial: SerNum00 slot: DIMM0 size: 2GiB width: 64 bits clock: 800MHz (1.2ns) *-bank:1 description: DIMM [empty] product: ModulePartNumber01 vendor: Manufacturer01 physical id: 1 serial: SerNum01 slot: DIMM1 *-pci description: Host bridge product: N10 Family DMI Bridge vendor: Intel Corporation physical id: 100 bus info: pci@0000:00:00.0 version: 02 width: 32 bits clock: 33MHz configuration: driver=agpgart-intel resources: irq:0 *-display description: VGA compatible controller product: N10 Family Integrated Graphics Controller vendor: Intel Corporation physical id: 2 bus info: pci@0000:00:02.0 version: 02 width: 32 bits clock: 33MHz capabilities: msi pm vga_controller bus_master cap_list rom configuration: driver=i915 latency=0 resources: irq:41 memory:fea80000-feafffff ioport:dc00(size=8) memory:e0000000-efffffff memory:fe900000-fe9fffff *-multimedia description: Audio device product: N10/ICH 7 Family High Definition Audio Controller vendor: Intel Corporation physical id: 1b bus info: pci@0000:00:1b.0 version: 02 width: 64 bits clock: 33MHz capabilities: pm msi pciexpress bus_master cap_list configuration: driver=HDA Intel latency=0 resources: irq:43 memory:fea78000-fea7bfff *-pci:0 description: PCI bridge product: N10/ICH 7 Family PCI Express Port 1 vendor: Intel Corporation physical id: 1c bus info: pci@0000:00:1c.0 version: 02 width: 32 bits clock: 33MHz capabilities: pci pciexpress msi pm normal_decode bus_master cap_list configuration: driver=pcieport resources: irq:40 ioport:e000(size=4096) memory:feb00000-febfffff ioport:80000000(size=2097152) *-network description: Ethernet interface product: Atheros Communications vendor: Atheros Communications physical id: 0 bus info: pci@0000:01:00.0 logical name: eth0 version: c0 serial: XX size: 100Mbit/s capacity: 1Gbit/s width: 64 bits clock: 33MHz capabilities: pm msi pciexpress vpd bus_master cap_list ethernet physical tp 10bt 10bt-fd 100bt 100bt-fd 1000bt-fd autonegotiation configuration: autonegotiation=on broadcast=yes driver=atl1c driverversion=1.0.1.0-NAPI duplex=full firmware=N/A ip=192.168.1.99 latency=0 link=yes multicast=yes port=twisted pair speed=100Mbit/s resources: irq:42 memory:febc0000-febfffff ioport:ec00(size=128) *-usb:0 description: USB Controller product: N10/ICH 7 Family USB UHCI Controller #1 vendor: Intel Corporation physical id: 1d bus info: pci@0000:00:1d.0 version: 02 width: 32 bits clock: 33MHz capabilities: uhci bus_master configuration: driver=uhci_hcd latency=0 resources: irq:23 ioport:d880(size=32) *-usb:1 description: USB Controller product: N10/ICH 7 Family USB UHCI Controller #2 vendor: Intel Corporation physical id: 1d.1 bus info: pci@0000:00:1d.1 version: 02 width: 32 bits clock: 33MHz capabilities: uhci bus_master configuration: driver=uhci_hcd latency=0 resources: irq:19 ioport:d800(size=32) *-usb:2 description: USB Controller product: N10/ICH 7 Family USB UHCI Controller #3 vendor: Intel Corporation physical id: 1d.2 bus info: pci@0000:00:1d.2 version: 02 width: 32 bits clock: 33MHz capabilities: uhci bus_master configuration: driver=uhci_hcd latency=0 resources: irq:18 ioport:d480(size=32) *-usb:3 description: USB Controller product: N10/ICH 7 Family USB UHCI Controller #4 vendor: Intel Corporation physical id: 1d.3 bus info: pci@0000:00:1d.3 version: 02 width: 32 bits clock: 33MHz capabilities: uhci bus_master configuration: driver=uhci_hcd latency=0 resources: irq:16 ioport:d400(size=32) *-usb:4 description: USB Controller product: N10/ICH 7 Family USB2 EHCI Controller vendor: Intel Corporation physical id: 1d.7 bus info: pci@0000:00:1d.7 version: 02 width: 32 bits clock: 33MHz capabilities: pm debug ehci bus_master cap_list configuration: driver=ehci_hcd latency=0 resources: irq:23 memory:fea77c00-fea77fff *-pci:1 description: PCI bridge product: 82801 Mobile PCI Bridge vendor: Intel Corporation physical id: 1e bus info: pci@0000:00:1e.0 version: e2 width: 32 bits clock: 33MHz capabilities: pci subtractive_decode bus_master cap_list *-isa description: ISA bridge product: NM10 Family LPC Controller vendor: Intel Corporation physical id: 1f bus info: pci@0000:00:1f.0 version: 02 width: 32 bits clock: 33MHz capabilities: isa bus_master cap_list configuration: latency=0 *-ide description: IDE interface product: N10/ICH7 Family SATA IDE Controller vendor: Intel Corporation physical id: 1f.2 bus info: pci@0000:00:1f.2 logical name: scsi0 version: 02 width: 32 bits clock: 66MHz capabilities: ide pm bus_master cap_list emulated configuration: driver=ata_piix latency=0 resources: irq:19 ioport:1f0(size=8) ioport:3f6 ioport:170(size=8) ioport:376 ioport:ff90(size=16) memory:80200000-802003ff *-disk description: ATA Disk product: WDC WD10TPVT-11U vendor: Western Digital physical id: 0.0.0 bus info: scsi@0:0.0.0 logical name: /dev/sda version: 01.0 serial: WD-WXC1A80P0314 size: 931GiB (1TB) capabilities: partitioned partitioned:dos configuration: ansiversion=5 signature=00088c47 *-volume:0 description: EXT4 volume vendor: Linux physical id: 1 bus info: scsi@0:0.0.0,1 logical name: /dev/sda1 logical name: /media/private version: 1.0 serial: 042daf2d-350c-4640-a76a-4554c9d98c59 size: 300GiB capacity: 300GiB capabilities: primary journaled extended_attributes large_files huge_files dir_nlink recover extents ext4 ext2 initialized configuration: created=2011-11-06 11:05:03 filesystem=ext4 label=Private lastmountpoint=/media/private modified=2012-04-13 20:01:16 mount.fstype=ext4 mount.options=rw,relatime,barrier=1,stripe=1,data=ordered mounted=2012-04-13 20:01:16 state=mounted *-volume:1 description: Extended partition physical id: 2 bus info: scsi@0:0.0.0,2 logical name: /dev/sda2 size: 625GiB capacity: 625GiB capabilities: primary extended partitioned partitioned:extended *-logicalvolume:0 description: Linux filesystem partition physical id: 5 logical name: /dev/sda5 logical name: /media/storage capacity: 600GiB configuration: mount.fstype=ext4 mount.options=rw,relatime,barrier=1,stripe=1,data=ordered state=mounted *-logicalvolume:1 description: Linux filesystem partition physical id: 6 logical name: /dev/sda6 logical name: /media/dropbox capacity: 24GiB configuration: mount.fstype=ext4 mount.options=rw,relatime,barrier=1,stripe=1,data=ordered state=mounted *-volume:2 description: EXT4 volume vendor: Linux physical id: 3 bus info: scsi@0:0.0.0,3 logical name: /dev/sda3 logical name: /media/www version: 1.0 serial: 9b0a27b4-05d8-40d5-bfc7-4aeba198db7b size: 2570MiB capacity: 2570MiB capabilities: primary journaled extended_attributes large_files huge_files dir_nlink recover extents ext4 ext2 initialized configuration: created=2011-11-06 11:05:11 filesystem=ext4 label=www lastmountpoint=/media/www modified=2012-04-15 11:31:12 mount.fstype=ext4 mount.options=rw,relatime,barrier=1,stripe=1,data=ordered mounted=2012-04-15 11:31:12 state=mounted *-volume:3 description: Linux swap volume physical id: 4 bus info: scsi@0:0.0.0,4 logical name: /dev/sda4 version: 1 serial: 6ed1130e-3aad-4fa6-890b-77e729121e3b size: 4098MiB capacity: 4098MiB capabilities: primary nofs swap initialized configuration: filesystem=swap pagesize=4096 *-serial UNCLAIMED description: SMBus product: N10/ICH 7 Family SMBus Controller vendor: Intel Corporation physical id: 1f.3 bus info: pci@0000:00:1f.3 version: 02 width: 32 bits clock: 33MHz configuration: latency=0 resources: ioport:400(size=32) *-scsi physical id: 1 bus info: usb@1:4 logical name: scsi2 capabilities: emulated scsi-host configuration: driver=usb-storage *-disk description: SCSI Disk physical id: 0.0.0 bus info: scsi@2:0.0.0 logical name: /dev/sdb size: 3864MiB (4051MB) capabilities: partitioned partitioned:dos configuration: signature=000b4c55 *-volume description: EXT4 volume vendor: Linux physical id: 1 bus info: scsi@2:0.0.0,1 logical name: /dev/sdb1 logical name: / version: 1.0 serial: 33926e39-4685-4f63-b83c-f2a67824b69a size: 3862MiB capacity: 3862MiB capabilities: primary bootable journaled extended_attributes large_files huge_files dir_nlink recover extents ext4 ext2 initialized configuration: created=2011-10-11 14:03:46 filesystem=ext4 lastmountpoint=/ modified=2012-03-19 11:47:29 mount.fstype=ext4 mount.options=rw,noatime,errors=remount-ro,barrier=1,data=ordered mounted=2012-04-15 11:31:11 state=mounted rfkill list all Doesnt show anything! dmesg | grep -i firmware [ 0.715481] pci 0000:00:1f.0: [Firmware Bug]: TigerPoint LPC.BM_STS cleared

    Read the article

  • External usb 3.0 hard drive is not recognised when plugged into usb 3 port (ubuntu natty 64 bit).

    - by kimangroo
    I have an Iomega Prestige Portable External Hard Drive 1TB USB 3.0. It works fine on windows 7 as a usb 3.0 drive. It isn't detected on ubuntu natty 64bit, 2.6.38-8-generic. fdisk -l cannot see it at all: Disk /dev/sda: 500.1 GB, 500107862016 bytes 255 heads, 63 sectors/track, 60801 cylinders Units = cylinders of 16065 * 512 = 8225280 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x1bed746b Device Boot Start End Blocks Id System /dev/sda1 1 1689 13560832 27 Unknown /dev/sda2 * 1689 1702 102400 7 HPFS/NTFS /dev/sda3 1702 19978 146805760 7 HPFS/NTFS /dev/sda4 19978 60802 327914497 5 Extended /dev/sda5 25555 60802 283120640 7 HPFS/NTFS /dev/sda6 19978 23909 31571968 83 Linux /dev/sda7 23909 25555 13218816 82 Linux swap / Solaris Partition table entries are not in disk order lsusb can see it: Bus 003 Device 003: ID 059b:0070 Iomega Corp. Bus 003 Device 001: ID 1d6b:0003 Linux Foundation 3.0 root hub Bus 002 Device 004: ID 05fe:0011 Chic Technology Corp. Browser Mouse Bus 002 Device 003: ID 0a12:0001 Cambridge Silicon Radio, Ltd Bluetooth Dongle (HCI mode) Bus 002 Device 002: ID 8087:0024 Intel Corp. Integrated Rate Matching Hub Bus 002 Device 001: ID 1d6b:0002 Linux Foundation 2.0 root hub Bus 001 Device 005: ID 0489:e00f Foxconn / Hon Hai Bus 001 Device 004: ID 0c45:64b5 Microdia Bus 001 Device 003: ID 08ff:168f AuthenTec, Inc. Bus 001 Device 002: ID 8087:0024 Intel Corp. Integrated Rate Matching Hub Bus 001 Device 001: ID 1d6b:0002 Linux Foundation 2.0 root hub And dmesg | grep -i xhci (I may have unplugged the drive and plugged it back in again after booting): [ 1.659060] pci 0000:04:00.0: xHCI HW did not halt within 2000 usec status = 0x0 [ 11.484971] xhci_hcd 0000:04:00.0: PCI INT A -> GSI 18 (level, low) -> IRQ 18 [ 11.484997] xhci_hcd 0000:04:00.0: setting latency timer to 64 [ 11.485002] xhci_hcd 0000:04:00.0: xHCI Host Controller [ 11.485064] xhci_hcd 0000:04:00.0: new USB bus registered, assigned bus number 3 [ 11.636149] xhci_hcd 0000:04:00.0: irq 18, io mem 0xc5400000 [ 11.636241] xhci_hcd 0000:04:00.0: irq 43 for MSI/MSI-X [ 11.636246] xhci_hcd 0000:04:00.0: irq 44 for MSI/MSI-X [ 11.636251] xhci_hcd 0000:04:00.0: irq 45 for MSI/MSI-X [ 11.636256] xhci_hcd 0000:04:00.0: irq 46 for MSI/MSI-X [ 11.636261] xhci_hcd 0000:04:00.0: irq 47 for MSI/MSI-X [ 11.639654] xHCI xhci_add_endpoint called for root hub [ 11.639655] xHCI xhci_check_bandwidth called for root hub [ 11.956366] usb 3-1: new SuperSpeed USB device using xhci_hcd and address 2 [ 12.001073] xhci_hcd 0000:04:00.0: WARN: short transfer on control ep [ 12.007059] xhci_hcd 0000:04:00.0: WARN: short transfer on control ep [ 12.012932] xhci_hcd 0000:04:00.0: WARN: short transfer on control ep [ 12.018922] xhci_hcd 0000:04:00.0: WARN: short transfer on control ep [ 12.049139] xhci_hcd 0000:04:00.0: WARN: short transfer on control ep [ 12.056754] xhci_hcd 0000:04:00.0: WARN: short transfer on control ep [ 12.131607] xhci_hcd 0000:04:00.0: WARN no SS endpoint bMaxBurst [ 12.179717] xhci_hcd 0000:04:00.0: WARN: short transfer on control ep [ 12.686876] xhci_hcd 0000:04:00.0: WARN: babble error on endpoint [ 12.687058] xhci_hcd 0000:04:00.0: WARN Set TR Deq Ptr cmd invalid because of stream ID configuration [ 12.687152] xhci_hcd 0000:04:00.0: ERROR Transfer event for disabled endpoint or incorrect stream ring [ 43.330737] usb 3-1: reset SuperSpeed USB device using xhci_hcd and address 2 [ 43.422579] xhci_hcd 0000:04:00.0: WARN: short transfer on control ep [ 43.422658] xhci_hcd 0000:04:00.0: xHCI xhci_drop_endpoint called with disabled ep ffff88014669af00 [ 43.422665] xhci_hcd 0000:04:00.0: xHCI xhci_drop_endpoint called with disabled ep ffff88014669af40 [ 43.422671] xhci_hcd 0000:04:00.0: xHCI xhci_drop_endpoint called with disabled ep ffff88014669af80 [ 43.422677] xhci_hcd 0000:04:00.0: xHCI xhci_drop_endpoint called with disabled ep ffff88014669afc0 [ 43.531159] xhci_hcd 0000:04:00.0: WARN no SS endpoint bMaxBurst [ 125.160248] xhci_hcd 0000:04:00.0: WARN no SS endpoint bMaxBurst [ 903.766466] usb 3-1: new SuperSpeed USB device using xhci_hcd and address 3 [ 903.807789] xhci_hcd 0000:04:00.0: WARN: short transfer on control ep [ 903.813530] xhci_hcd 0000:04:00.0: WARN: short transfer on control ep [ 903.819400] xhci_hcd 0000:04:00.0: WARN: short transfer on control ep [ 903.825104] xhci_hcd 0000:04:00.0: WARN: short transfer on control ep [ 903.855067] xhci_hcd 0000:04:00.0: WARN: short transfer on control ep [ 903.862314] xhci_hcd 0000:04:00.0: WARN: short transfer on control ep [ 903.862597] xhci_hcd 0000:04:00.0: WARN no SS endpoint bMaxBurst [ 903.913211] xhci_hcd 0000:04:00.0: WARN: short transfer on control ep [ 904.424416] xhci_hcd 0000:04:00.0: WARN: babble error on endpoint [ 904.424599] xhci_hcd 0000:04:00.0: WARN Set TR Deq Ptr cmd invalid because of stream ID configuration [ 904.424700] xhci_hcd 0000:04:00.0: ERROR Transfer event for disabled endpoint or incorrect stream ring [ 935.139021] usb 3-1: reset SuperSpeed USB device using xhci_hcd and address 3 [ 935.226075] xhci_hcd 0000:04:00.0: WARN: short transfer on control ep [ 935.226140] xhci_hcd 0000:04:00.0: xHCI xhci_drop_endpoint called with disabled ep ffff880148186b00 [ 935.226148] xhci_hcd 0000:04:00.0: xHCI xhci_drop_endpoint called with disabled ep ffff880148186b40 [ 935.226153] xhci_hcd 0000:04:00.0: xHCI xhci_drop_endpoint called with disabled ep ffff880148186b80 [ 935.226159] xhci_hcd 0000:04:00.0: xHCI xhci_drop_endpoint called with disabled ep ffff880148186bc0 [ 935.343339] xhci_hcd 0000:04:00.0: WARN no SS endpoint bMaxBurst I thought it might be that the firmware wasn't compatible with linux or something, but when booting a live image of partedmagic, (2.6.38.4-pmagic), the drive was detected fine, I could mount it and got usb 3.0 speeds (at least they double the speeds I got from plugging same drive in usb 2 ports). dmesg in partedmagic did say something about no SuperSpeed endpoint which was an error I saw in a previous dmesg of ubuntu: Jun 27 15:49:02 (none) user.info kernel: [ 2.978743] xhci_hcd 0000:04:00.0: PCI INT A -> GSI 18 (level, low) -> IRQ 18 Jun 27 15:49:02 (none) user.debug kernel: [ 2.978771] xhci_hcd 0000:04:00.0: setting latency timer to 64 Jun 27 15:49:02 (none) user.info kernel: [ 2.978781] xhci_hcd 0000:04:00.0: xHCI Host Controller Jun 27 15:49:02 (none) user.info kernel: [ 2.978856] xhci_hcd 0000:04:00.0: new USB bus registered, assigned bus number 3 Jun 27 15:49:02 (none) user.info kernel: [ 3.089458] xhci_hcd 0000:04:00.0: irq 18, io mem 0xc5400000 Jun 27 15:49:02 (none) user.debug kernel: [ 3.089541] xhci_hcd 0000:04:00.0: irq 42 for MSI/MSI-X Jun 27 15:49:02 (none) user.debug kernel: [ 3.089544] xhci_hcd 0000:04:00.0: irq 43 for MSI/MSI-X Jun 27 15:49:02 (none) user.debug kernel: [ 3.089546] xhci_hcd 0000:04:00.0: irq 44 for MSI/MSI-X Jun 27 15:49:02 (none) user.debug kernel: [ 3.089548] xhci_hcd 0000:04:00.0: irq 45 for MSI/MSI-X Jun 27 15:49:02 (none) user.debug kernel: [ 3.089550] xhci_hcd 0000:04:00.0: irq 46 for MSI/MSI-X Jun 27 15:49:02 (none) user.warn kernel: [ 3.092857] usb usb3: No SuperSpeed endpoint companion for config 1 interface 0 altsetting 0 ep 129: using minimum values Jun 27 15:49:02 (none) user.info kernel: [ 3.092864] usb usb3: New USB device found, idVendor=1d6b, idProduct=0003 Jun 27 15:49:02 (none) user.info kernel: [ 3.092866] usb usb3: New USB device strings: Mfr=3, Product=2, SerialNumber=1 Jun 27 15:49:02 (none) user.info kernel: [ 3.092867] usb usb3: Product: xHCI Host Controller Jun 27 15:49:02 (none) user.info kernel: [ 3.092869] usb usb3: Manufacturer: Linux 2.6.38.4-pmagic xhci_hcd Jun 27 15:49:02 (none) user.info kernel: [ 3.092870] usb usb3: SerialNumber: 0000:04:00.0 Jun 27 15:49:02 (none) user.debug kernel: [ 3.092961] xHCI xhci_add_endpoint called for root hub Jun 27 15:49:02 (none) user.debug kernel: [ 3.092963] xHCI xhci_check_bandwidth called for root hub Well I have no idea what's going wrong, and I haven't had much luck from google and the forums so far. A number of unanswered threads with people with similar error messages and problems only. Hopefully someone here can help or point me in the right direction?!

    Read the article

  • Make a Drive Image Using an Ubuntu Live CD

    - by Trevor Bekolay
    Cloning a hard drive is useful, but what if you have to make several copies, or you just want to make a complete backup of a hard drive? Drive images let you put everything, and we mean everything, from your hard drive in one big file. With an Ubuntu Live CD, this is a simple process – the versatile tool dd can do this for us right out of the box. We’ve used dd to clone a hard drive before. Making a drive image is very similar, except instead of copying data from one hard drive to another, we copy from a hard drive to a file. Drive images are more flexible, as you can do what you please with the data once you’ve pulled it off the source drive. Your drive image is going to be a big file, depending on the size of your source drive – dd will copy every bit of it, even if there’s only one tiny file stored on the whole hard drive. So, to start, make sure you have a device connected to your computer that will be large enough to hold the drive image. Some ideas for places to store the drive image, and how to connect to them in an Ubuntu Live CD, can be found at this previous Live CD article. In this article, we’re going to make an image of a 1GB drive, and store it on another hard drive in the same PC. Note: always be cautious when using dd, as it’s very easy to completely wipe out a drive, as we will show later in this article. Creating a Drive Image Boot up into the Ubuntu Live CD environment. Since we’re going to store the drive image on a local hard drive, we first have to mount it. Click on Places and then the location that you want to store the image on – in our case, a 136GB internal drive. Open a terminal window (Applications > Accessories > Terminal) and navigate to the newly mounted drive. All mounted drives should be in /media, so we’ll use the command cd /media and then type the first few letters of our difficult-to-type drive, press tab to auto-complete the name, and switch to that directory. If you wish to place the drive image in a specific folder, then navigate to it now. We’ll just place our drive image in the root of our mounted drive. The next step is to determine the identifier for the drive you want to make an image of. In the terminal window, type in the command sudo fdisk -l Our 1GB drive is /dev/sda, so we make a note of that. Now we’ll use dd to make the image. The invocation is sudo dd if=/dev/sda of=./OldHD.img This means that we want to copy from the input file (“if”) /dev/sda (our source drive) to the output file (“of”) OldHD.img, which is located in the current working directory (that’s the “.” portion of the “of” string). It takes some time, but our image has been created…Let’s test to make sure it works. Drive Image Testing: Wiping the Drive Another interesting thing that dd can do is totally wipe out the data on a drive (a process we’ve covered before). The command for that is sudo dd if=/dev/urandom of=/dev/sda This takes some random data as input, and outputs it to our drive, /dev/sda. If we examine the drive now using sudo fdisk –l, we can see that the drive is, indeed, wiped. Drive Image Testing: Restoring the Drive Image We can restore our drive image with a call to dd that’s very similar to how we created the image. The only difference is that the image is going to be out input file, and the drive now our output file. The exact invocation is sudo dd if=./OldHD.img of=/dev/sda It takes a while, but when it’s finished, we can confirm with sudo fdisk –l that our drive is back to the way it used to be! Conclusion There are a lots of reasons to create a drive image, with backup being the most obvious. Fortunately, with dd creating a drive image only takes one line in a terminal window – if you’ve got an Ubuntu Live CD handy! Similar Articles Productive Geek Tips Reset Your Ubuntu Password Easily from the Live CDCreate a Bootable Ubuntu USB Flash Drive the Easy WayHow to Browse Without a Trace with an Ubuntu Live CDWipe, Delete, and Securely Destroy Your Hard Drive’s Data the Easy WayClone a Hard Drive Using an Ubuntu Live CD TouchFreeze Alternative in AutoHotkey The Icy Undertow Desktop Windows Home Server – Backup to LAN The Clear & Clean Desktop Use This Bookmarklet to Easily Get Albums Use AutoHotkey to Assign a Hotkey to a Specific Window Latest Software Reviews Tinyhacker Random Tips HippoRemote Pro 2.2 Xobni Plus for Outlook All My Movies 5.9 CloudBerry Online Backup 1.5 for Windows Home Server Microsoft Office Web Apps Guide Know if Someone Accessed Your Facebook Account Shop for Music with Windows Media Player 12 Access Free Documentaries at BBC Documentaries Rent Cameras In Bulk At CameraRenter Download Songs From MySpace

    Read the article

  • Delete merge history in a branch in TFS

    - by JMarsch
    Suppose I have a main branch and a dev branch. Suppose I merge some stuff from dev into main. I check in the merge Now I decide "whoops, the dev branch wasn't really ready for me to merge into main yet." I want to tell TFS: remove that change set from main and forget that the merge ever happened. Rolling back the changeset is easy enough -- I can use the TFS powertools ROLLBACK command. on the Main branch (with the /changeset /recursive flags) However, I will get a warning from the rollback that the merge history for the files has not been deleted. Effect: Later, when dev is ready to be merged into main, the changes in the files that were rolled back previously are NOT merged into Main (this is because TFS "thinks" that those merges are already done. My goal: When I rollback, make TFS remove the merge history so that when I merge dev into main later on, everything merges. How can I do that? BTW: I'm using TFS 2008 SP1

    Read the article

  • Recovering from apt-get upgrade gone wrong due to a full disk

    - by Peter
    I was performing an apt-get upgrade on an Ubuntu 12.04.5 LTS box that hadn't been updated in a little while and the upgrade failed due to 'No space left on device'. After a little while I worked out space meant inodes and I have freed some up but unfortunately things have been left something askew. I have tried manually installing the old versions of packages mentioned using dpkg -i but that doesn't help. I have tried apt-get upgrade and apt-get -f install to no avail. Results are below. Any ideas how to fix things up? FIXED: Installing the earlier versions again manually via dpkg -i and then apt-get -f install has done the trick. Not sure why this didn't work the first time. The packages in question are listed below but they will presumably vary. libssl1.0.0_1.0.1-4ubuntu5.14_i386.deb linux-headers-3.2.0-64-generic-pae_3.2.0-64.97_i386.deb linux-image-generic-pae_3.2.0.64.76_i386.deb linux-headers-3.2.0-64_3.2.0-64.97_all.deb linux-headers-generic-pae_3.2.0.64.76_i386.deb root@unlinked:/tmp# apt-get upgrade Reading package lists... Done Building dependency tree Reading state information... Done You might want to run ‘apt-get -f install’ to correct these. The following packages have unmet dependencies. libssl-dev : Depends: libssl1.0.0 (= 1.0.1-4ubuntu5.14) but 1.0.1-4ubuntu5.17 is installed linux-generic-pae : Depends: linux-image-generic-pae (= 3.2.0.64.76) but 3.2.0.67.79 is installed Depends: linux-headers-generic-pae (= 3.2.0.64.76) but 3.2.0.67.79 is installed E: Unmet dependencies. Try using -f. root@unlinked:/tmp# apt-get -f install Reading package lists... Done Building dependency tree Reading state information... Done Correcting dependencies... Done The following packages were automatically installed and are no longer required: linux-headers-3.2.0-43-generic-pae linux-headers-3.2.0-38-generic-pae linux-headers-3.2.0-41-generic-pae linux-headers-3.2.0-36-generic-pae linux-headers-3.2.0-63-generic-pae linux-headers-3.2.0-58-generic-pae linux-headers-3.2.0-60-generic-pae linux-headers-3.2.0-55-generic-pae linux-headers-3.2.0-40 linux-headers-3.2.0-41 linux-headers-3.2.0-36 linux-headers-3.2.0-37 linux-headers-3.2.0-43 linux-headers-3.2.0-38 linux-headers-3.2.0-44 linux-headers-3.2.0-39 linux-headers-3.2.0-45 linux-headers-3.2.0-51 linux-headers-3.2.0-52 linux-headers-3.2.0-53 linux-headers-3.2.0-48 linux-headers-3.2.0-54 linux-headers-3.2.0-60 linux-headers-3.2.0-55 linux-headers-3.2.0-61 linux-headers-3.2.0-56 linux-headers-3.2.0-57 linux-headers-3.2.0-63 linux-headers-3.2.0-58 linux-headers-3.2.0-59 linux-headers-3.2.0-52-generic-pae linux-headers-3.2.0-44-generic-pae linux-headers-3.2.0-39-generic-pae linux-headers-3.2.0-37-generic-pae linux-headers-3.2.0-59-generic-pae linux-headers-3.2.0-61-generic-pae linux-headers-3.2.0-56-generic-pae linux-headers-3.2.0-53-generic-pae linux-headers-3.2.0-48-generic-pae linux-headers-3.2.0-45-generic-pae linux-headers-3.2.0-40-generic-pae linux-headers-3.2.0-57-generic-pae linux-headers-3.2.0-54-generic-pae linux-headers-3.2.0-51-generic-pae Use 'apt-get autoremove' to remove them. The following extra packages will be installed: libssl-dev linux-generic-pae The following packages will be upgraded: libssl-dev linux-generic-pae 2 to upgrade, 0 to newly install, 0 to remove and 0 not to upgrade. 2 not fully installed or removed. Need to get 0 B/1,427 kB of archives. After this operation, 1,024 B of additional disk space will be used. Do you want to continue [Y/n]? y dpkg: dependency problems prevent configuration of libssl-dev: libssl-dev depends on libssl1.0.0 (= 1.0.1-4ubuntu5.14); however: Version of libssl1.0.0 on system is 1.0.1-4ubuntu5.17. dpkg: error processing libssl-dev (--configure): dependency problems - leaving unconfigured No apport report written because the error message indicates it's a follow-up error from a previous failure. dpkg: dependency problems prevent configuration of linux-generic-pae: linux-generic-pae depends on linux-image-generic-pae (= 3.2.0.64.76); however: Version of linux-image-generic-pae on system is 3.2.0.67.79. linux-generic-pae depends on linux-headers-generic-pae (= 3.2.0.64.76); however: Version of linux-headers-generic-pae on system is 3.2.0.67.79. dpkg: error processing linux-generic-pae (--configure): dependency problems - leaving unconfigured No apport report written because the error message indicates it's a follow-up error from a previous failure. Errors were encountered while processing: libssl-dev linux-generic-pae E: Sub-process /usr/bin/dpkg returned an error code (1)

    Read the article

< Previous Page | 60 61 62 63 64 65 66 67 68 69 70 71  | Next Page >