Search Results

Search found 1637 results on 66 pages for 'ids'.

Page 65/66 | < Previous Page | 61 62 63 64 65 66  | Next Page >

  • I need help with Widget and PendingIntents

    - by YaW
    Hi, I've asked here a question about Task Killers and widgets stop working (SO Question) but now, I have reports of user that they don't use any Task Killer and the widgets didn't work after a while. I have a Nexus One and I don't have this problem. I don't know if this is a problem of memory or something. Based on the API: A PendingIntent itself is simply a reference to a token maintained by the system describing the original data used to retrieve it. This means that, even if its owning application's process is killed, the PendingIntent itself will remain usable from other processes that have been given it. So, I don't know why widget stop working, if Android doesn't kill the PendingIntent by itself, what's the problem? This is my manifest code: <receiver android:name=".widget.InstantWidget" android:label="@string/app_name"> <intent-filter> <action android:name="android.appwidget.action.APPWIDGET_UPDATE" /> </intent-filter> <meta-data android:name="android.appwidget.provider" android:resource="@xml/widget_provider" /> </receiver> And the widget code: public class InstantWidget extends AppWidgetProvider { public static ArrayList<Integer> alWidgetsId = new ArrayList<Integer>(); private static final String PREFS_NAME = "com.cremagames.instant.InstantWidget"; private static final String PREF_PREFIX_NOM = "nom_"; private static final String PREF_PREFIX_RAW = "raw_"; /** * Esto se llama cuando se crea el widget. Metemos en las preferencias los valores de nombre y raw para tenerlos en proximos reboot. * @param context * @param appWidgetManager * @param appWidgetId * @param nombreSound * @param rawSound */ static void updateAppWidget(Context context, AppWidgetManager appWidgetManager, int appWidgetId, String nombreSound, int rawSound){ //Guardamos en las prefs los valores SharedPreferences.Editor prefs = context.getSharedPreferences(PREFS_NAME, 0).edit(); prefs.putString(PREF_PREFIX_NOM + appWidgetId, nombreSound); prefs.putInt(PREF_PREFIX_RAW + appWidgetId, rawSound); prefs.commit(); //Actualizamos la interfaz updateWidgetGrafico(context, appWidgetManager, appWidgetId, nombreSound, rawSound); } /** * Actualiza la interfaz gráfica del widget (pone el nombre y crea el intent con el raw) * @param context * @param appWidgetManager * @param appWidgetId * @param nombreSound * @param rawSound */ private static void updateWidgetGrafico(Context context, AppWidgetManager appWidgetManager, int appWidgetId, String nombreSound, int rawSound){ RemoteViews remoteViews = new RemoteViews(context.getPackageName(), R.layout.widget); //Nombre del Button remoteViews.setTextViewText(R.id.tvWidget, nombreSound); //Creamos el PendingIntent para el onclik del boton Intent active = new Intent(context, InstantWidget.class); active.setAction(String.valueOf(appWidgetId)); active.putExtra("sonido", rawSound); PendingIntent actionPendingIntent = PendingIntent.getBroadcast(context, 0, active, 0); actionPendingIntent.cancel(); actionPendingIntent = PendingIntent.getBroadcast(context, 0, active, 0); remoteViews.setOnClickPendingIntent(R.id.btWidget, actionPendingIntent); appWidgetManager.updateAppWidget(appWidgetId, remoteViews); } public void onReceive(Context context, Intent intent) { final String action = intent.getAction(); //Esto se usa en la 1.5 para que se borre bien el widget if (AppWidgetManager.ACTION_APPWIDGET_DELETED.equals(action)) { final int appWidgetId = intent.getExtras().getInt( AppWidgetManager.EXTRA_APPWIDGET_ID, AppWidgetManager.INVALID_APPWIDGET_ID); if (appWidgetId != AppWidgetManager.INVALID_APPWIDGET_ID) { this.onDeleted(context, new int[] { appWidgetId }); } } else { //Listener de los botones for(int i=0; i<alWidgetsId.size(); i++){ if (intent.getAction().equals(String.valueOf(alWidgetsId.get(i)))) { int sonidoRaw = 0; try { sonidoRaw = intent.getIntExtra("sonido", 0); } catch (NullPointerException e) { } MediaPlayer mp = MediaPlayer.create(context, sonidoRaw); mp.start(); mp.setOnCompletionListener(completionListener); } } super.onReceive(context, intent); } } /** Al borrar el widget, borramos también las preferencias **/ public void onDeleted(Context context, int[] appWidgetIds) { for(int i=0; i<appWidgetIds.length; i++){ //Recogemos las preferencias SharedPreferences.Editor prefs = context.getSharedPreferences(PREFS_NAME, 0).edit(); prefs.remove(PREF_PREFIX_NOM + appWidgetIds[i]); prefs.remove(PREF_PREFIX_RAW + appWidgetIds[i]); prefs.commit(); } super.onDeleted(context, appWidgetIds); } /**Este método se llama cada vez que se refresca un widget. En nuestro caso, al crearse y al reboot del telefono. Al crearse lo único que hace es guardar el id en el arrayList Al reboot, vienen varios ID así que los recorremos y guardamos todos y también recuperamos de las preferencias el nombre y el sonido*/ public void onUpdate(Context context, AppWidgetManager appWidgetManager, int[] appWidgetIds) { for(int i=0; i<appWidgetIds.length; i++){ //Metemos en el array los IDs de los widgets alWidgetsId.add(appWidgetIds[i]); //Recogemos las preferencias SharedPreferences prefs = context.getSharedPreferences(PREFS_NAME, 0); String nomSound = prefs.getString(PREF_PREFIX_NOM + appWidgetIds[i], null); int rawSound = prefs.getInt(PREF_PREFIX_RAW + appWidgetIds[i], 0); //Si están creadas, actualizamos la interfaz if(nomSound != null){ updateWidgetGrafico(context, appWidgetManager, appWidgetIds[i], nomSound, rawSound); } } } MediaPlayer.OnCompletionListener completionListener = new MediaPlayer.OnCompletionListener(){ public void onCompletion(MediaPlayer mp) { if(mp != null){ mp.stop(); mp.release(); mp = null; } } }; } Sorry for the comments in Spanish. I have the possibility to put differents widgets on the desktop, that's why I use the widgetId as the "unique id" for the PendingIntent. Any ideas please? The 70% of the functionality of my app is the widgets, and it isn't working for some users :( Thanks in advance and sorry for my English.

    Read the article

  • Using RJS to replace innerHTML with a real live instance variable.

    - by Steve Cotner
    I can't for the life of me get RJS to replace an element's innerHTML with an instance variable's attribute, i.e. something like @thing.name I'll show all the code (simplified from the actual project, but still complete), and I hope the solution will be forehead-slap obvious to someone... In RoR, I've made a simple page displaying a random Chinese character. This is a Word object with attributes chinese and english. Clicking on a link titled "What is this?" reveals the english attribute using RJS. Currently, it also hides the "What is this?" link and reveals a "Try Another?" link that just reloads the page, effectively starting over with a new random character. This is fine, but there are other elements on the page that make their own database queries, so I would like to load a new random character by an AJAX call, leaving the rest of the page alone. This has turned out to be harder than I expected: I have no trouble replacing the html using link_remote_to and page.replace_html, but I can't get it to display anything that includes an instance variable. I have a Word resource and a Page resource, which has a home page, where all this fun takes place. In the PagesController, I've made a couple ways to get random words. Either one works fine... Here's the code: class PagesController < ApplicationController def home all_words = Word.find(:all) @random_word = all_words.rand @random_words = Word.find(:all, :limit => 100, :order => 'rand()') @random_first = @random_words[1] end end As an aside, the SQL call with :limit => 100 is just in case I think of some way to cycle through those random words. Right now it's not useful. Also, the 'rand()' is MySQL specific, as far as I know. In the home page view (it's HAML), I have this: #character_box = render(:partial => "character", :object => @random_word) if @random_word #whatisthis = link_to_remote "? what is this?", :url => { :controller => 'words', :action => 'reveal_character' }, :html => { :title => "Click for the translation." } #tryanother.{:style => "display:none"} = link_to "try another?", root_path Note that the #'s in this case represent divs (with the given ids), not comments, because this is HAML. The "character" partial looks like this (it's erb, for no real reason): <div id="character"> <%= "#{@random_word.chinese}" } %> </div> <div id="revealed" style="display:none"> <ul> <li><span id="english"><%= "#{@random_word.english_name}" %></span></li> </ul> </div> The reveal_character.rjs file looks like this: page[:revealed].visual_effect :slide_down, :duration => '.2' page[:english].visual_effect :highlight, :startcolor => "#ffff00", :endcolor => "#ffffff", :duration => '2.5' page.delay(0.8) do page[:whatisthis].visual_effect :fade, :duration => '.3' page[:tryanother].visual_effect :appear end That all works perfectly fine. But if I try to turn link_to "try another?" into link_to_remote, and point it to an RJS template that replaces the "character" element with something new, it only works when I replace the innerHTML with static text. If I try to pass an instance variable in there, it never works. For instance, let's say I've defined a second random word under Pages#home... I'll add @random_second = @random_words[2] there. Then, in the home page view, I'll replace the "try another?" link (previously pointing to the root_path), with this: = link_to_remote "try another?", :url => { :controller => 'words', :action => 'second_character' }, :html => { :title => "Click for a new character." } I'll make that new RJS template, at app/views/words/second_character.rjs, and a simple test like this shows that it's working: page.replace_html("character", "hi") But if I change it to this: page.replace_html("character", "#{@random_second.english}") I get an error saying I fed it a nil object: ActionView::TemplateError (undefined method `english_name' for nil:NilClass) on line #1 of app/views/words/second_character.rjs: 1: page.replace_html("character", "#{@random_second.english}") Of course, actually instantiating @random_second, @random_third and so on ad infinitum would be ridiculous in a real app (I would eventually figure out some better way to keep grabbing a new random record without reloading the page), but the point is that I don't know how to get any instance variable to work here. This is not even approaching my ideal solution of rendering a partial that includes the object I specify, like this: page.replace_html 'character', :partial => 'new_character', :object => @random_second As I can't get an instance variable to work directly, I obviously cannot get it to work via a partial. I have tried various things like: :object => @random_second or :locals => { :random_second => @random_second } I've tried adding these all over the place -- in the link_to_remote options most obviously -- and studying what gets passed in the parameters, but to no avail. It's at this point that I realize I don't know what I'm doing. This is my first question here. I erred on the side of providing all necessary code, rather than being brief. Any help would be greatly appreciated.

    Read the article

  • Of these 3 methods for reading linked lists from shared memory, why is the 3rd fastest?

    - by Joseph Garvin
    I have a 'server' program that updates many linked lists in shared memory in response to external events. I want client programs to notice an update on any of the lists as quickly as possible (lowest latency). The server marks a linked list's node's state_ as FILLED once its data is filled in and its next pointer has been set to a valid location. Until then, its state_ is NOT_FILLED_YET. I am using memory barriers to make sure that clients don't see the state_ as FILLED before the data within is actually ready (and it seems to work, I never see corrupt data). Also, state_ is volatile to be sure the compiler doesn't lift the client's checking of it out of loops. Keeping the server code exactly the same, I've come up with 3 different methods for the client to scan the linked lists for changes. The question is: Why is the 3rd method fastest? Method 1: Round robin over all the linked lists (called 'channels') continuously, looking to see if any nodes have changed to 'FILLED': void method_one() { std::vector<Data*> channel_cursors; for(ChannelList::iterator i = channel_list.begin(); i != channel_list.end(); ++i) { Data* current_item = static_cast<Data*>(i->get(segment)->tail_.get(segment)); channel_cursors.push_back(current_item); } while(true) { for(std::size_t i = 0; i < channel_list.size(); ++i) { Data* current_item = channel_cursors[i]; ACQUIRE_MEMORY_BARRIER; if(current_item->state_ == NOT_FILLED_YET) { continue; } log_latency(current_item->tv_sec_, current_item->tv_usec_); channel_cursors[i] = static_cast<Data*>(current_item->next_.get(segment)); } } } Method 1 gave very low latency when then number of channels was small. But when the number of channels grew (250K+) it became very slow because of looping over all the channels. So I tried... Method 2: Give each linked list an ID. Keep a separate 'update list' to the side. Every time one of the linked lists is updated, push its ID on to the update list. Now we just need to monitor the single update list, and check the IDs we get from it. void method_two() { std::vector<Data*> channel_cursors; for(ChannelList::iterator i = channel_list.begin(); i != channel_list.end(); ++i) { Data* current_item = static_cast<Data*>(i->get(segment)->tail_.get(segment)); channel_cursors.push_back(current_item); } UpdateID* update_cursor = static_cast<UpdateID*>(update_channel.tail_.get(segment)); while(true) { if(update_cursor->state_ == NOT_FILLED_YET) { continue; } ::uint32_t update_id = update_cursor->list_id_; Data* current_item = channel_cursors[update_id]; if(current_item->state_ == NOT_FILLED_YET) { std::cerr << "This should never print." << std::endl; // it doesn't continue; } log_latency(current_item->tv_sec_, current_item->tv_usec_); channel_cursors[update_id] = static_cast<Data*>(current_item->next_.get(segment)); update_cursor = static_cast<UpdateID*>(update_cursor->next_.get(segment)); } } Method 2 gave TERRIBLE latency. Whereas Method 1 might give under 10us latency, Method 2 would inexplicably often given 8ms latency! Using gettimeofday it appears that the change in update_cursor-state_ was very slow to propogate from the server's view to the client's (I'm on a multicore box, so I assume the delay is due to cache). So I tried a hybrid approach... Method 3: Keep the update list. But loop over all the channels continuously, and within each iteration check if the update list has updated. If it has, go with the number pushed onto it. If it hasn't, check the channel we've currently iterated to. void method_three() { std::vector<Data*> channel_cursors; for(ChannelList::iterator i = channel_list.begin(); i != channel_list.end(); ++i) { Data* current_item = static_cast<Data*>(i->get(segment)->tail_.get(segment)); channel_cursors.push_back(current_item); } UpdateID* update_cursor = static_cast<UpdateID*>(update_channel.tail_.get(segment)); while(true) { for(std::size_t i = 0; i < channel_list.size(); ++i) { std::size_t idx = i; ACQUIRE_MEMORY_BARRIER; if(update_cursor->state_ != NOT_FILLED_YET) { //std::cerr << "Found via update" << std::endl; i--; idx = update_cursor->list_id_; update_cursor = static_cast<UpdateID*>(update_cursor->next_.get(segment)); } Data* current_item = channel_cursors[idx]; ACQUIRE_MEMORY_BARRIER; if(current_item->state_ == NOT_FILLED_YET) { continue; } found_an_update = true; log_latency(current_item->tv_sec_, current_item->tv_usec_); channel_cursors[idx] = static_cast<Data*>(current_item->next_.get(segment)); } } } The latency of this method was as good as Method 1, but scaled to large numbers of channels. The problem is, I have no clue why. Just to throw a wrench in things: if I uncomment the 'found via update' part, it prints between EVERY LATENCY LOG MESSAGE. Which means things are only ever found on the update list! So I don't understand how this method can be faster than method 2. The full, compilable code (requires GCC and boost-1.41) that generates random strings as test data is at: http://pastebin.com/e3HuL0nr

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • jQuery returning two elements for each one it finds?

    - by John Rudy
    I'll start by saying I'm fairly new to jQuery. For the most part, I've found it intuitive and powerful, but this one circumstance has me thoroughly stumped. In the following method, the call to .each() returns two elements for every one found. It iterates over a set of table rows given IDs starting with the word, "communication," and followed by an ID number. For each row it returns, it processes twice. Using Firebug, I've validated that the DOM only has a single instance of each table row in question. Also using Firebug, I've validated that the method is not being called twice; the iteration in .each() is truly going over each returned table row twice. By the time all the AJAX call goodness is done, I'll have two entries in the database for each row created in the table. This is the code that's causing the issues: function getCommunications() { var list = $('[id^=communication]'); var communications = new Array(); list.each(function () { var communication = { ID: $(this).find('.commCompanyID').val(), /* * SNIP: more object properties here that are * unnecessary to this discussion */ }; communications.push(communication); }); return communications; } At the point of return communications, the Array returned will contain twice as many elements as there are table rows. I should note that nearly identical code (but going against specific lists of divs) is working on the same page. It's just the table that's suffering the issues. I'm using jQuery 1.4.1, the version which shipped with Visual Studio .NET 2010. The table markup is fully dynamic -- that is, aside from the header row, it's dependent on data either returned at page load or created by the user via a dialog box. I'll drop in just the code for what's created at page load; again using Firebug I've validated that what I create dynamically when an end user creates a row with the dialog box matches. (This should be readable by anyone, but for the record this is an ASP.NET MVC 2.0 project.) <table id="commTable"> <tr> <th></th> <th> Date / Time </th> <th> Contact </th> <th> Type </th> <th> Duration </th> <th> Notes </th> </tr> <% foreach (var item in Model) { %> <tr id="communication<%: item.ID %>"> <td> <a href="#" onclick="showEditCommunicationForm(<%: item.ID %>"> Edit</a> <span class="commDeleteButton"> <a href="#" onclick="deleteCommunication(<%: item.ID %>)"> Delete</a> </span> </td> <td> <span class="commDateTime"><%: item.DateTime %></span> <input type="hidden" class="commID" value="<%: item.ID %>" /> <input type="hidden" class="commIsDeleted" value="<%: item.IsDeleted %>" /> </td> <td> <span class="commSourceText"><%: item.Company.CompanyName %></span> <input type="hidden" class="commCompanyID" value="<%: item.CompanyID %>" /> </td> <td> <%: item.CommunicationType.CommunicationTypeText %> <input type="hidden" class="commTypeID" value="<%: item.CommunicationTypeID %>" /> </td> <td> <span class="commDuration"><%: item.DurationMinutes %></span> Minutes </td> <td> <span class="commNotes"><%: item.Notes %></span> </td> </tr> <% } %> </table>

    Read the article

  • Unknown error in Producer/Consumer program, believe it to be an infinite loop.

    - by ray2k
    Hello, I am writing a program that is solving the producer/consumer problem, specifically the bounded-buffer version(i believe they mean the same thing). The producer will be generating x number of random numbers, where x is a command line parameter to my program. At the current moment, I believe my program is entering an infinite loop, but I'm not sure why it is occurring. I believe I am executing the semaphores correctly. You compile it like this: gcc -o prodcon prodcon.cpp -lpthread -lrt Then to run, ./prodcon 100(the number of randum nums to produce) This is my code. typedef int buffer_item; #include <stdlib.h> #include <stdio.h> #include <pthread.h> #include <semaphore.h> #include <unistd.h> #define BUFF_SIZE 10 #define RAND_DIVISOR 100000000 #define TRUE 1 //two threads void *Producer(void *param); void *Consumer(void *param); int insert_item(buffer_item item); int remove_item(buffer_item *item); int returnRandom(); //the global semaphores sem_t empty, full, mutex; //the buffer buffer_item buf[BUFF_SIZE]; //buffer counter int counter; //number of random numbers to produce int numRand; int main(int argc, char** argv) { /* thread ids and attributes */ pthread_t pid, cid; pthread_attr_t attr; pthread_attr_init(&attr); pthread_attr_setscope(&attr, PTHREAD_SCOPE_SYSTEM); numRand = atoi(argv[1]); sem_init(&empty,0,BUFF_SIZE); sem_init(&full,0,0); sem_init(&mutex,0,0); printf("main started\n"); pthread_create(&pid, &attr, Producer, NULL); pthread_create(&cid, &attr, Consumer, NULL); printf("main gets here"); pthread_join(pid, NULL); pthread_join(cid, NULL); printf("main done\n"); return 0; } //generates a randum number between 1 and 100 int returnRandom() { int num; srand(time(NULL)); num = rand() % 100 + 1; return num; } //begin producing items void *Producer(void *param) { buffer_item item; int i; for(i = 0; i < numRand; i++) { //sleep for a random period of time int rNum = rand() / RAND_DIVISOR; sleep(rNum); //generate a random number item = returnRandom(); //acquire the empty lock sem_wait(&empty); //acquire the mutex lock sem_wait(&mutex); if(insert_item(item)) { fprintf(stderr, " Producer report error condition\n"); } else { printf("producer produced %d\n", item); } /* release the mutex lock */ sem_post(&mutex); /* signal full */ sem_post(&full); } return NULL; } /* Consumer Thread */ void *Consumer(void *param) { buffer_item item; int i; for(i = 0; i < numRand; i++) { /* sleep for a random period of time */ int rNum = rand() / RAND_DIVISOR; sleep(rNum); /* aquire the full lock */ sem_wait(&full); /* aquire the mutex lock */ sem_wait(&mutex); if(remove_item(&item)) { fprintf(stderr, "Consumer report error condition\n"); } else { printf("consumer consumed %d\n", item); } /* release the mutex lock */ sem_post(&mutex); /* signal empty */ sem_post(&empty); } return NULL; } /* Add an item to the buffer */ int insert_item(buffer_item item) { /* When the buffer is not full add the item and increment the counter*/ if(counter < BUFF_SIZE) { buf[counter] = item; counter++; return 0; } else { /* Error the buffer is full */ return -1; } } /* Remove an item from the buffer */ int remove_item(buffer_item *item) { /* When the buffer is not empty remove the item and decrement the counter */ if(counter > 0) { *item = buf[(counter-1)]; counter--; return 0; } else { /* Error buffer empty */ return -1; } }

    Read the article

  • Problem with Mootools Ajax request and submitting a form

    - by Arwed
    Hello. This is my problem: I have a table with content comming from a database. Now i tryed to realize a way to (a) delete rows from the table (b) edit the content of the row "on the fly". (a) is working perfectly (b) makes my head smoking! Here is the complete Mootools Code: <script type="text/javascript"> window.addEvent('domready', function() { $('edit_hide').slide('hide'); var saf = new Request.HTML( { url: 'termin_safe.php', encoding: 'utf-8', onComplete: function(response) { document.location.href=''; } }); var req = new Request.HTML( { url: 'fuss_response.php', encoding: 'utf-8', onComplete: function(response) { document.location.href=''; } }); var eDit = $('edit_hide'); var eD = new Request.HTML( { url: 'fuss_response_edit.php', update: eDit, encoding: 'utf-8', onComplete: function(response) { $('sst').addEvent( 'click', function(e){ e.stop(); saf.send(); }); } }); $$('input.edit').addEvent( 'click', function(e){ e.stop(); var aID = 'edit_', bID = '', cID = 'ed_'; var deleteID = this.getProperty('id').replace(aID,bID); var editID = $(this.getProperty('id').replace(aID,cID)); eD.send({data : "id=" + deleteID}); $('edit_hide').slide('toggle'); }); $$('input.delete').addEvent( 'click', function(e){ e.stop(); var aID = 'delete_', bID = ''; var deleteID = this.getProperty('id').replace(aID,bID); new MooDialog.Confirm('Soll der Termin gelöscht werden?', function(){ req.send({data : "id=" + deleteID}); }, function(){ new MooDialog.Alert('Schon Konfuzius hat gesagt: Erst denken dann handeln!'); }); }); }); </script> Here the PHP Part that makes the Edit Form: <?php $cKey = mysql_real_escape_string($_POST['id']); $request = mysql_query("SELECT * FROM fusspflege WHERE ID = '".$cKey."'"); while ($row = mysql_fetch_object($request)) { $id = $row->ID; $name = $row->name; $vor = $row->vorname; $ort = $row->ort; $tel = $row->telefon; $mail = $row->email; } echo '<form id="termin_edit" method="post" action="">'; echo '<div><label>Name:</label><input type="text" id="nns" name="name" value="'.$name.'"></div>'; echo '<div><label>Vorname:</label><input type="text" id="nvs" name="vorname" value="'.$vor.'"></div>'; echo '<div><label>Ort:</label><input type="text" id="nos" name="ort" value="'.$ort.'"></div>'; echo '<div><label>Telefon:</label><input type="text" id="nts" name="telefon" value="'.$tel.'"></div>'; echo '<div><label>eMail:</label><input type="text" id="nms" name="email" value="'.$mail.'"></div>'; echo '<input name="id" type="hidden" id="ids" value="'.$id.'"/>'; echo '<input type="button" id="sst" value="Speichern">'; echo '</form>'; ?> And last the Code of the termin_safe.php $id = mysql_real_escape_string($_POST['id']); $na = mysql_real_escape_string($_POST['name']); $vn = mysql_real_escape_string($_POST['vorname']); $ort = mysql_real_escape_string($_POST['ort']); $tel = mysql_real_escape_string($_POST['telefon']); $em = mysql_real_escape_string($_POST['email']); $score = mysql_query("UPDATE fuspflege SET name = '".$na."', vorname = '".$vn."', ort = '".$ort."', telefon = '".$tel."', email = '".$em."' WHERE ID = '".$id."'"); As far as i can see the request does work but the data is not updated! i guess somethings wrong with the things posted For any suggestions i will be gladly happy!

    Read the article

  • New hire expectations... (Am I being unreasonable?)

    - by user295841
    I work for a very small custom software shop. We currently consist me and my boss. My boss is an old FoxPro DOS developer and OOP makes him uncomfortable. He is planning on taking a back seat in the next few years to hopefully enjoy a “partial retirement”. I will be taking over the day to day operations and we are now desperately looking for more help. We tried Monster.com, Dice.com, and others a few years ago when we started our search. We had no success. We have tried outsourcing overseas (total disaster), hiring kids right out of college (mostly a disaster but that’s where I came from), interns (good for them, not so good for us) and hiring laid off “experienced” developers (there was a reason they were laid off). I have heard hiring practices discussed on podcasts, blogs, etc... and have tried a few. The “Fizz Buzz” test was a good one. One kid looked physically ill before he finally gave up. I think my problem is that I have grown so much as a developer since I started here that I now have a high standard. I hear/read very intelligent people podcasts and blogs and I know that there are lots of people out there that can do the job. I don’t want to settle for less than a “good” developer. Perhaps my expectations are unreasonable. I expect any good developer (entry level or experienced) to be billable (at least paying their own wage) in under one month. I expect any good developer to be able to be productive (at least dangerous) in any language or technology with only a few days of research/training. I expect any good developer to be able to take a project from initial customer request to completion with little or no help from others. Am I being unreasonable? What constitutes a valuable developer? What should be expected of an entry level developer? What should be expected of an experienced developer? I realize that everyone is different but there has to be some sort of expectations standard, right? I have been giving the test project below to potential canidates to weed them out. Good idea? Too much? Too little? Please let me know what you think. Thanks. Project ID: T00001 Description: Order Entry System Deadline: 1 Week Scope The scope of this project is to develop a fully function order entry system. Screen/Form design must be user friendly and promote efficient data entry and modification. User experience (Navigation, Screen/Form layouts, Look and Feel…) is at the developer’s discretion. System may be developed using any technologies that conform to the technical and system requirements. Deliverables Complete source code Database setup instructions (Scripts or restorable backup) Application installation instructions (Installer or installation procedure) Any necessary documentation Technical Requirements Server Platform – Windows XP / Windows Server 2003 / SBS Client Platform – Windows XP Web Browser (If applicable) – IE 8 Database – At developer’s discretion (Must be a relational SQL database.) Language – At developer’s discretion All data must be normalized. (+) All data must maintain referential integrity. (++) All data must be indexed for optimal performance. System must handle concurrency. System Requirements Customer Maintenance Customer records must have unique ID. Customer data will include Name, Address, Phone, etc. User must be able to perform all CRUD (Create, Read, Update, and Delete) operations on the Customer table. User must be able to enter a specific Customer ID to edit. User must be able to pull up a sortable/queryable search grid/utility to find a customer to edit. Validation must be performed prior to database commit. Customer record cannot be deleted if the customer has an order in the system. (++) Inventory Maintenance Part records must have unique ID. Part data will include Description, Price, UOM (Unit of Measure), etc. User must be able to perform all CRUD operations on the part table. User must be able to enter a specific Part ID to edit. User must be able to pull up a sortable/queryable search grid/utility to find a part to edit. Validation must be performed prior to database commit. Part record cannot be deleted if the part has been used in an order. (++) Order Entry Order records must have a unique auto-incrementing key (Order Number). Order data must be split into a header/detail structure. (+) Order can contain an infinite number of detail records. Order header data will include Order Number, Customer ID (++), Order Date, Order Status (Open/Closed), etc. Order detail data will include Part Number (++), Quantity, Price, etc. User must be able to perform all CRUD operations on the order tables. User must be able to enter a specific Order Number to edit. User must be able to pull up a sortable/queryable search grid/utility to find an order to edit. User must be able to print an order form from within the order entry form. Validation must be performed prior to database commit. Reports Customer Listing – All Customers in the system. Inventory Listing – All parts in the system. Open Order Listing – All open orders in system. Customer Order Listing – All orders for specific customer. All reports must include sorts and filter functions where applicable. Ex. Customer Listing by range of Customer IDs. Open Order Listing by date range.

    Read the article

  • Saving a Join Model

    - by Thorpe Obazee
    I've been reading the cookbook for a while now and still don't get how I'm supposed to do this: My original problem was this: A related Model isn't being validated From RabidFire's commment: If you want to count the number of Category models that a new Post is associated with (on save), then you need to do this in the beforeSave function as I've mentioned. As you've currently set up your models, you don't need to use the multiple rule anywhere. If you really, really want to validate against a list of Category IDs for some reason, then create a join model, and validate category_id with the multiple rule there. Now, I have these models and are now validating. The problem now is that data isn't being saved in the Join Table: class Post extends AppModel { var $name = 'Post'; var $hasMany = array( 'CategoryPost' => array( 'className' => 'CategoryPost' ) ); var $belongsTo = array( 'Page' => array( 'className' => 'Page' ) ); class Category extends AppModel { var $name = 'Category'; var $hasMany = array( 'CategoryPost' => array( 'className' => 'CategoryPost' ) ); class CategoryPost extends AppModel { var $name = 'CategoryPost'; var $validate = array( 'category_id' => array( 'rule' => array('multiple', array('in' => array(1, 2, 3, 4))), 'required' => FALSE, 'message' => 'Please select one, two or three options' ) ); var $belongsTo = array( 'Post' => array( 'className' => 'Post' ), 'Category' => array( 'className' => 'Category' ) ); This is the new Form: <div id="content-wrap"> <div id="main"> <h2>Add Post</h2> <?php echo $this->Session->flash();?> <div> <?php echo $this->Form->create('Post'); echo $this->Form->input('Post.title'); echo $this->Form->input('CategoryPost.category_id', array('multiple' => 'checkbox')); echo $this->Form->input('Post.body', array('rows' => '3')); echo $this->Form->input('Page.meta_keywords'); echo $this->Form->input('Page.meta_description'); echo $this->Form->end('Save Post'); ?> </div> <!-- main ends --> </div> The data I am producing from the form is as follows: Array ( [Post] => Array ( [title] => 1234 [body] => 1234 ) [CategoryPost] => Array ( [category_id] => Array ( [0] => 1 [1] => 2 ) ) [Page] => Array ( [meta_keywords] => 1234 [meta_description] => 1234 [title] => 1234 [layout] => index ) ) UPDATE: controller action //Controller action function admin_add() { // pr(Debugger::trace()); $this->set('categories', $this->Post->CategoryPost->Category->find('list')); if ( ! empty($this->data)) { $this->data['Page']['title'] = $this->data['Post']['title']; $this->data['Page']['layout'] = 'index'; debug($this->data); if ($this->Post->saveAll($this->data)) { $this->Session->setFlash('Your post has been saved', 'flash_good'); $this->redirect($this->here); } } } UPDATE #2: Should I just do this manually? The problem is that the join tables doesn't have things saved in it. Is there something I'm missing? UPDATE #3 RabidFire gave me a solution. I already did this before and am quite surprised as so why it didn't work. Thus, me asking here. The reason I think there is something wrong. I don't know where: Post beforeSave: function beforeSave() { if (empty($this->id)) { $this->data[$this->name]['uri'] = $this->getUniqueUrl($this->data[$this->name]['title']); } if (isset($this->data['CategoryPost']['category_id']) && is_array($this->data['CategoryPost']['category_id'])) { echo 'test'; $categoryPosts = array(); foreach ($this->data['CategoryPost']['category_id'] as $categoryId) { $categoryPost = array( 'category_id' => $categoryId ); array_push($categoryPosts, $categoryPost); } $this->data['CategoryPost'] = $categoryPosts; } debug($this->data); // Gives RabidFire's correct array for saving. return true; } My Post action: function admin_add() { // pr(Debugger::trace()); $this->set('categories', $this->Post->CategoryPost->Category->find('list')); if ( ! empty($this->data)) { $this->data['Page']['title'] = $this->data['Post']['title']; $this->data['Page']['layout'] = 'index'; debug($this->data); // First debug is giving the correct array as above. if ($this->Post->saveAll($this->data)) { debug($this->data); // STILL gives the above array. which shouldn't be because of the beforeSave in the Post Model // $this->Session->setFlash('Your post has been saved', 'flash_good'); // $this->redirect($this->here); } } }

    Read the article

  • Checkbox to Show and Hide only for the near DIV

    - by Holp
    Select all options... Then, when the user uncheck "B" and check it again, the "D" parents must be hidden. I have to do it without give then IDs. <html> <head> <title>Form</title> <style> * { font-family: Segoe UI, Verdana; font-size: 10pt; } #total { padding: 10px; position: fixed; top: 10px; left: 500px; width: 150px; height: 100px; } p { margin: 5px; } .grupo { padding: 5px 0 5px 0; } </style> <script src="jquery-1.4.2.min.js" type="text/javascript"></script> </head> <body> <div class="grupo"> <p class="pergunta">A) Lorem ipsum dolor sit amet, nulla nec tortor?</p> <p><label><input type="radio" name="P-1" value="R-1-1" />Sim</label></p> <p><label><input type="radio" name="P-1" value="R-1-2" />Não</label></p> </div> <div class="grupo"> <p class="pergunta"><label><input type="checkbox" name="P-2" value="R-2-3" />B) Donec libero risus, commodo vitae</label></p> <div class="dependente"> <div class="grupo"> <p class="pergunta">C) Lorem ipsum dolor sit amet, nulla nec tortor?</p> <p><label><input type="radio" name="P-3" value="R-3-1" />Morbi in orci</label></p> <p><label><input type="radio" name="P-3" value="R-3-2" />Nulla purus lacus, pulvinar vel</label></p> <p><label><input type="radio" name="P-3" value="R-3-3" />Aliquam ante</label></p> <p><label><input type="radio" name="P-3" value="R-3-4" />Suspendisse scelerisque dui nec velit</label></p> </div> <div class="grupo"> <p class="pergunta"><label><input type="checkbox" name="P-4" value="R-4-5" />D) Donec libero risus, commodo vitae</label></p> <div class="dependente"> <div class="grupo"> <p class="pergunta">E) Lorem ipsum dolor sit amet, nulla nec tortor?</p> <p><label><input type="radio" name="P-5" value="R-5-1" />Morbi in orci</label></p> <p><label><input type="radio" name="P-5" value="R-5-2" />Nulla purus lacus</label></p> </div> </div> </div> </div> </div> <div class="grupo"> <p class="pergunta">F) Lorem ipsum dolor sit amet, nulla nec tortor?</p> <p><label><input type="radio" name="P-6" value="R-6-1" />Morbi in orci</label></p> <p><label><input type="radio" name="P-6" value="R-6-2" />Nulla purus lacus, pulvinar vel</label></p> <p><label><input type="radio" name="P-6" value="R-6-3" />Aliquam ante</label></p> <p><label><input type="radio" name="P-6" value="R-6-4" />Suspendisse scelerisque dui nec velit</label></p> </div> <script type="text/javascript"> $('.dependente').hide(); $(':checkbox').click(function () { var checked = this.checked; $('.dependente:first',$(this).parents('div:first')).css('display',checked ? 'block':'none'); $('.dependente input',$(this).parents('div:first')).attr('checked', false).change(); }); </script> </body> </html>

    Read the article

  • Javascript: Make a static code, dynamic - List of inputs

    - by BoDiE2003
    I have this code, that checks some ids and enable others, the javascript is pretty clear about what it does, but since it corresponds to some specific id ranges, I cant do just a look until it finishes, but I'm looking a way to do this dynamic and save 40 lines of code (or more), since its not the best way. function loopGroup1() { var a = 0; do { $$('.selectedAuthorities-3_' + a).each(function(chk1) { // watch for clicks chk1.observe('click', function(evt) { dynamicCheckbox1(); }); dynamicCheckbox1(); }); a++; } while (a < 4); } function dynamicCheckbox1() { // count how many of group_first are checked, // doEnable true if any are checked var doEnable = ($$('.selectedAuthorities-3_0:checked').length > 0) ? true : false; var doEnable1 = ($$('.selectedAuthorities-3_1:checked').length > 0) ? true : false; var doEnable2 = ($$('.selectedAuthorities-3_2:checked').length > 0) ? true : false; // for each in group_second, enable the checkbox, and // remove the cssDisabled class from the parent label var i = 0; do { $$('.selectedAuthorities-4_' + i).each(function(item) { if (doEnable || doEnable1 || doEnable2) { item.enable().up('li').removeClassName('cssDisabled'); } else { item.disable().up('li').addClassName('cssDisabled'); } }); i++; } while (i < 4); }; /* * * Loop Group 2 * * */ function loopGroup2() { var a = 0; do { $$('.selectedAuthorities-5_' + a).each(function(chk1) { // watch for clicks chk1.observe('click', function(evt) { dynamicCheckbox2(); }); dynamicCheckbox2(); }); a++; } while (a < 4); } function dynamicCheckbox2() { // count how many of group_first are checked, // doEnable true if any are checked var doEnable3 = ($$('.selectedAuthorities-5_0:checked').length > 0) ? true : false; // for each in group_second, enable the checkbox, and // remove the cssDisabled class from the parent label var i = 0; do { $$('.selectedAuthorities-6_' + i).each(function(item) { if (doEnable3) { item.enable().up('li').removeClassName('cssDisabled'); } else { item.disable().up('li').addClassName('cssDisabled'); } }); i++; } while (i < 4); }; /* * * Loop Group 3 * * */ function loopGroup3() { var a = 0; do { $$('.selectedAuthorities-6_' + a).each(function(chk1) { // watch for clicks chk1.observe('click', function(evt) { dynamicCheckbox3(); }); dynamicCheckbox3(); }); a++; } while (a < 4); } function dynamicCheckbox3() { // count how many of group_first are checked, // doEnable true if any are checked var doEnable4 = ($$('.selectedAuthorities-6_0:checked').length > 0) ? true : false; var doEnable5 = ($$('.selectedAuthorities-6_1:checked').length > 0) ? true : false; // for each in group_second, enable the checkbox, and // remove the cssDisabled class from the parent label var i = 0; do { $$('.selectedAuthorities-7_' + i).each(function(item) { if (doEnable4 || doEnable5) { item.enable().up('li').removeClassName('cssDisabled'); } else { item.disable().up('li').addClassName('cssDisabled'); } }); i++; } while (i < 4); }; /* * * Loop Group 4 * * */ function loopGroup4() { var a = 0; do { $$('.selectedAuthorities-9_' + a).each(function(chk1) { // watch for clicks chk1.observe('click', function(evt) { dynamicCheckbox4(); }); dynamicCheckbox4(); }); a++; } while (a < 4); } function dynamicCheckbox4() { // count how many of group_first are checked, // doEnable true if any are checked var doEnable6 = ($$('.selectedAuthorities-9_0:checked').length > 0) ? true : false; var doEnable7 = ($$('.selectedAuthorities-9_1:checked').length > 0) ? true : false; // for each in group_second, enable the checkbox, and // remove the cssDisabled class from the parent label var i = 0; do { $$('.selectedAuthorities-10_' + i).each(function(item) { if (doEnable6 || doEnable7) { item.enable().up('li').removeClassName('cssDisabled'); } else { item.disable().up('li').addClassName('cssDisabled'); } }); i++; } while (i < 4); };

    Read the article

  • With XSLT, how can I use this if-test with an array, when search element is returned by a template call inside the for loop?

    - by codesforcoffee
    I think this simple example might ask the question a lot more clearly. I have an input file with multiple products. There are 10 types of product (2 product IDs is fine enough for this example), but the input will have 200 products, and I only want to output the info for the first product of each type. (Output info for the lowest priced one, so the first one will be the lowest price because I sort by Price first.) So I want to read in each product, but only output the product's info if I haven't already output a product with that same ID. I couldn't figure out how to get the processID template to return a value that I need to do my if-check on, that uses parameters from inside the for-each Product loop -then properly close the if tag in the right place so it won't output the open Product tag unless it passes the if test. I know the following code does not work, but it illustrates the idea and gives me a place to start: <?xml version="1.0" encoding="utf-8"?> <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/XSL/Transform"> <xsl:output method="xml" encoding="UTF-8" indent="yes" cdata-section-elements="prod_name adv_notes"/> <xsl:template match="/"> <List> <xsl:for-each select="ProductGroup"> <xsl:sort select="ActiveProducts/Product/Rate"/> <xsl:variable name="IDarray"> <xsl:for-each select="ActiveProducts/Product"> <xsl:variable name="CurrentID"> <xsl:call-template name="processID"> <xsl:with-param name="ProductCode" select="ProductCode" /> </xsl:call-template> </xsl:variable> <xsl:if test="not(contains($IDarray, $CurrentID))"> <child elem="{@elem}"> <xsl:select value-of="$CurrentID" /> </child> <Product> <xsl:attribute name="ID"> <xsl:select value-of="$CurrentID" /> </xsl:attribute> <prod_name> <xsl:value-of select="../ProductName"/> </prod_name> <rate> <xsl:value-of select="../Rate"/> </rate> </Product> </xsl:if> </xsl:for-each> </xsl:variable> </xsl:for-each> </List> </xsl:template> <xsl:template name="processID"> <xsl:param name="ProductCode"/> <xsl:choose> <xsl:when test="starts-with($ProductCode, '515')">5</xsl:when> <xsl:when test="starts-with($ProductCode, '205')">2</xsl:when> </xsl:choose> </xsl:template> Thanks so much in advance, I know some of the awesome programmers here can help! :) -Holly An input would look like this: <ProductGroup> <ActiveProducts> <Product> <ProductCode> 5155 </ProductCode> <ProductName> House </ProductName> <Rate> 3.99 </Rate> </Product> <Product> <ProductCode> 5158 </ProductCode> <ProductName> House </ProductName> <Rate> 4.99 </Rate> </Product> </ActiveProducts> </ProductGroup> <ProductGroup> <ActiveProducts> <Product> <ProductCode> 2058 </ProductCode> <ProductName> House </ProductName> <Rate> 2.99 </Rate> </Product> <Product> <ProductCode> 2055 </ProductCode> <ProductName> House </ProductName> <Rate> 7.99 </Rate> </Product> </ActiveProducts> </ProductGroup> 200 of those with different attributes. I have the translation working, just needed to add that array and if statement somehow. Output would be this for only that simple input file:

    Read the article

  • Is multithreading the right way to go for my case?

    - by Julien Lebosquain
    Hello, I'm currently designing a multi-client / server application. I'm using plain good old sockets because WCF or similar technology is not what I need. Let me explain: it isn't the classical case of a client simply calling a service; all clients can 'interact' with each other by sending a packet to the server, which will then do some action, and possible re-dispatch an answer message to one or more clients. Although doable with WCF, the application will get pretty complex with hundreds of different messages. For each connected client, I'm of course using asynchronous methods to send and receive bytes. I've got the messages fully working, everything's fine. Except that for each line of code I'm writing, my head just burns because of multithreading issues. Since there could be around 200 clients connected at the same time, I chose to go the fully multithreaded way: each received message on a socket is immediately processed on the thread pool thread it was received, not on a single consumer thread. Since each client can interact with other clients, and indirectly with shared objects on the server, I must protect almost every object that is mutable. I first went with a ReaderWriterLockSlim for each resource that must be protected, but quickly noticed that there are more writes overall than reads in the server application, and switched to the well-known Monitor to simplify the code. So far, so good. Each resource is protected, I have helper classes that I must use to get a lock and its protected resource, so I can't use an object without getting a lock. Moreover, each client has its own lock that is entered as soon as a packet is received from its socket. It's done to prevent other clients from making changes to the state of this client while it has some messages being processed, which is something that will happen frequently. Now, I don't just need to protect resources from concurrent accesses. I must keep every client in sync with the server for some collections I have. One tricky part that I'm currently struggling with is the following: I have a collection of clients. Each client has its own unique ID. When a client connects, it must receive the IDs of every connected client, and each one of them must be notified of the newcomer's ID. When a client disconnects, every other client must know it so that its ID is no longer valid for them. Every client must always have, at a given time, the same clients collection as the server so that I can assume that everybody knows everybody. This way if I'm sending a message to client #1 telling "Client #2 has done something", I know that it will always be correctly interpreted: Client 1 will never wonder "but who is Client 2 anyway?". My first attempt for handling the connection of a new client (let's call it X) was this pseudo-code (remember that newClient is already locked here): lock (clients) { foreach (var client in clients) { lock (client) { client.Send("newClient with id X has connected"); } } clients.Add(newClient); newClient.Send("the list of other clients"); } Now imagine that in the same time, another client has sent a packet that translates into a message that must be broadcasted to every connected client, the pseudo-code will be something like this (remember that the current client - let's call it Y - is already locked here): lock (clients) { foreach (var client in clients) { lock (client) { client.Send("something"); } } } An obvious deadlock occurs here: on one thread X is locked, the clients lock has been entered, started looping through the clients, and at one moment must get Y's lock... which is already acquired on the second thread, itself waiting for the clients collection lock to be released! This is not the only case like this in the server application. There are other collections which must be kept in sync with the clients, some properties on a client can be changed by another one, etc. I tried other types of locks, lock-free mechanisms and a bunch of other things. Either there were obvious deadlocks when I'm using too much locks for safety, or obvious race conditions otherwise. When I finally find a good middle point between the two, it usually comes with very subtle race conditions / dead locks and other multi-threading issues... my head hurts very quickly since for any single line of code I'm writing I have to review almost the whole application to ensure everything will behave correctly with any number of threads. So here's my final question: how would you resolve this specific case, the general case, and more importantly: aren't I going the wrong way here? I have little problems with the .NET framework, C#, simple concurrency or algorithms in general. Still, I'm lost here. I know I could use only one thread processing the incoming requests and everything will be fine. However, that won't scale well at all with more clients... But I'm thinking more and more to go this simple way. What do you think? Thanks in advance to you, StackOverflow people which have taken the time to read this huge question. I really had to explain the whole context if I want to get some help.

    Read the article

  • OpenGL texture shifted somewhat to the left when applied to a quad

    - by user308226
    I'm a bit new to OpenGL and I've been having a problem with using textures. The texture seems to load fine, but when I run the program, the texture displays shifted a couple pixels to the left, with the section cut off by the shift appearing on the right side. I don't know if the problem here is in the my TGA loader or if it's the way I'm applying the texture to the quad. Here is the loader: #include "texture.h" #include <iostream> GLubyte uncompressedheader[12] = {0,0, 2,0,0,0,0,0,0,0,0,0}; GLubyte compressedheader[12] = {0,0,10,0,0,0,0,0,0,0,0,0}; TGA::TGA() { } //Private loading function called by LoadTGA. Loads uncompressed TGA files //Returns: TRUE on success, FALSE on failure bool TGA::LoadCompressedTGA(char *filename,ifstream &texturestream) { return false; } bool TGA::LoadUncompressedTGA(char *filename,ifstream &texturestream) { cout << "G position status:" << texturestream.tellg() << endl; texturestream.read((char*)header, sizeof(header)); //read 6 bytes into the file to get the tga header width = (GLuint)header[1] * 256 + (GLuint)header[0]; //read and calculate width and save height = (GLuint)header[3] * 256 + (GLuint)header[2]; //read and calculate height and save bpp = (GLuint)header[4]; //read bpp and save cout << bpp << endl; if((width <= 0) || (height <= 0) || ((bpp != 24) && (bpp !=32))) //check to make sure the height, width, and bpp are valid { return false; } if(bpp == 24) { type = GL_RGB; } else { type = GL_RGBA; } imagesize = ((bpp/8) * width * height); //determine size in bytes of the image cout << imagesize << endl; imagedata = new GLubyte[imagesize]; //allocate memory for our imagedata variable texturestream.read((char*)imagedata,imagesize); //read according the the size of the image and save into imagedata for(GLuint cswap = 0; cswap < (GLuint)imagesize; cswap += (bpp/8)) //loop through and reverse the tga's BGR format to RGB { imagedata[cswap] ^= imagedata[cswap+2] ^= //1st Byte XOR 3rd Byte XOR 1st Byte XOR 3rd Byte imagedata[cswap] ^= imagedata[cswap+2]; } texturestream.close(); //close ifstream because we're done with it cout << "image loaded" << endl; glGenTextures(1, &texID); // Generate OpenGL texture IDs glBindTexture(GL_TEXTURE_2D, texID); // Bind Our Texture glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_MIN_FILTER, GL_LINEAR); // Linear Filtered glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_MAG_FILTER, GL_LINEAR); glTexImage2D(GL_TEXTURE_2D, 0, type, width, height, 0, type, GL_UNSIGNED_BYTE, imagedata); delete imagedata; return true; } //Public loading function for TGA images. Opens TGA file and determines //its type, if any, then loads it and calls the appropriate function. //Returns: TRUE on success, FALSE on failure bool TGA::loadTGA(char *filename) { cout << width << endl; ifstream texturestream; texturestream.open(filename,ios::binary); texturestream.read((char*)header,sizeof(header)); //read 6 bytes into the file, its the header. //if it matches the uncompressed header's first 6 bytes, load it as uncompressed LoadUncompressedTGA(filename,texturestream); return true; } GLubyte* TGA::getImageData() { return imagedata; } GLuint& TGA::getTexID() { return texID; } And here's the quad: void Square::show() { glEnable(GL_TEXTURE_2D); glBindTexture(GL_TEXTURE_2D, texture.texID); //Move to offset glTranslatef( x, y, 0 ); //Start quad glBegin( GL_QUADS ); //Set color to white glColor4f( 1.0, 1.0, 1.0, 1.0 ); //Draw square glTexCoord2f(0.0f, 0.0f); glVertex3f( 0, 0, 0 ); glTexCoord2f(1.0f, 0.0f); glVertex3f( SQUARE_WIDTH, 0, 0 ); glTexCoord2f(1.0f, 1.0f); glVertex3f( SQUARE_WIDTH, SQUARE_HEIGHT, 0 ); glTexCoord2f(0.0f, 1.0f); glVertex3f( 0, SQUARE_HEIGHT, 0 ); //End quad glEnd(); //Reset glLoadIdentity(); }

    Read the article

  • How to model a relationship that NHibernate (or Hibernate) doesn’t easily support

    - by MylesRip
    I have a situation in which the ideal relationship, I believe, would involve Value Object Inheritance. This is unfortunately not supported in NHibernate so any solution I come up with will be less than perfect. Let’s say that: “Item” entities have a “Location” that can be in one of multiple different formats. These formats are completely different with no overlapping fields. We will deal with each Location in the format that is provided in the data with no attempt to convert from one format to another. Each Item has exactly one Location. “SpecialItem” is a subtype of Item, however, that is unique in that it has exactly two Locations. “Group” entities aggregate Items. “LocationGroup” is as subtype of Group. LocationGroup also has a single Location that can be in any of the formats as described above. Although I’m interested in Items by Group, I’m also interested in being able to find all items with the same Location, regardless of which group they are in. I apologize for the number of stipulations listed above, but I’m afraid that simplifying it any further wouldn’t really reflect the difficulties of the situation. Here is how the above could be diagrammed: Mapping Dilemma Diagram: (http://www.freeimagehosting.net/uploads/592ad48b1a.jpg) (I tried placing the diagram inline, but Stack Overflow won't allow that until I have accumulated more points. I understand the reasoning behind it, but it is a bit inconvenient for now.) Hmmm... Apparently I can't have multiple links either. :-( Analyzing the above, I make the following observations: I treat Locations polymorphically, referring to the supertype rather than the subtype. Logically, Locations should be “Value Objects” rather than entities since it is meaningless to differentiate between two Location objects that have all the same values. Thus equality between Locations should be based on field comparisons, not identifiers. Also, value objects should be immutable and shared references should not be allowed. Using NHibernate (or Hibernate) one would typically map value objects using the “component” keyword which would cause the fields of the class to be mapped directly into the database table that represents the containing class. Put another way, there would not be a separate “Locations” table in the database (and Locations would therefore have no identifiers). NHibernate (or Hibernate) do not currently support inheritance for value objects. My choices as I see them are: Ignore the fact that Locations should be value objects and map them as entities. This would take care of the inheritance mapping issues since NHibernate supports entity inheritance. The downside is that I then have to deal with aliasing issues. (Meaning that if multiple objects share a reference to the same Location, then changing values for one object’s Location would cause the location to change for other objects that share the reference the same Location record.) I want to avoid this if possible. Another downside is that entities are typically compared by their IDs. This would mean that two Location objects would be considered not equal even if the values of all their fields are the same. This would be invalid and unacceptable from the business perspective. Flatten Locations into a single class so that there are no longer inheritance relationships for Locations. This would allow Locations to be treated as value objects which could easily be handled by using “component” mapping in NHibernate. The downside in this case would be that the domain model becomes weaker, more fragile and less maintainable. Do some “creative” mapping in the hbm files in order to force Location fields to be mapped into the containing entities’ tables without using the “component” keyword. This approach is described by Colin Jack here. My situation is more complicated than the one he describes due to the fact that SpecialItem has a second Location and the fact that a different entity, LocatedGroup, also has Locations. I could probably get it to work, but the mappings would be non-intuitive and therefore hard to understand and maintain by other developers in the future. Also, I suspect that these tricky mappings would likely not be possible using Fluent NHibernate so I would use the advantages of using that tool, at least in that situation. Surely others out there have run into similar situations. I’m hoping someone who has “been there, done that” can share some wisdom. :-) So here’s the question… Which approach should be preferred in this situation? Why?

    Read the article

  • Creating Custom Ajax Control Toolkit Controls

    - by Stephen Walther
    The goal of this blog entry is to explain how you can extend the Ajax Control Toolkit with custom Ajax Control Toolkit controls. I describe how you can create the two halves of an Ajax Control Toolkit control: the server-side control extender and the client-side control behavior. Finally, I explain how you can use the new Ajax Control Toolkit control in a Web Forms page. At the end of this blog entry, there is a link to download a Visual Studio 2010 solution which contains the code for two Ajax Control Toolkit controls: SampleExtender and PopupHelpExtender. The SampleExtender contains the minimum skeleton for creating a new Ajax Control Toolkit control. You can use the SampleExtender as a starting point for your custom Ajax Control Toolkit controls. The PopupHelpExtender control is a super simple custom Ajax Control Toolkit control. This control extender displays a help message when you start typing into a TextBox control. The animated GIF below demonstrates what happens when you click into a TextBox which has been extended with the PopupHelp extender. Here’s a sample of a Web Forms page which uses the control: <%@ Page Language="C#" AutoEventWireup="true" CodeBehind="ShowPopupHelp.aspx.cs" Inherits="MyACTControls.Web.Default" %> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html > <head runat="server"> <title>Show Popup Help</title> </head> <body> <form id="form1" runat="server"> <div> <act:ToolkitScriptManager ID="tsm" runat="server" /> <%-- Social Security Number --%> <asp:Label ID="lblSSN" Text="SSN:" AssociatedControlID="txtSSN" runat="server" /> <asp:TextBox ID="txtSSN" runat="server" /> <act:PopupHelpExtender id="ph1" TargetControlID="txtSSN" HelpText="Please enter your social security number." runat="server" /> <%-- Social Security Number --%> <asp:Label ID="lblPhone" Text="Phone Number:" AssociatedControlID="txtPhone" runat="server" /> <asp:TextBox ID="txtPhone" runat="server" /> <act:PopupHelpExtender id="ph2" TargetControlID="txtPhone" HelpText="Please enter your phone number." runat="server" /> </div> </form> </body> </html> In the page above, the PopupHelp extender is used to extend the functionality of the two TextBox controls. When focus is given to a TextBox control, the popup help message is displayed. An Ajax Control Toolkit control extender consists of two parts: a server-side control extender and a client-side behavior. For example, the PopupHelp extender consists of a server-side PopupHelpExtender control (PopupHelpExtender.cs) and a client-side PopupHelp behavior JavaScript script (PopupHelpBehavior.js). Over the course of this blog entry, I describe how you can create both the server-side extender and the client-side behavior. Writing the Server-Side Code Creating a Control Extender You create a control extender by creating a class that inherits from the abstract ExtenderControlBase class. For example, the PopupHelpExtender control is declared like this: public class PopupHelpExtender: ExtenderControlBase { } The ExtenderControlBase class is part of the Ajax Control Toolkit. This base class contains all of the common server properties and methods of every Ajax Control Toolkit extender control. The ExtenderControlBase class inherits from the ExtenderControl class. The ExtenderControl class is a standard class in the ASP.NET framework located in the System.Web.UI namespace. This class is responsible for generating a client-side behavior. The class generates a call to the Microsoft Ajax Library $create() method which looks like this: <script type="text/javascript"> $create(MyACTControls.PopupHelpBehavior, {"HelpText":"Please enter your social security number.","id":"ph1"}, null, null, $get("txtSSN")); }); </script> The JavaScript $create() method is part of the Microsoft Ajax Library. The reference for this method can be found here: http://msdn.microsoft.com/en-us/library/bb397487.aspx This method accepts the following parameters: type – The type of client behavior to create. The $create() method above creates a client PopupHelpBehavior. Properties – Enables you to pass initial values for the properties of the client behavior. For example, the initial value of the HelpText property. This is how server property values are passed to the client. Events – Enables you to pass client-side event handlers to the client behavior. References – Enables you to pass references to other client components. Element – The DOM element associated with the client behavior. This will be the DOM element associated with the control being extended such as the txtSSN TextBox. The $create() method is generated for you automatically. You just need to focus on writing the server-side control extender class. Specifying the Target Control All Ajax Control Toolkit extenders inherit a TargetControlID property from the ExtenderControlBase class. This property, the TargetControlID property, points at the control that the extender control extends. For example, the Ajax Control Toolkit TextBoxWatermark control extends a TextBox, the ConfirmButton control extends a Button, and the Calendar control extends a TextBox. You must indicate the type of control which your extender is extending. You indicate the type of control by adding a [TargetControlType] attribute to your control. For example, the PopupHelp extender is declared like this: [TargetControlType(typeof(TextBox))] public class PopupHelpExtender: ExtenderControlBase { } The PopupHelp extender can be used to extend a TextBox control. If you try to use the PopupHelp extender with another type of control then an exception is thrown. If you want to create an extender control which can be used with any type of ASP.NET control (Button, DataView, TextBox or whatever) then use the following attribute: [TargetControlType(typeof(Control))] Decorating Properties with Attributes If you decorate a server-side property with the [ExtenderControlProperty] attribute then the value of the property gets passed to the control’s client-side behavior. The value of the property gets passed to the client through the $create() method discussed above. The PopupHelp control contains the following HelpText property: [ExtenderControlProperty] [RequiredProperty] public string HelpText { get { return GetPropertyValue("HelpText", "Help Text"); } set { SetPropertyValue("HelpText", value); } } The HelpText property determines the help text which pops up when you start typing into a TextBox control. Because the HelpText property is decorated with the [ExtenderControlProperty] attribute, any value assigned to this property on the server is passed to the client automatically. For example, if you declare the PopupHelp extender in a Web Form page like this: <asp:TextBox ID="txtSSN" runat="server" /> <act:PopupHelpExtender id="ph1" TargetControlID="txtSSN" HelpText="Please enter your social security number." runat="server" />   Then the PopupHelpExtender renders the call to the the following Microsoft Ajax Library $create() method: $create(MyACTControls.PopupHelpBehavior, {"HelpText":"Please enter your social security number.","id":"ph1"}, null, null, $get("txtSSN")); You can see this call to the JavaScript $create() method by selecting View Source in your browser. This call to the $create() method calls a method named set_HelpText() automatically and passes the value “Please enter your social security number”. There are several attributes which you can use to decorate server-side properties including: ExtenderControlProperty – When a property is marked with this attribute, the value of the property is passed to the client automatically. ExtenderControlEvent – When a property is marked with this attribute, the property represents a client event handler. Required – When a value is not assigned to this property on the server, an error is displayed. DefaultValue – The default value of the property passed to the client. ClientPropertyName – The name of the corresponding property in the JavaScript behavior. For example, the server-side property is named ID (uppercase) and the client-side property is named id (lower-case). IDReferenceProperty – Applied to properties which refer to the IDs of other controls. URLProperty – Calls ResolveClientURL() to convert from a server-side URL to a URL which can be used on the client. ElementReference – Returns a reference to a DOM element by performing a client $get(). The WebResource, ClientResource, and the RequiredScript Attributes The PopupHelp extender uses three embedded resources named PopupHelpBehavior.js, PopupHelpBehavior.debug.js, and PopupHelpBehavior.css. The first two files are JavaScript files and the final file is a Cascading Style sheet file. These files are compiled as embedded resources. You don’t need to mark them as embedded resources in your Visual Studio solution because they get added to the assembly when the assembly is compiled by a build task. You can see that these files get embedded into the MyACTControls assembly by using Red Gate’s .NET Reflector tool: In order to use these files with the PopupHelp extender, you need to work with both the WebResource and the ClientScriptResource attributes. The PopupHelp extender includes the following three WebResource attributes. [assembly: WebResource("PopupHelp.PopupHelpBehavior.js", "text/javascript")] [assembly: WebResource("PopupHelp.PopupHelpBehavior.debug.js", "text/javascript")] [assembly: WebResource("PopupHelp.PopupHelpBehavior.css", "text/css", PerformSubstitution = true)] These WebResource attributes expose the embedded resource from the assembly so that they can be accessed by using the ScriptResource.axd or WebResource.axd handlers. The first parameter passed to the WebResource attribute is the name of the embedded resource and the second parameter is the content type of the embedded resource. The PopupHelp extender also includes the following ClientScriptResource and ClientCssResource attributes: [ClientScriptResource("MyACTControls.PopupHelpBehavior", "PopupHelp.PopupHelpBehavior.js")] [ClientCssResource("PopupHelp.PopupHelpBehavior.css")] Including these attributes causes the PopupHelp extender to request these resources when you add the PopupHelp extender to a page. If you open View Source in a browser which uses the PopupHelp extender then you will see the following link for the Cascading Style Sheet file: <link href="/WebResource.axd?d=0uONMsWXUuEDG-pbJHAC1kuKiIMteQFkYLmZdkgv7X54TObqYoqVzU4mxvaa4zpn5H9ch0RDwRYKwtO8zM5mKgO6C4WbrbkWWidKR07LD1d4n4i_uNB1mHEvXdZu2Ae5mDdVNDV53znnBojzCzwvSw2&amp;t=634417392021676003" type="text/css" rel="stylesheet" /> You also will see the following script include for the JavaScript file: <script src="/ScriptResource.axd?d=pIS7xcGaqvNLFBvExMBQSp_0xR3mpDfS0QVmmyu1aqDUjF06TrW1jVDyXNDMtBHxpRggLYDvgFTWOsrszflZEDqAcQCg-hDXjun7ON0Ol7EXPQIdOe1GLMceIDv3OeX658-tTq2LGdwXhC1-dE7_6g2&amp;t=ffffffff88a33b59" type="text/javascript"></script> The JavaScrpt file returned by this request to ScriptResource.axd contains the combined scripts for any and all Ajax Control Toolkit controls in a page. By default, the Ajax Control Toolkit combines all of the JavaScript files required by a page into a single JavaScript file. Combining files in this way really speeds up how quickly all of the JavaScript files get delivered from the web server to the browser. So, by default, there will be only one ScriptResource.axd include for all of the JavaScript files required by a page. If you want to disable Script Combining, and create separate links, then disable Script Combining like this: <act:ToolkitScriptManager ID="tsm" runat="server" CombineScripts="false" /> There is one more important attribute used by Ajax Control Toolkit extenders. The PopupHelp behavior uses the following two RequirdScript attributes to load the JavaScript files which are required by the PopupHelp behavior: [RequiredScript(typeof(CommonToolkitScripts), 0)] [RequiredScript(typeof(PopupExtender), 1)] The first parameter of the RequiredScript attribute represents either the string name of a JavaScript file or the type of an Ajax Control Toolkit control. The second parameter represents the order in which the JavaScript files are loaded (This second parameter is needed because .NET attributes are intrinsically unordered). In this case, the RequiredScript attribute will load the JavaScript files associated with the CommonToolkitScripts type and the JavaScript files associated with the PopupExtender in that order. The PopupHelp behavior depends on these JavaScript files. Writing the Client-Side Code The PopupHelp extender uses a client-side behavior written with the Microsoft Ajax Library. Here is the complete code for the client-side behavior: (function () { // The unique name of the script registered with the // client script loader var scriptName = "PopupHelpBehavior"; function execute() { Type.registerNamespace('MyACTControls'); MyACTControls.PopupHelpBehavior = function (element) { /// <summary> /// A behavior which displays popup help for a textbox /// </summmary> /// <param name="element" type="Sys.UI.DomElement">The element to attach to</param> MyACTControls.PopupHelpBehavior.initializeBase(this, [element]); this._textbox = Sys.Extended.UI.TextBoxWrapper.get_Wrapper(element); this._cssClass = "ajax__popupHelp"; this._popupBehavior = null; this._popupPosition = Sys.Extended.UI.PositioningMode.BottomLeft; this._popupDiv = null; this._helpText = "Help Text"; this._element$delegates = { focus: Function.createDelegate(this, this._element_onfocus), blur: Function.createDelegate(this, this._element_onblur) }; } MyACTControls.PopupHelpBehavior.prototype = { initialize: function () { MyACTControls.PopupHelpBehavior.callBaseMethod(this, 'initialize'); // Add event handlers for focus and blur var element = this.get_element(); $addHandlers(element, this._element$delegates); }, _ensurePopup: function () { if (!this._popupDiv) { var element = this.get_element(); var id = this.get_id(); this._popupDiv = $common.createElementFromTemplate({ nodeName: "div", properties: { id: id + "_popupDiv" }, cssClasses: ["ajax__popupHelp"] }, element.parentNode); this._popupBehavior = new $create(Sys.Extended.UI.PopupBehavior, { parentElement: element }, {}, {}, this._popupDiv); this._popupBehavior.set_positioningMode(this._popupPosition); } }, get_HelpText: function () { return this._helpText; }, set_HelpText: function (value) { if (this._HelpText != value) { this._helpText = value; this._ensurePopup(); this._popupDiv.innerHTML = value; this.raisePropertyChanged("Text") } }, _element_onfocus: function (e) { this.show(); }, _element_onblur: function (e) { this.hide(); }, show: function () { this._popupBehavior.show(); }, hide: function () { if (this._popupBehavior) { this._popupBehavior.hide(); } }, dispose: function() { var element = this.get_element(); $clearHandlers(element); if (this._popupBehavior) { this._popupBehavior.dispose(); this._popupBehavior = null; } } }; MyACTControls.PopupHelpBehavior.registerClass('MyACTControls.PopupHelpBehavior', Sys.Extended.UI.BehaviorBase); Sys.registerComponent(MyACTControls.PopupHelpBehavior, { name: "popupHelp" }); } // execute if (window.Sys && Sys.loader) { Sys.loader.registerScript(scriptName, ["ExtendedBase", "ExtendedCommon"], execute); } else { execute(); } })();   In the following sections, we’ll discuss how this client-side behavior works. Wrapping the Behavior for the Script Loader The behavior is wrapped with the following script: (function () { // The unique name of the script registered with the // client script loader var scriptName = "PopupHelpBehavior"; function execute() { // Behavior Content } // execute if (window.Sys && Sys.loader) { Sys.loader.registerScript(scriptName, ["ExtendedBase", "ExtendedCommon"], execute); } else { execute(); } })(); This code is required by the Microsoft Ajax Library Script Loader. You need this code if you plan to use a behavior directly from client-side code and you want to use the Script Loader. If you plan to only use your code in the context of the Ajax Control Toolkit then you can leave out this code. Registering a JavaScript Namespace The PopupHelp behavior is declared within a namespace named MyACTControls. In the code above, this namespace is created with the following registerNamespace() method: Type.registerNamespace('MyACTControls'); JavaScript does not have any built-in way of creating namespaces to prevent naming conflicts. The Microsoft Ajax Library extends JavaScript with support for namespaces. You can learn more about the registerNamespace() method here: http://msdn.microsoft.com/en-us/library/bb397723.aspx Creating the Behavior The actual Popup behavior is created with the following code. MyACTControls.PopupHelpBehavior = function (element) { /// <summary> /// A behavior which displays popup help for a textbox /// </summmary> /// <param name="element" type="Sys.UI.DomElement">The element to attach to</param> MyACTControls.PopupHelpBehavior.initializeBase(this, [element]); this._textbox = Sys.Extended.UI.TextBoxWrapper.get_Wrapper(element); this._cssClass = "ajax__popupHelp"; this._popupBehavior = null; this._popupPosition = Sys.Extended.UI.PositioningMode.BottomLeft; this._popupDiv = null; this._helpText = "Help Text"; this._element$delegates = { focus: Function.createDelegate(this, this._element_onfocus), blur: Function.createDelegate(this, this._element_onblur) }; } MyACTControls.PopupHelpBehavior.prototype = { initialize: function () { MyACTControls.PopupHelpBehavior.callBaseMethod(this, 'initialize'); // Add event handlers for focus and blur var element = this.get_element(); $addHandlers(element, this._element$delegates); }, _ensurePopup: function () { if (!this._popupDiv) { var element = this.get_element(); var id = this.get_id(); this._popupDiv = $common.createElementFromTemplate({ nodeName: "div", properties: { id: id + "_popupDiv" }, cssClasses: ["ajax__popupHelp"] }, element.parentNode); this._popupBehavior = new $create(Sys.Extended.UI.PopupBehavior, { parentElement: element }, {}, {}, this._popupDiv); this._popupBehavior.set_positioningMode(this._popupPosition); } }, get_HelpText: function () { return this._helpText; }, set_HelpText: function (value) { if (this._HelpText != value) { this._helpText = value; this._ensurePopup(); this._popupDiv.innerHTML = value; this.raisePropertyChanged("Text") } }, _element_onfocus: function (e) { this.show(); }, _element_onblur: function (e) { this.hide(); }, show: function () { this._popupBehavior.show(); }, hide: function () { if (this._popupBehavior) { this._popupBehavior.hide(); } }, dispose: function() { var element = this.get_element(); $clearHandlers(element); if (this._popupBehavior) { this._popupBehavior.dispose(); this._popupBehavior = null; } } }; The code above has two parts. The first part of the code is used to define the constructor function for the PopupHelp behavior. This is a factory method which returns an instance of a PopupHelp behavior: MyACTControls.PopupHelpBehavior = function (element) { } The second part of the code modified the prototype for the PopupHelp behavior: MyACTControls.PopupHelpBehavior.prototype = { } Any code which is particular to a single instance of the PopupHelp behavior should be placed in the constructor function. For example, the default value of the _helpText field is assigned in the constructor function: this._helpText = "Help Text"; Any code which is shared among all instances of the PopupHelp behavior should be added to the PopupHelp behavior’s prototype. For example, the public HelpText property is added to the prototype: get_HelpText: function () { return this._helpText; }, set_HelpText: function (value) { if (this._HelpText != value) { this._helpText = value; this._ensurePopup(); this._popupDiv.innerHTML = value; this.raisePropertyChanged("Text") } }, Registering a JavaScript Class After you create the PopupHelp behavior, you must register the behavior as a class by using the Microsoft Ajax registerClass() method like this: MyACTControls.PopupHelpBehavior.registerClass('MyACTControls.PopupHelpBehavior', Sys.Extended.UI.BehaviorBase); This call to registerClass() registers PopupHelp behavior as a class which derives from the base Sys.Extended.UI.BehaviorBase class. Like the ExtenderControlBase class on the server side, the BehaviorBase class on the client side contains method used by every behavior. The documentation for the BehaviorBase class can be found here: http://msdn.microsoft.com/en-us/library/bb311020.aspx The most important methods and properties of the BehaviorBase class are the following: dispose() – Use this method to clean up all resources used by your behavior. In the case of the PopupHelp behavior, the dispose() method is used to remote the event handlers created by the behavior and disposed the Popup behavior. get_element() -- Use this property to get the DOM element associated with the behavior. In other words, the DOM element which the behavior extends. get_id() – Use this property to the ID of the current behavior. initialize() – Use this method to initialize the behavior. This method is called after all of the properties are set by the $create() method. Creating Debug and Release Scripts You might have noticed that the PopupHelp behavior uses two scripts named PopupHelpBehavior.js and PopupHelpBehavior.debug.js. However, you never create these two scripts. Instead, you only create a single script named PopupHelpBehavior.pre.js. The pre in PopupHelpBehavior.pre.js stands for preprocessor. When you build the Ajax Control Toolkit (or the sample Visual Studio Solution at the end of this blog entry), a build task named JSBuild generates the PopupHelpBehavior.js release script and PopupHelpBehavior.debug.js debug script automatically. The JSBuild preprocessor supports the following directives: #IF #ELSE #ENDIF #INCLUDE #LOCALIZE #DEFINE #UNDEFINE The preprocessor directives are used to mark code which should only appear in the debug version of the script. The directives are used extensively in the Microsoft Ajax Library. For example, the Microsoft Ajax Library Array.contains() method is created like this: $type.contains = function Array$contains(array, item) { //#if DEBUG var e = Function._validateParams(arguments, [ {name: "array", type: Array, elementMayBeNull: true}, {name: "item", mayBeNull: true} ]); if (e) throw e; //#endif return (indexOf(array, item) >= 0); } Notice that you add each of the preprocessor directives inside a JavaScript comment. The comment prevents Visual Studio from getting confused with its Intellisense. The release version, but not the debug version, of the PopupHelpBehavior script is also minified automatically by the Microsoft Ajax Minifier. The minifier is invoked by a build step in the project file. Conclusion The goal of this blog entry was to explain how you can create custom AJAX Control Toolkit controls. In the first part of this blog entry, you learned how to create the server-side portion of an Ajax Control Toolkit control. You learned how to derive a new control from the ExtenderControlBase class and decorate its properties with the necessary attributes. Next, in the second part of this blog entry, you learned how to create the client-side portion of an Ajax Control Toolkit control by creating a client-side behavior with JavaScript. You learned how to use the methods of the Microsoft Ajax Library to extend your client behavior from the BehaviorBase class. Download the Custom ACT Starter Solution

    Read the article

  • Oracle Coherence, Split-Brain and Recovery Protocols In Detail

    - by Ricardo Ferreira
    This article provides a high level conceptual overview of Split-Brain scenarios in distributed systems. It will focus on a specific example of cluster communication failure and recovery in Oracle Coherence. This includes a discussion on the witness protocol (used to remove failed cluster members) and the panic protocol (used to resolve Split-Brain scenarios). Note that the removal of cluster members does not necessarily indicate a Split-Brain condition. Oracle Coherence does not (and cannot) detect a Split-Brain as it occurs, the condition is only detected when cluster members that previously lost contact with each other regain contact. Cluster Topology and Configuration In order to create an good didactic for the article, let's assume a cluster topology and configuration. In this example we have a six member cluster, consisting of one JVM on each physical machine. The member IDs are as follows: Member ID  IP Address  1  10.149.155.76  2  10.149.155.77  3  10.149.155.236  4  10.149.155.75  5  10.149.155.79  6  10.149.155.78 Members 1, 2, and 3 are connected to a switch, and members 4, 5, and 6 are connected to a second switch. There is a link between the two switches, which provides network connectivity between all of the machines. Member 1 is the first member to join this cluster, thus making it the senior member. Member 6 is the last member to join this cluster. Here is a log snippet from Member 6 showing the complete member set: 2010-02-26 15:27:57.390/3.062 Oracle Coherence GE 3.5.3/465p2 <Info> (thread=main, member=6): Started DefaultCacheServer... SafeCluster: Name=cluster:0xDDEB Group{Address=224.3.5.3, Port=35465, TTL=4} MasterMemberSet ( ThisMember=Member(Id=6, Timestamp=2010-02-26 15:27:58.635, Address=10.149.155.78:8088, MachineId=1102, Location=process:228, Role=CoherenceServer) OldestMember=Member(Id=1, Timestamp=2010-02-26 15:27:06.931, Address=10.149.155.76:8088, MachineId=1100, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:511, Role=CoherenceServer) ActualMemberSet=MemberSet(Size=6, BitSetCount=2 Member(Id=1, Timestamp=2010-02-26 15:27:06.931, Address=10.149.155.76:8088, MachineId=1100, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:511, Role=CoherenceServer) Member(Id=2, Timestamp=2010-02-26 15:27:17.847, Address=10.149.155.77:8088, MachineId=1101, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:296, Role=CoherenceServer) Member(Id=3, Timestamp=2010-02-26 15:27:24.892, Address=10.149.155.236:8088, MachineId=1260, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:32459, Role=CoherenceServer) Member(Id=4, Timestamp=2010-02-26 15:27:39.574, Address=10.149.155.75:8088, MachineId=1099, Location=process:800, Role=CoherenceServer) Member(Id=5, Timestamp=2010-02-26 15:27:49.095, Address=10.149.155.79:8088, MachineId=1103, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:3229, Role=CoherenceServer) Member(Id=6, Timestamp=2010-02-26 15:27:58.635, Address=10.149.155.78:8088, MachineId=1102, Location=process:228, Role=CoherenceServer) ) RecycleMillis=120000 RecycleSet=MemberSet(Size=0, BitSetCount=0 ) ) At approximately 15:30, the connection between the two switches is severed: Thirty seconds later (the default packet timeout in development mode) the logs indicate communication failures across the cluster. In this example, the communication failure was caused by a network failure. In a production setting, this type of communication failure can have many root causes, including (but not limited to) network failures, excessive GC, high CPU utilization, swapping/virtual memory, and exceeding maximum network bandwidth. In addition, this type of failure is not necessarily indicative of a split brain. Any communication failure will be logged in this fashion. Member 2 logs a communication failure with Member 5: 2010-02-26 15:30:32.638/196.928 Oracle Coherence GE 3.5.3/465p2 <Warning> (thread=PacketPublisher, member=2): Timeout while delivering a packet; requesting the departure confirmation for Member(Id=5, Timestamp=2010-02-26 15:27:49.095, Address=10.149.155.79:8088, MachineId=1103, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:3229, Role=CoherenceServer) by MemberSet(Size=2, BitSetCount=2 Member(Id=1, Timestamp=2010-02-26 15:27:06.931, Address=10.149.155.76:8088, MachineId=1100, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:511, Role=CoherenceServer) Member(Id=4, Timestamp=2010-02-26 15:27:39.574, Address=10.149.155.75:8088, MachineId=1099, Location=process:800, Role=CoherenceServer) ) The Coherence clustering protocol (TCMP) is a reliable transport mechanism built on UDP. In order for the protocol to be reliable, it requires an acknowledgement (ACK) for each packet delivered. If a packet fails to be acknowledged within the configured timeout period, the Coherence cluster member will log a packet timeout (as seen in the log message above). When this occurs, the cluster member will consult with other members to determine who is at fault for the communication failure. If the witness members agree that the suspect member is at fault, the suspect is removed from the cluster. If the witnesses unanimously disagree, the accuser is removed. This process is known as the witness protocol. Since Member 2 cannot communicate with Member 5, it selects two witnesses (Members 1 and 4) to determine if the communication issue is with Member 5 or with itself (Member 2). However, Member 4 is on the switch that is no longer accessible by Members 1, 2 and 3; thus a packet timeout for member 4 is recorded as well: 2010-02-26 15:30:35.648/199.938 Oracle Coherence GE 3.5.3/465p2 <Warning> (thread=PacketPublisher, member=2): Timeout while delivering a packet; requesting the departure confirmation for Member(Id=4, Timestamp=2010-02-26 15:27:39.574, Address=10.149.155.75:8088, MachineId=1099, Location=process:800, Role=CoherenceServer) by MemberSet(Size=2, BitSetCount=2 Member(Id=1, Timestamp=2010-02-26 15:27:06.931, Address=10.149.155.76:8088, MachineId=1100, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:511, Role=CoherenceServer) Member(Id=6, Timestamp=2010-02-26 15:27:58.635, Address=10.149.155.78:8088, MachineId=1102, Location=process:228, Role=CoherenceServer) ) Member 1 has the ability to confirm the departure of member 4, however Member 6 cannot as it is also inaccessible. At the same time, Member 3 sends a request to remove Member 6, which is followed by a report from Member 3 indicating that Member 6 has departed the cluster: 2010-02-26 15:30:35.706/199.996 Oracle Coherence GE 3.5.3/465p2 <D5> (thread=Cluster, member=2): MemberLeft request for Member 6 received from Member(Id=3, Timestamp=2010-02-26 15:27:24.892, Address=10.149.155.236:8088, MachineId=1260, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:32459, Role=CoherenceServer) 2010-02-26 15:30:35.709/199.999 Oracle Coherence GE 3.5.3/465p2 <D5> (thread=Cluster, member=2): MemberLeft notification for Member 6 received from Member(Id=3, Timestamp=2010-02-26 15:27:24.892, Address=10.149.155.236:8088, MachineId=1260, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:32459, Role=CoherenceServer) The log for Member 3 determines how Member 6 departed the cluster: 2010-02-26 15:30:35.161/191.694 Oracle Coherence GE 3.5.3/465p2 <Warning> (thread=PacketPublisher, member=3): Timeout while delivering a packet; requesting the departure confirmation for Member(Id=6, Timestamp=2010-02-26 15:27:58.635, Address=10.149.155.78:8088, MachineId=1102, Location=process:228, Role=CoherenceServer) by MemberSet(Size=2, BitSetCount=2 Member(Id=1, Timestamp=2010-02-26 15:27:06.931, Address=10.149.155.76:8088, MachineId=1100, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:511, Role=CoherenceServer) Member(Id=2, Timestamp=2010-02-26 15:27:17.847, Address=10.149.155.77:8088, MachineId=1101, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:296, Role=CoherenceServer) ) 2010-02-26 15:30:35.165/191.698 Oracle Coherence GE 3.5.3/465p2 <Info> (thread=Cluster, member=3): Member departure confirmed by MemberSet(Size=2, BitSetCount=2 Member(Id=1, Timestamp=2010-02-26 15:27:06.931, Address=10.149.155.76:8088, MachineId=1100, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:511, Role=CoherenceServer) Member(Id=2, Timestamp=2010-02-26 15:27:17.847, Address=10.149.155.77:8088, MachineId=1101, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:296, Role=CoherenceServer) ); removing Member(Id=6, Timestamp=2010-02-26 15:27:58.635, Address=10.149.155.78:8088, MachineId=1102, Location=process:228, Role=CoherenceServer) In this case, Member 3 happened to select two witnesses that it still had connectivity with (Members 1 and 2) thus resulting in a simple decision to remove Member 6. Given the departure of Member 6, Member 2 is left with a single witness to confirm the departure of Member 4: 2010-02-26 15:30:35.713/200.003 Oracle Coherence GE 3.5.3/465p2 <Info> (thread=Cluster, member=2): Member departure confirmed by MemberSet(Size=1, BitSetCount=2 Member(Id=1, Timestamp=2010-02-26 15:27:06.931, Address=10.149.155.76:8088, MachineId=1100, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:511, Role=CoherenceServer) ); removing Member(Id=4, Timestamp=2010-02-26 15:27:39.574, Address=10.149.155.75:8088, MachineId=1099, Location=process:800, Role=CoherenceServer) In the meantime, Member 4 logs a missing heartbeat from the senior member. This message is also logged on Members 5 and 6. 2010-02-26 15:30:07.906/150.453 Oracle Coherence GE 3.5.3/465p2 <Info> (thread=PacketListenerN, member=4): Scheduled senior member heartbeat is overdue; rejoining multicast group. Next, Member 4 logs a TcpRing failure with Member 2, thus resulting in the termination of Member 2: 2010-02-26 15:30:21.421/163.968 Oracle Coherence GE 3.5.3/465p2 <D4> (thread=Cluster, member=4): TcpRing: Number of socket exceptions exceeded maximum; last was "java.net.SocketTimeoutException: connect timed out"; removing the member: 2 For quick process termination detection, Oracle Coherence utilizes a feature called TcpRing which is a sparse collection of TCP/IP-based connections between different members in the cluster. Each member in the cluster is connected to at least one other member, which (if at all possible) is running on a different physical box. This connection is not used for any data transfer, only heartbeat communications are sent once a second per each link. If a certain number of exceptions are thrown while trying to re-establish a connection, the member throwing the exceptions is removed from the cluster. Member 5 logs a packet timeout with Member 3 and cites witnesses Members 4 and 6: 2010-02-26 15:30:29.791/165.037 Oracle Coherence GE 3.5.3/465p2 <Warning> (thread=PacketPublisher, member=5): Timeout while delivering a packet; requesting the departure confirmation for Member(Id=3, Timestamp=2010-02-26 15:27:24.892, Address=10.149.155.236:8088, MachineId=1260, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:32459, Role=CoherenceServer) by MemberSet(Size=2, BitSetCount=2 Member(Id=4, Timestamp=2010-02-26 15:27:39.574, Address=10.149.155.75:8088, MachineId=1099, Location=process:800, Role=CoherenceServer) Member(Id=6, Timestamp=2010-02-26 15:27:58.635, Address=10.149.155.78:8088, MachineId=1102, Location=process:228, Role=CoherenceServer) ) 2010-02-26 15:30:29.798/165.044 Oracle Coherence GE 3.5.3/465p2 <Info> (thread=Cluster, member=5): Member departure confirmed by MemberSet(Size=2, BitSetCount=2 Member(Id=4, Timestamp=2010-02-26 15:27:39.574, Address=10.149.155.75:8088, MachineId=1099, Location=process:800, Role=CoherenceServer) Member(Id=6, Timestamp=2010-02-26 15:27:58.635, Address=10.149.155.78:8088, MachineId=1102, Location=process:228, Role=CoherenceServer) ); removing Member(Id=3, Timestamp=2010-02-26 15:27:24.892, Address=10.149.155.236:8088, MachineId=1260, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:32459, Role=CoherenceServer) Eventually we are left with two distinct clusters consisting of Members 1, 2, 3 and Members 4, 5, 6, respectively. In the latter cluster, Member 4 is promoted to senior member. The connection between the two switches is restored at 15:33. Upon the restoration of the connection, the cluster members immediately receive cluster heartbeats from the two senior members. In the case of Members 1, 2, and 3, the following is logged: 2010-02-26 15:33:14.970/369.066 Oracle Coherence GE 3.5.3/465p2 <Warning> (thread=Cluster, member=1): The member formerly known as Member(Id=4, Timestamp=2010-02-26 15:30:35.341, Address=10.149.155.75:8088, MachineId=1099, Location=process:800, Role=CoherenceServer) has been forcefully evicted from the cluster, but continues to emit a cluster heartbeat; henceforth, the member will be shunned and its messages will be ignored. Likewise for Members 4, 5, and 6: 2010-02-26 15:33:14.343/336.890 Oracle Coherence GE 3.5.3/465p2 <Warning> (thread=Cluster, member=4): The member formerly known as Member(Id=1, Timestamp=2010-02-26 15:30:31.64, Address=10.149.155.76:8088, MachineId=1100, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:511, Role=CoherenceServer) has been forcefully evicted from the cluster, but continues to emit a cluster heartbeat; henceforth, the member will be shunned and its messages will be ignored. This message indicates that a senior heartbeat is being received from members that were previously removed from the cluster, in other words, something that should not be possible. For this reason, the recipients of these messages will initially ignore them. After several iterations of these messages, the existence of multiple clusters is acknowledged, thus triggering the panic protocol to reconcile this situation. When the presence of more than one cluster (i.e. Split-Brain) is detected by a Coherence member, the panic protocol is invoked in order to resolve the conflicting clusters and consolidate into a single cluster. The protocol consists of the removal of smaller clusters until there is one cluster remaining. In the case of equal size clusters, the one with the older Senior Member will survive. Member 1, being the oldest member, initiates the protocol: 2010-02-26 15:33:45.970/400.066 Oracle Coherence GE 3.5.3/465p2 <Warning> (thread=Cluster, member=1): An existence of a cluster island with senior Member(Id=4, Timestamp=2010-02-26 15:27:39.574, Address=10.149.155.75:8088, MachineId=1099, Location=process:800, Role=CoherenceServer) containing 3 nodes have been detected. Since this Member(Id=1, Timestamp=2010-02-26 15:27:06.931, Address=10.149.155.76:8088, MachineId=1100, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:511, Role=CoherenceServer) is the senior of an older cluster island, the panic protocol is being activated to stop the other island's senior and all junior nodes that belong to it. Member 3 receives the panic: 2010-02-26 15:33:45.803/382.336 Oracle Coherence GE 3.5.3/465p2 <Error> (thread=Cluster, member=3): Received panic from senior Member(Id=1, Timestamp=2010-02-26 15:27:06.931, Address=10.149.155.76:8088, MachineId=1100, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:511, Role=CoherenceServer) caused by Member(Id=4, Timestamp=2010-02-26 15:27:39.574, Address=10.149.155.75:8088, MachineId=1099, Location=process:800, Role=CoherenceServer) Member 4, the senior member of the younger cluster, receives the kill message from Member 3: 2010-02-26 15:33:44.921/367.468 Oracle Coherence GE 3.5.3/465p2 <Error> (thread=Cluster, member=4): Received a Kill message from a valid Member(Id=3, Timestamp=2010-02-26 15:27:24.892, Address=10.149.155.236:8088, MachineId=1260, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:32459, Role=CoherenceServer); stopping cluster service. In turn, Member 4 requests the departure of its junior members 5 and 6: 2010-02-26 15:33:44.921/367.468 Oracle Coherence GE 3.5.3/465p2 <Error> (thread=Cluster, member=4): Received a Kill message from a valid Member(Id=3, Timestamp=2010-02-26 15:27:24.892, Address=10.149.155.236:8088, MachineId=1260, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:32459, Role=CoherenceServer); stopping cluster service. 2010-02-26 15:33:43.343/349.015 Oracle Coherence GE 3.5.3/465p2 <Error> (thread=Cluster, member=6): Received a Kill message from a valid Member(Id=4, Timestamp=2010-02-26 15:27:39.574, Address=10.149.155.75:8088, MachineId=1099, Location=process:800, Role=CoherenceServer); stopping cluster service. Once Members 4, 5, and 6 restart, they rejoin the original cluster with senior member 1. The log below is from Member 4. Note that it receives a different member id when it rejoins the cluster. 2010-02-26 15:33:44.921/367.468 Oracle Coherence GE 3.5.3/465p2 <Error> (thread=Cluster, member=4): Received a Kill message from a valid Member(Id=3, Timestamp=2010-02-26 15:27:24.892, Address=10.149.155.236:8088, MachineId=1260, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:32459, Role=CoherenceServer); stopping cluster service. 2010-02-26 15:33:46.921/369.468 Oracle Coherence GE 3.5.3/465p2 <D5> (thread=Cluster, member=4): Service Cluster left the cluster 2010-02-26 15:33:47.046/369.593 Oracle Coherence GE 3.5.3/465p2 <D5> (thread=Invocation:InvocationService, member=4): Service InvocationService left the cluster 2010-02-26 15:33:47.046/369.593 Oracle Coherence GE 3.5.3/465p2 <D5> (thread=OptimisticCache, member=4): Service OptimisticCache left the cluster 2010-02-26 15:33:47.046/369.593 Oracle Coherence GE 3.5.3/465p2 <D5> (thread=ReplicatedCache, member=4): Service ReplicatedCache left the cluster 2010-02-26 15:33:47.046/369.593 Oracle Coherence GE 3.5.3/465p2 <D5> (thread=DistributedCache, member=4): Service DistributedCache left the cluster 2010-02-26 15:33:47.046/369.593 Oracle Coherence GE 3.5.3/465p2 <D5> (thread=Invocation:Management, member=4): Service Management left the cluster 2010-02-26 15:33:47.046/369.593 Oracle Coherence GE 3.5.3/465p2 <D5> (thread=Cluster, member=4): Member 6 left service Management with senior member 5 2010-02-26 15:33:47.046/369.593 Oracle Coherence GE 3.5.3/465p2 <D5> (thread=Cluster, member=4): Member 6 left service DistributedCache with senior member 5 2010-02-26 15:33:47.046/369.593 Oracle Coherence GE 3.5.3/465p2 <D5> (thread=Cluster, member=4): Member 6 left service ReplicatedCache with senior member 5 2010-02-26 15:33:47.046/369.593 Oracle Coherence GE 3.5.3/465p2 <D5> (thread=Cluster, member=4): Member 6 left service OptimisticCache with senior member 5 2010-02-26 15:33:47.046/369.593 Oracle Coherence GE 3.5.3/465p2 <D5> (thread=Cluster, member=4): Member 6 left service InvocationService with senior member 5 2010-02-26 15:33:47.046/369.593 Oracle Coherence GE 3.5.3/465p2 <D5> (thread=Cluster, member=4): Member(Id=6, Timestamp=2010-02-26 15:33:47.046, Address=10.149.155.78:8088, MachineId=1102, Location=process:228, Role=CoherenceServer) left Cluster with senior member 4 2010-02-26 15:33:49.218/371.765 Oracle Coherence GE 3.5.3/465p2 <Info> (thread=main, member=n/a): Restarting cluster 2010-02-26 15:33:49.421/371.968 Oracle Coherence GE 3.5.3/465p2 <D5> (thread=Cluster, member=n/a): Service Cluster joined the cluster with senior service member n/a 2010-02-26 15:33:49.625/372.172 Oracle Coherence GE 3.5.3/465p2 <Info> (thread=Cluster, member=n/a): This Member(Id=5, Timestamp=2010-02-26 15:33:50.499, Address=10.149.155.75:8088, MachineId=1099, Location=process:800, Role=CoherenceServer, Edition=Grid Edition, Mode=Development, CpuCount=2, SocketCount=1) joined cluster "cluster:0xDDEB" with senior Member(Id=1, Timestamp=2010-02-26 15:27:06.931, Address=10.149.155.76:8088, MachineId=1100, Location=site:usdhcp.oraclecorp.com,machine:dhcp-burlington6-4fl-east-10-149,process:511, Role=CoherenceServer, Edition=Grid Edition, Mode=Development, CpuCount=2, SocketCount=2) Cool isn't it?

    Read the article

  • Windows Azure: Backup Services Release, Hyper-V Recovery Manager, VM Enhancements, Enhanced Enterprise Management Support

    - by ScottGu
    This morning we released a huge set of updates to Windows Azure.  These new capabilities include: Backup Services: General Availability of Windows Azure Backup Services Hyper-V Recovery Manager: Public preview of Windows Azure Hyper-V Recovery Manager Virtual Machines: Delete Attached Disks, Availability Set Warnings, SQL AlwaysOn Configuration Active Directory: Securely manage hundreds of SaaS applications Enterprise Management: Use Active Directory to Better Manage Windows Azure Windows Azure SDK 2.2: A massive update of our SDK + Visual Studio tooling support All of these improvements are now available to use immediately.  Below are more details about them. Backup Service: General Availability Release of Windows Azure Backup Today we are releasing Windows Azure Backup Service as a general availability service.  This release is now live in production, backed by an enterprise SLA, supported by Microsoft Support, and is ready to use for production scenarios. Windows Azure Backup is a cloud based backup solution for Windows Server which allows files and folders to be backed up and recovered from the cloud, and provides off-site protection against data loss. The service provides IT administrators and developers with the option to back up and protect critical data in an easily recoverable way from any location with no upfront hardware cost. Windows Azure Backup is built on the Windows Azure platform and uses Windows Azure blob storage for storing customer data. Windows Server uses the downloadable Windows Azure Backup Agent to transfer file and folder data securely and efficiently to the Windows Azure Backup Service. Along with providing cloud backup for Windows Server, Windows Azure Backup Service also provides capability to backup data from System Center Data Protection Manager and Windows Server Essentials, to the cloud. All data is encrypted onsite before it is sent to the cloud, and customers retain and manage the encryption key (meaning the data is stored entirely secured and can’t be decrypted by anyone but yourself). Getting Started To get started with the Windows Azure Backup Service, create a new Backup Vault within the Windows Azure Management Portal.  Click New->Data Services->Recovery Services->Backup Vault to do this: Once the backup vault is created you’ll be presented with a simple tutorial that will help guide you on how to register your Windows Servers with it: Once the servers you want to backup are registered, you can use the appropriate local management interface (such as the Microsoft Management Console snap-in, System Center Data Protection Manager Console, or Windows Server Essentials Dashboard) to configure the scheduled backups and to optionally initiate recoveries. You can follow these tutorials to learn more about how to do this: Tutorial: Schedule Backups Using the Windows Azure Backup Agent This tutorial helps you with setting up a backup schedule for your registered Windows Servers. Additionally, it also explains how to use Windows PowerShell cmdlets to set up a custom backup schedule. Tutorial: Recover Files and Folders Using the Windows Azure Backup Agent This tutorial helps you with recovering data from a backup. Additionally, it also explains how to use Windows PowerShell cmdlets to do the same tasks. Below are some of the key benefits the Windows Azure Backup Service provides: Simple configuration and management. Windows Azure Backup Service integrates with the familiar Windows Server Backup utility in Windows Server, the Data Protection Manager component in System Center and Windows Server Essentials, in order to provide a seamless backup and recovery experience to a local disk, or to the cloud. Block level incremental backups. The Windows Azure Backup Agent performs incremental backups by tracking file and block level changes and only transferring the changed blocks, hence reducing the storage and bandwidth utilization. Different point-in-time versions of the backups use storage efficiently by only storing the changes blocks between these versions. Data compression, encryption and throttling. The Windows Azure Backup Agent ensures that data is compressed and encrypted on the server before being sent to the Windows Azure Backup Service over the network. As a result, the Windows Azure Backup Service only stores encrypted data in the cloud storage. The encryption key is not available to the Windows Azure Backup Service, and as a result the data is never decrypted in the service. Also, users can setup throttling and configure how the Windows Azure Backup service utilizes the network bandwidth when backing up or restoring information. Data integrity is verified in the cloud. In addition to the secure backups, the backed up data is also automatically checked for integrity once the backup is done. As a result, any corruptions which may arise due to data transfer can be easily identified and are fixed automatically. Configurable retention policies for storing data in the cloud. The Windows Azure Backup Service accepts and implements retention policies to recycle backups that exceed the desired retention range, thereby meeting business policies and managing backup costs. Hyper-V Recovery Manager: Now Available in Public Preview I’m excited to also announce the public preview of a new Windows Azure Service – the Windows Azure Hyper-V Recovery Manager (HRM). Windows Azure Hyper-V Recovery Manager helps protect your business critical services by coordinating the replication and recovery of System Center Virtual Machine Manager 2012 SP1 and System Center Virtual Machine Manager 2012 R2 private clouds at a secondary location. With automated protection, asynchronous ongoing replication, and orderly recovery, the Hyper-V Recovery Manager service can help you implement Disaster Recovery and restore important services accurately, consistently, and with minimal downtime. Application data in an Hyper-V Recovery Manager scenarios always travels on your on-premise replication channel. Only metadata (such as names of logical clouds, virtual machines, networks etc.) that is needed for orchestration is sent to Azure. All traffic sent to/from Azure is encrypted. You can begin using Windows Azure Hyper-V Recovery today by clicking New->Data Services->Recovery Services->Hyper-V Recovery Manager within the Windows Azure Management Portal.  You can read more about Windows Azure Hyper-V Recovery Manager in Brad Anderson’s 9-part series, Transform the datacenter. To learn more about setting up Hyper-V Recovery Manager follow our detailed step-by-step guide. Virtual Machines: Delete Attached Disks, Availability Set Warnings, SQL AlwaysOn Today’s Windows Azure release includes a number of nice updates to Windows Azure Virtual Machines.  These improvements include: Ability to Delete both VM Instances + Attached Disks in One Operation Prior to today’s release, when you deleted VMs within Windows Azure we would delete the VM instance – but not delete the drives attached to the VM.  You had to manually delete these yourself from the storage account.  With today’s update we’ve added a convenience option that now allows you to either retain or delete the attached disks when you delete the VM:   We’ve also added the ability to delete a cloud service, its deployments, and its role instances with a single action. This can either be a cloud service that has production and staging deployments with web and worker roles, or a cloud service that contains virtual machines.  To do this, simply select the Cloud Service within the Windows Azure Management Portal and click the “Delete” button: Warnings on Availability Sets with Only One Virtual Machine In Them One of the nice features that Windows Azure Virtual Machines supports is the concept of “Availability Sets”.  An “availability set” allows you to define a tier/role (e.g. webfrontends, databaseservers, etc) that you can map Virtual Machines into – and when you do this Windows Azure separates them across fault domains and ensures that at least one of them is always available during servicing operations.  This enables you to deploy applications in a high availability way. One issue we’ve seen some customers run into is where they define an availability set, but then forget to map more than one VM into it (which defeats the purpose of having an availability set).  With today’s release we now display a warning in the Windows Azure Management Portal if you have only one virtual machine deployed in an availability set to help highlight this: You can learn more about configuring the availability of your virtual machines here. Configuring SQL Server Always On SQL Server Always On is a great feature that you can use with Windows Azure to enable high availability and DR scenarios with SQL Server. Today’s Windows Azure release makes it even easier to configure SQL Server Always On by enabling “Direct Server Return” endpoints to be configured and managed within the Windows Azure Management Portal.  Previously, setting this up required using PowerShell to complete the endpoint configuration.  Starting today you can enable this simply by checking the “Direct Server Return” checkbox: You can learn more about how to use direct server return for SQL Server AlwaysOn availability groups here. Active Directory: Application Access Enhancements This summer we released our initial preview of our Application Access Enhancements for Windows Azure Active Directory.  This service enables you to securely implement single-sign-on (SSO) support against SaaS applications (including Office 365, SalesForce, Workday, Box, Google Apps, GitHub, etc) as well as LOB based applications (including ones built with the new Windows Azure AD support we shipped last week with ASP.NET and VS 2013). Since the initial preview we’ve enhanced our SAML federation capabilities, integrated our new password vaulting system, and shipped multi-factor authentication support. We've also turned on our outbound identity provisioning system and have it working with hundreds of additional SaaS Applications: Earlier this month we published an update on dates and pricing for when the service will be released in general availability form.  In this blog post we announced our intention to release the service in general availability form by the end of the year.  We also announced that the below features would be available in a free tier with it: SSO to every SaaS app we integrate with – Users can Single Sign On to any app we are integrated with at no charge. This includes all the top SAAS Apps and every app in our application gallery whether they use federation or password vaulting. Application access assignment and removal – IT Admins can assign access privileges to web applications to the users in their active directory assuring that every employee has access to the SAAS Apps they need. And when a user leaves the company or changes jobs, the admin can just as easily remove their access privileges assuring data security and minimizing IP loss User provisioning (and de-provisioning) – IT admins will be able to automatically provision users in 3rd party SaaS applications like Box, Salesforce.com, GoToMeeting, DropBox and others. We are working with key partners in the ecosystem to establish these connections, meaning you no longer have to continually update user records in multiple systems. Security and auditing reports – Security is a key priority for us. With the free version of these enhancements you'll get access to our standard set of access reports giving you visibility into which users are using which applications, when they were using them and where they are using them from. In addition, we'll alert you to un-usual usage patterns for instance when a user logs in from multiple locations at the same time. Our Application Access Panel – Users are logging in from every type of devices including Windows, iOS, & Android. Not all of these devices handle authentication in the same manner but the user doesn't care. They need to access their apps from the devices they love. Our Application Access Panel will support the ability for users to access access and launch their apps from any device and anywhere. You can learn more about our plans for application management with Windows Azure Active Directory here.  Try out the preview and start using it today. Enterprise Management: Use Active Directory to Better Manage Windows Azure Windows Azure Active Directory provides the ability to manage your organization in a directory which is hosted entirely in the cloud, or alternatively kept in sync with an on-premises Windows Server Active Directory solution (allowing you to seamlessly integrate with the directory you already have).  With today’s Windows Azure release we are integrating Windows Azure Active Directory even more within the core Windows Azure management experience, and enabling an even richer enterprise security offering.  Specifically: 1) All Windows Azure accounts now have a default Windows Azure Active Directory created for them.  You can create and map any users you want into this directory, and grant administrative rights to manage resources in Windows Azure to these users. 2) You can keep this directory entirely hosted in the cloud – or optionally sync it with your on-premises Windows Server Active Directory.  Both options are free.  The later approach is ideal for companies that wish to use their corporate user identities to sign-in and manage Windows Azure resources.  It also ensures that if an employee leaves an organization, his or her access control rights to the company’s Windows Azure resources are immediately revoked. 3) The Windows Azure Service Management APIs have been updated to support using Windows Azure Active Directory credentials to sign-in and perform management operations.  Prior to today’s release customers had to download and use management certificates (which were not scoped to individual users) to perform management operations.  We still support this management certificate approach (don’t worry – nothing will stop working).  But we think the new Windows Azure Active Directory authentication support enables an even easier and more secure way for customers to manage resources going forward.  4) The Windows Azure SDK 2.2 release (which is also shipping today) includes built-in support for the new Service Management APIs that authenticate with Windows Azure Active Directory, and now allow you to create and manage Windows Azure applications and resources directly within Visual Studio using your Active Directory credentials.  This, combined with updated PowerShell scripts that also support Active Directory, enables an end-to-end enterprise authentication story with Windows Azure. Below are some details on how all of this works: Subscriptions within a Directory As part of today’s update, we have associated all existing Window Azure accounts with a Windows Azure Active Directory (and created one for you if you don’t already have one). When you login to the Windows Azure Management Portal you’ll now see the directory name in the URI of the browser.  For example, in the screen-shot below you can see that I have a “scottgu” directory that my subscriptions are hosted within: Note that you can continue to use Microsoft Accounts (formerly known as Microsoft Live IDs) to sign-into Windows Azure.  These map just fine to a Windows Azure Active Directory – so there is no need to create new usernames that are specific to a directory if you don’t want to.  In the scenario above I’m actually logged in using my @hotmail.com based Microsoft ID which is now mapped to a “scottgu” active directory that was created for me.  By default everything will continue to work just like you used to before. Manage your Directory You can manage an Active Directory (including the one we now create for you by default) by clicking the “Active Directory” tab in the left-hand side of the portal.  This will list all of the directories in your account.  Clicking one the first time will display a getting started page that provides documentation and links to perform common tasks with it: You can use the built-in directory management support within the Windows Azure Management Portal to add/remove/manage users within the directory, enable multi-factor authentication, associate a custom domain (e.g. mycompanyname.com) with the directory, and/or rename the directory to whatever friendly name you want (just click the configure tab to do this).  You can also setup the directory to automatically sync with an on-premises Active Directory using the “Directory Integration” tab. Note that users within a directory by default do not have admin rights to login or manage Windows Azure based resources.  You still need to explicitly grant them co-admin permissions on a subscription for them to login or manage resources in Windows Azure.  You can do this by clicking the Settings tab on the left-hand side of the portal and then by clicking the administrators tab within it. Sign-In Integration within Visual Studio If you install the new Windows Azure SDK 2.2 release, you can now connect to Windows Azure from directly inside Visual Studio without having to download any management certificates.  You can now just right-click on the “Windows Azure” icon within the Server Explorer and choose the “Connect to Windows Azure” context menu option to do so: Doing this will prompt you to enter the email address of the username you wish to sign-in with (make sure this account is a user in your directory with co-admin rights on a subscription): You can use either a Microsoft Account (e.g. Windows Live ID) or an Active Directory based Organizational account as the email.  The dialog will update with an appropriate login prompt depending on which type of email address you enter: Once you sign-in you’ll see the Windows Azure resources that you have permissions to manage show up automatically within the Visual Studio server explorer and be available to start using: No downloading of management certificates required.  All of the authentication was handled using your Windows Azure Active Directory! Manage Subscriptions across Multiple Directories If you have already have multiple directories and multiple subscriptions within your Windows Azure account, we have done our best to create a good default mapping of your subscriptions->directories as part of today’s update.  If you don’t like the default subscription-to-directory mapping we have done you can click the Settings tab in the left-hand navigation of the Windows Azure Management Portal and browse to the Subscriptions tab within it: If you want to map a subscription under a different directory in your account, simply select the subscription from the list, and then click the “Edit Directory” button to choose which directory to map it to.  Mapping a subscription to a different directory takes only seconds and will not cause any of the resources within the subscription to recycle or stop working.  We’ve made the directory->subscription mapping process self-service so that you always have complete control and can map things however you want. Filtering By Directory and Subscription Within the Windows Azure Management Portal you can filter resources in the portal by subscription (allowing you to show/hide different subscriptions).  If you have subscriptions mapped to multiple directory tenants, we also now have a filter drop-down that allows you to filter the subscription list by directory tenant.  This filter is only available if you have multiple subscriptions mapped to multiple directories within your Windows Azure Account:   Windows Azure SDK 2.2 Today we are also releasing a major update of our Windows Azure SDK.  The Windows Azure SDK 2.2 release adds some great new features including: Visual Studio 2013 Support Integrated Windows Azure Sign-In support within Visual Studio Remote Debugging Cloud Services with Visual Studio Firewall Management support within Visual Studio for SQL Databases Visual Studio 2013 RTM VM Images for MSDN Subscribers Windows Azure Management Libraries for .NET Updated Windows Azure PowerShell Cmdlets and ScriptCenter I’ll post a follow-up blog shortly with more details about all of the above. Additional Updates In addition to the above enhancements, today’s release also includes a number of additional improvements: AutoScale: Richer time and date based scheduling support (set different rules on different dates) AutoScale: Ability to Scale to Zero Virtual Machines (very useful for Dev/Test scenarios) AutoScale: Support for time-based scheduling of Mobile Service AutoScale rules Operation Logs: Auditing support for Service Bus management operations Today we also shipped a major update to the Windows Azure SDK – Windows Azure SDK 2.2.  It has so much goodness in it that I have a whole second blog post coming shortly on it! :-) Summary Today’s Windows Azure release enables a bunch of great new scenarios, and enables a much richer enterprise authentication offering. If you don’t already have a Windows Azure account, you can sign-up for a free trial and start using all of the above features today.  Then visit the Windows Azure Developer Center to learn more about how to build apps with it. Hope this helps, Scott P.S. In addition to blogging, I am also now using Twitter for quick updates and to share links. Follow me at: twitter.com/scottgu

    Read the article

  • Using Durandal to Create Single Page Apps

    - by Stephen.Walther
    A few days ago, I gave a talk on building Single Page Apps on the Microsoft Stack. In that talk, I recommended that people use Knockout, Sammy, and RequireJS to build their presentation layer and use the ASP.NET Web API to expose data from their server. After I gave the talk, several people contacted me and suggested that I investigate a new open-source JavaScript library named Durandal. Durandal stitches together Knockout, Sammy, and RequireJS to make it easier to use these technologies together. In this blog entry, I want to provide a brief walkthrough of using Durandal to create a simple Single Page App. I am going to demonstrate how you can create a simple Movies App which contains (virtual) pages for viewing a list of movies, adding new movies, and viewing movie details. The goal of this blog entry is to give you a sense of what it is like to build apps with Durandal. Installing Durandal First things first. How do you get Durandal? The GitHub project for Durandal is located here: https://github.com/BlueSpire/Durandal The Wiki — located at the GitHub project — contains all of the current documentation for Durandal. Currently, the documentation is a little sparse, but it is enough to get you started. Instead of downloading the Durandal source from GitHub, a better option for getting started with Durandal is to install one of the Durandal NuGet packages. I built the Movies App described in this blog entry by first creating a new ASP.NET MVC 4 Web Application with the Basic Template. Next, I executed the following command from the Package Manager Console: Install-Package Durandal.StarterKit As you can see from the screenshot of the Package Manager Console above, the Durandal Starter Kit package has several dependencies including: · jQuery · Knockout · Sammy · Twitter Bootstrap The Durandal Starter Kit package includes a sample Durandal application. You can get to the Starter Kit app by navigating to the Durandal controller. Unfortunately, when I first tried to run the Starter Kit app, I got an error because the Starter Kit is hard-coded to use a particular version of jQuery which is already out of date. You can fix this issue by modifying the App_Start\DurandalBundleConfig.cs file so it is jQuery version agnostic like this: bundles.Add( new ScriptBundle("~/scripts/vendor") .Include("~/Scripts/jquery-{version}.js") .Include("~/Scripts/knockout-{version}.js") .Include("~/Scripts/sammy-{version}.js") // .Include("~/Scripts/jquery-1.9.0.min.js") // .Include("~/Scripts/knockout-2.2.1.js") // .Include("~/Scripts/sammy-0.7.4.min.js") .Include("~/Scripts/bootstrap.min.js") ); The recommendation is that you create a Durandal app in a folder off your project root named App. The App folder in the Starter Kit contains the following subfolders and files: · durandal – This folder contains the actual durandal JavaScript library. · viewmodels – This folder contains all of your application’s view models. · views – This folder contains all of your application’s views. · main.js — This file contains all of the JavaScript startup code for your app including the client-side routing configuration. · main-built.js – This file contains an optimized version of your application. You need to build this file by using the RequireJS optimizer (unfortunately, before you can run the optimizer, you must first install NodeJS). For the purpose of this blog entry, I wanted to start from scratch when building the Movies app, so I deleted all of these files and folders except for the durandal folder which contains the durandal library. Creating the ASP.NET MVC Controller and View A Durandal app is built using a single server-side ASP.NET MVC controller and ASP.NET MVC view. A Durandal app is a Single Page App. When you navigate between pages, you are not navigating to new pages on the server. Instead, you are loading new virtual pages into the one-and-only-one server-side view. For the Movies app, I created the following ASP.NET MVC Home controller: public class HomeController : Controller { public ActionResult Index() { return View(); } } There is nothing special about the Home controller – it is as basic as it gets. Next, I created the following server-side ASP.NET view. This is the one-and-only server-side view used by the Movies app: @{ Layout = null; } <!DOCTYPE html> <html> <head> <title>Index</title> </head> <body> <div id="applicationHost"> Loading app.... </div> @Scripts.Render("~/scripts/vendor") <script type="text/javascript" src="~/App/durandal/amd/require.js" data-main="/App/main"></script> </body> </html> Notice that I set the Layout property for the view to the value null. If you neglect to do this, then the default ASP.NET MVC layout will be applied to the view and you will get the <!DOCTYPE> and opening and closing <html> tags twice. Next, notice that the view contains a DIV element with the Id applicationHost. This marks the area where virtual pages are loaded. When you navigate from page to page in a Durandal app, HTML page fragments are retrieved from the server and stuck in the applicationHost DIV element. Inside the applicationHost element, you can place any content which you want to display when a Durandal app is starting up. For example, you can create a fancy splash screen. I opted for simply displaying the text “Loading app…”: Next, notice the view above includes a call to the Scripts.Render() helper. This helper renders out all of the JavaScript files required by the Durandal library such as jQuery and Knockout. Remember to fix the App_Start\DurandalBundleConfig.cs as described above or Durandal will attempt to load an old version of jQuery and throw a JavaScript exception and stop working. Your application JavaScript code is not included in the scripts rendered by the Scripts.Render helper. Your application code is loaded dynamically by RequireJS with the help of the following SCRIPT element located at the bottom of the view: <script type="text/javascript" src="~/App/durandal/amd/require.js" data-main="/App/main"></script> The data-main attribute on the SCRIPT element causes RequireJS to load your /app/main.js JavaScript file to kick-off your Durandal app. Creating the Durandal Main.js File The Durandal Main.js JavaScript file, located in your App folder, contains all of the code required to configure the behavior of Durandal. Here’s what the Main.js file looks like in the case of the Movies app: require.config({ paths: { 'text': 'durandal/amd/text' } }); define(function (require) { var app = require('durandal/app'), viewLocator = require('durandal/viewLocator'), system = require('durandal/system'), router = require('durandal/plugins/router'); //>>excludeStart("build", true); system.debug(true); //>>excludeEnd("build"); app.start().then(function () { //Replace 'viewmodels' in the moduleId with 'views' to locate the view. //Look for partial views in a 'views' folder in the root. viewLocator.useConvention(); //configure routing router.useConvention(); router.mapNav("movies/show"); router.mapNav("movies/add"); router.mapNav("movies/details/:id"); app.adaptToDevice(); //Show the app by setting the root view model for our application with a transition. app.setRoot('viewmodels/shell', 'entrance'); }); }); There are three important things to notice about the main.js file above. First, notice that it contains a section which enables debugging which looks like this: //>>excludeStart(“build”, true); system.debug(true); //>>excludeEnd(“build”); This code enables debugging for your Durandal app which is very useful when things go wrong. When you call system.debug(true), Durandal writes out debugging information to your browser JavaScript console. For example, you can use the debugging information to diagnose issues with your client-side routes: (The funny looking //> symbols around the system.debug() call are RequireJS optimizer pragmas). The main.js file is also the place where you configure your client-side routes. In the case of the Movies app, the main.js file is used to configure routes for three page: the movies show, add, and details pages. //configure routing router.useConvention(); router.mapNav("movies/show"); router.mapNav("movies/add"); router.mapNav("movies/details/:id");   The route for movie details includes a route parameter named id. Later, we will use the id parameter to lookup and display the details for the right movie. Finally, the main.js file above contains the following line of code: //Show the app by setting the root view model for our application with a transition. app.setRoot('viewmodels/shell', 'entrance'); This line of code causes Durandal to load up a JavaScript file named shell.js and an HTML fragment named shell.html. I’ll discuss the shell in the next section. Creating the Durandal Shell You can think of the Durandal shell as the layout or master page for a Durandal app. The shell is where you put all of the content which you want to remain constant as a user navigates from virtual page to virtual page. For example, the shell is a great place to put your website logo and navigation links. The Durandal shell is composed from two parts: a JavaScript file and an HTML file. Here’s what the HTML file looks like for the Movies app: <h1>Movies App</h1> <div class="container-fluid page-host"> <!--ko compose: { model: router.activeItem, //wiring the router afterCompose: router.afterCompose, //wiring the router transition:'entrance', //use the 'entrance' transition when switching views cacheViews:true //telling composition to keep views in the dom, and reuse them (only a good idea with singleton view models) }--><!--/ko--> </div> And here is what the JavaScript file looks like: define(function (require) { var router = require('durandal/plugins/router'); return { router: router, activate: function () { return router.activate('movies/show'); } }; }); The JavaScript file contains the view model for the shell. This view model returns the Durandal router so you can access the list of configured routes from your shell. Notice that the JavaScript file includes a function named activate(). This function loads the movies/show page as the first page in the Movies app. If you want to create a different default Durandal page, then pass the name of a different age to the router.activate() method. Creating the Movies Show Page Durandal pages are created out of a view model and a view. The view model contains all of the data and view logic required for the view. The view contains all of the HTML markup for rendering the view model. Let’s start with the movies show page. The movies show page displays a list of movies. The view model for the show page looks like this: define(function (require) { var moviesRepository = require("repositories/moviesRepository"); return { movies: ko.observable(), activate: function() { this.movies(moviesRepository.listMovies()); } }; }); You create a view model by defining a new RequireJS module (see http://requirejs.org). You create a RequireJS module by placing all of your JavaScript code into an anonymous function passed to the RequireJS define() method. A RequireJS module has two parts. You retrieve all of the modules which your module requires at the top of your module. The code above depends on another RequireJS module named repositories/moviesRepository. Next, you return the implementation of your module. The code above returns a JavaScript object which contains a property named movies and a method named activate. The activate() method is a magic method which Durandal calls whenever it activates your view model. Your view model is activated whenever you navigate to a page which uses it. In the code above, the activate() method is used to get the list of movies from the movies repository and assign the list to the view model movies property. The HTML for the movies show page looks like this: <table> <thead> <tr> <th>Title</th><th>Director</th> </tr> </thead> <tbody data-bind="foreach:movies"> <tr> <td data-bind="text:title"></td> <td data-bind="text:director"></td> <td><a data-bind="attr:{href:'#/movies/details/'+id}">Details</a></td> </tr> </tbody> </table> <a href="#/movies/add">Add Movie</a> Notice that this is an HTML fragment. This fragment will be stuffed into the page-host DIV element in the shell.html file which is stuffed, in turn, into the applicationHost DIV element in the server-side MVC view. The HTML markup above contains data-bind attributes used by Knockout to display the list of movies (To learn more about Knockout, visit http://knockoutjs.com). The list of movies from the view model is displayed in an HTML table. Notice that the page includes a link to a page for adding a new movie. The link uses the following URL which starts with a hash: #/movies/add. Because the link starts with a hash, clicking the link does not cause a request back to the server. Instead, you navigate to the movies/add page virtually. Creating the Movies Add Page The movies add page also consists of a view model and view. The add page enables you to add a new movie to the movie database. Here’s the view model for the add page: define(function (require) { var app = require('durandal/app'); var router = require('durandal/plugins/router'); var moviesRepository = require("repositories/moviesRepository"); return { movieToAdd: { title: ko.observable(), director: ko.observable() }, activate: function () { this.movieToAdd.title(""); this.movieToAdd.director(""); this._movieAdded = false; }, canDeactivate: function () { if (this._movieAdded == false) { return app.showMessage('Are you sure you want to leave this page?', 'Navigate', ['Yes', 'No']); } else { return true; } }, addMovie: function () { // Add movie to db moviesRepository.addMovie(ko.toJS(this.movieToAdd)); // flag new movie this._movieAdded = true; // return to list of movies router.navigateTo("#/movies/show"); } }; }); The view model contains one property named movieToAdd which is bound to the add movie form. The view model also has the following three methods: 1. activate() – This method is called by Durandal when you navigate to the add movie page. The activate() method resets the add movie form by clearing out the movie title and director properties. 2. canDeactivate() – This method is called by Durandal when you attempt to navigate away from the add movie page. If you return false then navigation is cancelled. 3. addMovie() – This method executes when the add movie form is submitted. This code adds the new movie to the movie repository. I really like the Durandal canDeactivate() method. In the code above, I use the canDeactivate() method to show a warning to a user if they navigate away from the add movie page – either by clicking the Cancel button or by hitting the browser back button – before submitting the add movie form: The view for the add movie page looks like this: <form data-bind="submit:addMovie"> <fieldset> <legend>Add Movie</legend> <div> <label> Title: <input data-bind="value:movieToAdd.title" required /> </label> </div> <div> <label> Director: <input data-bind="value:movieToAdd.director" required /> </label> </div> <div> <input type="submit" value="Add" /> <a href="#/movies/show">Cancel</a> </div> </fieldset> </form> I am using Knockout to bind the movieToAdd property from the view model to the INPUT elements of the HTML form. Notice that the FORM element includes a data-bind attribute which invokes the addMovie() method from the view model when the HTML form is submitted. Creating the Movies Details Page You navigate to the movies details Page by clicking the Details link which appears next to each movie in the movies show page: The Details links pass the movie ids to the details page: #/movies/details/0 #/movies/details/1 #/movies/details/2 Here’s what the view model for the movies details page looks like: define(function (require) { var router = require('durandal/plugins/router'); var moviesRepository = require("repositories/moviesRepository"); return { movieToShow: { title: ko.observable(), director: ko.observable() }, activate: function (context) { // Grab movie from repository var movie = moviesRepository.getMovie(context.id); // Add to view model this.movieToShow.title(movie.title); this.movieToShow.director(movie.director); } }; }); Notice that the view model activate() method accepts a parameter named context. You can take advantage of the context parameter to retrieve route parameters such as the movie Id. In the code above, the context.id property is used to retrieve the correct movie from the movie repository and the movie is assigned to a property named movieToShow exposed by the view model. The movie details view displays the movieToShow property by taking advantage of Knockout bindings: <div> <h2 data-bind="text:movieToShow.title"></h2> directed by <span data-bind="text:movieToShow.director"></span> </div> Summary The goal of this blog entry was to walkthrough building a simple Single Page App using Durandal and to get a feel for what it is like to use this library. I really like how Durandal stitches together Knockout, Sammy, and RequireJS and establishes patterns for using these libraries to build Single Page Apps. Having a standard pattern which developers on a team can use to build new pages is super valuable. Once you get the hang of it, using Durandal to create new virtual pages is dead simple. Just define a new route, view model, and view and you are done. I also appreciate the fact that Durandal did not attempt to re-invent the wheel and that Durandal leverages existing JavaScript libraries such as Knockout, RequireJS, and Sammy. These existing libraries are powerful libraries and I have already invested a considerable amount of time in learning how to use them. Durandal makes it easier to use these libraries together without losing any of their power. Durandal has some additional interesting features which I have not had a chance to play with yet. For example, you can use the RequireJS optimizer to combine and minify all of a Durandal app’s code. Also, Durandal supports a way to create custom widgets (client-side controls) by composing widgets from a controller and view. You can download the code for the Movies app by clicking the following link (this is a Visual Studio 2012 project): Durandal Movie App

    Read the article

  • Improving Partitioned Table Join Performance

    - by Paul White
    The query optimizer does not always choose an optimal strategy when joining partitioned tables. This post looks at an example, showing how a manual rewrite of the query can almost double performance, while reducing the memory grant to almost nothing. Test Data The two tables in this example use a common partitioning partition scheme. The partition function uses 41 equal-size partitions: CREATE PARTITION FUNCTION PFT (integer) AS RANGE RIGHT FOR VALUES ( 125000, 250000, 375000, 500000, 625000, 750000, 875000, 1000000, 1125000, 1250000, 1375000, 1500000, 1625000, 1750000, 1875000, 2000000, 2125000, 2250000, 2375000, 2500000, 2625000, 2750000, 2875000, 3000000, 3125000, 3250000, 3375000, 3500000, 3625000, 3750000, 3875000, 4000000, 4125000, 4250000, 4375000, 4500000, 4625000, 4750000, 4875000, 5000000 ); GO CREATE PARTITION SCHEME PST AS PARTITION PFT ALL TO ([PRIMARY]); There two tables are: CREATE TABLE dbo.T1 ( TID integer NOT NULL IDENTITY(0,1), Column1 integer NOT NULL, Padding binary(100) NOT NULL DEFAULT 0x,   CONSTRAINT PK_T1 PRIMARY KEY CLUSTERED (TID) ON PST (TID) );   CREATE TABLE dbo.T2 ( TID integer NOT NULL, Column1 integer NOT NULL, Padding binary(100) NOT NULL DEFAULT 0x,   CONSTRAINT PK_T2 PRIMARY KEY CLUSTERED (TID, Column1) ON PST (TID) ); The next script loads 5 million rows into T1 with a pseudo-random value between 1 and 5 for Column1. The table is partitioned on the IDENTITY column TID: INSERT dbo.T1 WITH (TABLOCKX) (Column1) SELECT (ABS(CHECKSUM(NEWID())) % 5) + 1 FROM dbo.Numbers AS N WHERE n BETWEEN 1 AND 5000000; In case you don’t already have an auxiliary table of numbers lying around, here’s a script to create one with 10 million rows: CREATE TABLE dbo.Numbers (n bigint PRIMARY KEY);   WITH L0 AS(SELECT 1 AS c UNION ALL SELECT 1), L1 AS(SELECT 1 AS c FROM L0 AS A CROSS JOIN L0 AS B), L2 AS(SELECT 1 AS c FROM L1 AS A CROSS JOIN L1 AS B), L3 AS(SELECT 1 AS c FROM L2 AS A CROSS JOIN L2 AS B), L4 AS(SELECT 1 AS c FROM L3 AS A CROSS JOIN L3 AS B), L5 AS(SELECT 1 AS c FROM L4 AS A CROSS JOIN L4 AS B), Nums AS(SELECT ROW_NUMBER() OVER (ORDER BY (SELECT NULL)) AS n FROM L5) INSERT dbo.Numbers WITH (TABLOCKX) SELECT TOP (10000000) n FROM Nums ORDER BY n OPTION (MAXDOP 1); Table T1 contains data like this: Next we load data into table T2. The relationship between the two tables is that table 2 contains ‘n’ rows for each row in table 1, where ‘n’ is determined by the value in Column1 of table T1. There is nothing particularly special about the data or distribution, by the way. INSERT dbo.T2 WITH (TABLOCKX) (TID, Column1) SELECT T.TID, N.n FROM dbo.T1 AS T JOIN dbo.Numbers AS N ON N.n >= 1 AND N.n <= T.Column1; Table T2 ends up containing about 15 million rows: The primary key for table T2 is a combination of TID and Column1. The data is partitioned according to the value in column TID alone. Partition Distribution The following query shows the number of rows in each partition of table T1: SELECT PartitionID = CA1.P, NumRows = COUNT_BIG(*) FROM dbo.T1 AS T CROSS APPLY (VALUES ($PARTITION.PFT(TID))) AS CA1 (P) GROUP BY CA1.P ORDER BY CA1.P; There are 40 partitions containing 125,000 rows (40 * 125k = 5m rows). The rightmost partition remains empty. The next query shows the distribution for table 2: SELECT PartitionID = CA1.P, NumRows = COUNT_BIG(*) FROM dbo.T2 AS T CROSS APPLY (VALUES ($PARTITION.PFT(TID))) AS CA1 (P) GROUP BY CA1.P ORDER BY CA1.P; There are roughly 375,000 rows in each partition (the rightmost partition is also empty): Ok, that’s the test data done. Test Query and Execution Plan The task is to count the rows resulting from joining tables 1 and 2 on the TID column: SET STATISTICS IO ON; DECLARE @s datetime2 = SYSUTCDATETIME();   SELECT COUNT_BIG(*) FROM dbo.T1 AS T1 JOIN dbo.T2 AS T2 ON T2.TID = T1.TID;   SELECT DATEDIFF(Millisecond, @s, SYSUTCDATETIME()); SET STATISTICS IO OFF; The optimizer chooses a plan using parallel hash join, and partial aggregation: The Plan Explorer plan tree view shows accurate cardinality estimates and an even distribution of rows across threads (click to enlarge the image): With a warm data cache, the STATISTICS IO output shows that no physical I/O was needed, and all 41 partitions were touched: Running the query without actual execution plan or STATISTICS IO information for maximum performance, the query returns in around 2600ms. Execution Plan Analysis The first step toward improving on the execution plan produced by the query optimizer is to understand how it works, at least in outline. The two parallel Clustered Index Scans use multiple threads to read rows from tables T1 and T2. Parallel scan uses a demand-based scheme where threads are given page(s) to scan from the table as needed. This arrangement has certain important advantages, but does result in an unpredictable distribution of rows amongst threads. The point is that multiple threads cooperate to scan the whole table, but it is impossible to predict which rows end up on which threads. For correct results from the parallel hash join, the execution plan has to ensure that rows from T1 and T2 that might join are processed on the same thread. For example, if a row from T1 with join key value ‘1234’ is placed in thread 5’s hash table, the execution plan must guarantee that any rows from T2 that also have join key value ‘1234’ probe thread 5’s hash table for matches. The way this guarantee is enforced in this parallel hash join plan is by repartitioning rows to threads after each parallel scan. The two repartitioning exchanges route rows to threads using a hash function over the hash join keys. The two repartitioning exchanges use the same hash function so rows from T1 and T2 with the same join key must end up on the same hash join thread. Expensive Exchanges This business of repartitioning rows between threads can be very expensive, especially if a large number of rows is involved. The execution plan selected by the optimizer moves 5 million rows through one repartitioning exchange and around 15 million across the other. As a first step toward removing these exchanges, consider the execution plan selected by the optimizer if we join just one partition from each table, disallowing parallelism: SELECT COUNT_BIG(*) FROM dbo.T1 AS T1 JOIN dbo.T2 AS T2 ON T2.TID = T1.TID WHERE $PARTITION.PFT(T1.TID) = 1 AND $PARTITION.PFT(T2.TID) = 1 OPTION (MAXDOP 1); The optimizer has chosen a (one-to-many) merge join instead of a hash join. The single-partition query completes in around 100ms. If everything scaled linearly, we would expect that extending this strategy to all 40 populated partitions would result in an execution time around 4000ms. Using parallelism could reduce that further, perhaps to be competitive with the parallel hash join chosen by the optimizer. This raises a question. If the most efficient way to join one partition from each of the tables is to use a merge join, why does the optimizer not choose a merge join for the full query? Forcing a Merge Join Let’s force the optimizer to use a merge join on the test query using a hint: SELECT COUNT_BIG(*) FROM dbo.T1 AS T1 JOIN dbo.T2 AS T2 ON T2.TID = T1.TID OPTION (MERGE JOIN); This is the execution plan selected by the optimizer: This plan results in the same number of logical reads reported previously, but instead of 2600ms the query takes 5000ms. The natural explanation for this drop in performance is that the merge join plan is only using a single thread, whereas the parallel hash join plan could use multiple threads. Parallel Merge Join We can get a parallel merge join plan using the same query hint as before, and adding trace flag 8649: SELECT COUNT_BIG(*) FROM dbo.T1 AS T1 JOIN dbo.T2 AS T2 ON T2.TID = T1.TID OPTION (MERGE JOIN, QUERYTRACEON 8649); The execution plan is: This looks promising. It uses a similar strategy to distribute work across threads as seen for the parallel hash join. In practice though, performance is disappointing. On a typical run, the parallel merge plan runs for around 8400ms; slower than the single-threaded merge join plan (5000ms) and much worse than the 2600ms for the parallel hash join. We seem to be going backwards! The logical reads for the parallel merge are still exactly the same as before, with no physical IOs. The cardinality estimates and thread distribution are also still very good (click to enlarge): A big clue to the reason for the poor performance is shown in the wait statistics (captured by Plan Explorer Pro): CXPACKET waits require careful interpretation, and are most often benign, but in this case excessive waiting occurs at the repartitioning exchanges. Unlike the parallel hash join, the repartitioning exchanges in this plan are order-preserving ‘merging’ exchanges (because merge join requires ordered inputs): Parallelism works best when threads can just grab any available unit of work and get on with processing it. Preserving order introduces inter-thread dependencies that can easily lead to significant waits occurring. In extreme cases, these dependencies can result in an intra-query deadlock, though the details of that will have to wait for another time to explore in detail. The potential for waits and deadlocks leads the query optimizer to cost parallel merge join relatively highly, especially as the degree of parallelism (DOP) increases. This high costing resulted in the optimizer choosing a serial merge join rather than parallel in this case. The test results certainly confirm its reasoning. Collocated Joins In SQL Server 2008 and later, the optimizer has another available strategy when joining tables that share a common partition scheme. This strategy is a collocated join, also known as as a per-partition join. It can be applied in both serial and parallel execution plans, though it is limited to 2-way joins in the current optimizer. Whether the optimizer chooses a collocated join or not depends on cost estimation. The primary benefits of a collocated join are that it eliminates an exchange and requires less memory, as we will see next. Costing and Plan Selection The query optimizer did consider a collocated join for our original query, but it was rejected on cost grounds. The parallel hash join with repartitioning exchanges appeared to be a cheaper option. There is no query hint to force a collocated join, so we have to mess with the costing framework to produce one for our test query. Pretending that IOs cost 50 times more than usual is enough to convince the optimizer to use collocated join with our test query: -- Pretend IOs are 50x cost temporarily DBCC SETIOWEIGHT(50);   -- Co-located hash join SELECT COUNT_BIG(*) FROM dbo.T1 AS T1 JOIN dbo.T2 AS T2 ON T2.TID = T1.TID OPTION (RECOMPILE);   -- Reset IO costing DBCC SETIOWEIGHT(1); Collocated Join Plan The estimated execution plan for the collocated join is: The Constant Scan contains one row for each partition of the shared partitioning scheme, from 1 to 41. The hash repartitioning exchanges seen previously are replaced by a single Distribute Streams exchange using Demand partitioning. Demand partitioning means that the next partition id is given to the next parallel thread that asks for one. My test machine has eight logical processors, and all are available for SQL Server to use. As a result, there are eight threads in the single parallel branch in this plan, each processing one partition from each table at a time. Once a thread finishes processing a partition, it grabs a new partition number from the Distribute Streams exchange…and so on until all partitions have been processed. It is important to understand that the parallel scans in this plan are different from the parallel hash join plan. Although the scans have the same parallelism icon, tables T1 and T2 are not being co-operatively scanned by multiple threads in the same way. Each thread reads a single partition of T1 and performs a hash match join with the same partition from table T2. The properties of the two Clustered Index Scans show a Seek Predicate (unusual for a scan!) limiting the rows to a single partition: The crucial point is that the join between T1 and T2 is on TID, and TID is the partitioning column for both tables. A thread that processes partition ‘n’ is guaranteed to see all rows that can possibly join on TID for that partition. In addition, no other thread will see rows from that partition, so this removes the need for repartitioning exchanges. CPU and Memory Efficiency Improvements The collocated join has removed two expensive repartitioning exchanges and added a single exchange processing 41 rows (one for each partition id). Remember, the parallel hash join plan exchanges had to process 5 million and 15 million rows. The amount of processor time spent on exchanges will be much lower in the collocated join plan. In addition, the collocated join plan has a maximum of 8 threads processing single partitions at any one time. The 41 partitions will all be processed eventually, but a new partition is not started until a thread asks for it. Threads can reuse hash table memory for the new partition. The parallel hash join plan also had 8 hash tables, but with all 5,000,000 build rows loaded at the same time. The collocated plan needs memory for only 8 * 125,000 = 1,000,000 rows at any one time. Collocated Hash Join Performance The collated join plan has disappointing performance in this case. The query runs for around 25,300ms despite the same IO statistics as usual. This is much the worst result so far, so what went wrong? It turns out that cardinality estimation for the single partition scans of table T1 is slightly low. The properties of the Clustered Index Scan of T1 (graphic immediately above) show the estimation was for 121,951 rows. This is a small shortfall compared with the 125,000 rows actually encountered, but it was enough to cause the hash join to spill to physical tempdb: A level 1 spill doesn’t sound too bad, until you realize that the spill to tempdb probably occurs for each of the 41 partitions. As a side note, the cardinality estimation error is a little surprising because the system tables accurately show there are 125,000 rows in every partition of T1. Unfortunately, the optimizer uses regular column and index statistics to derive cardinality estimates here rather than system table information (e.g. sys.partitions). Collocated Merge Join We will never know how well the collocated parallel hash join plan might have worked without the cardinality estimation error (and the resulting 41 spills to tempdb) but we do know: Merge join does not require a memory grant; and Merge join was the optimizer’s preferred join option for a single partition join Putting this all together, what we would really like to see is the same collocated join strategy, but using merge join instead of hash join. Unfortunately, the current query optimizer cannot produce a collocated merge join; it only knows how to do collocated hash join. So where does this leave us? CROSS APPLY sys.partitions We can try to write our own collocated join query. We can use sys.partitions to find the partition numbers, and CROSS APPLY to get a count per partition, with a final step to sum the partial counts. The following query implements this idea: SELECT row_count = SUM(Subtotals.cnt) FROM ( -- Partition numbers SELECT p.partition_number FROM sys.partitions AS p WHERE p.[object_id] = OBJECT_ID(N'T1', N'U') AND p.index_id = 1 ) AS P CROSS APPLY ( -- Count per collocated join SELECT cnt = COUNT_BIG(*) FROM dbo.T1 AS T1 JOIN dbo.T2 AS T2 ON T2.TID = T1.TID WHERE $PARTITION.PFT(T1.TID) = p.partition_number AND $PARTITION.PFT(T2.TID) = p.partition_number ) AS SubTotals; The estimated plan is: The cardinality estimates aren’t all that good here, especially the estimate for the scan of the system table underlying the sys.partitions view. Nevertheless, the plan shape is heading toward where we would like to be. Each partition number from the system table results in a per-partition scan of T1 and T2, a one-to-many Merge Join, and a Stream Aggregate to compute the partial counts. The final Stream Aggregate just sums the partial counts. Execution time for this query is around 3,500ms, with the same IO statistics as always. This compares favourably with 5,000ms for the serial plan produced by the optimizer with the OPTION (MERGE JOIN) hint. This is another case of the sum of the parts being less than the whole – summing 41 partial counts from 41 single-partition merge joins is faster than a single merge join and count over all partitions. Even so, this single-threaded collocated merge join is not as quick as the original parallel hash join plan, which executed in 2,600ms. On the positive side, our collocated merge join uses only one logical processor and requires no memory grant. The parallel hash join plan used 16 threads and reserved 569 MB of memory:   Using a Temporary Table Our collocated merge join plan should benefit from parallelism. The reason parallelism is not being used is that the query references a system table. We can work around that by writing the partition numbers to a temporary table (or table variable): SET STATISTICS IO ON; DECLARE @s datetime2 = SYSUTCDATETIME();   CREATE TABLE #P ( partition_number integer PRIMARY KEY);   INSERT #P (partition_number) SELECT p.partition_number FROM sys.partitions AS p WHERE p.[object_id] = OBJECT_ID(N'T1', N'U') AND p.index_id = 1;   SELECT row_count = SUM(Subtotals.cnt) FROM #P AS p CROSS APPLY ( SELECT cnt = COUNT_BIG(*) FROM dbo.T1 AS T1 JOIN dbo.T2 AS T2 ON T2.TID = T1.TID WHERE $PARTITION.PFT(T1.TID) = p.partition_number AND $PARTITION.PFT(T2.TID) = p.partition_number ) AS SubTotals;   DROP TABLE #P;   SELECT DATEDIFF(Millisecond, @s, SYSUTCDATETIME()); SET STATISTICS IO OFF; Using the temporary table adds a few logical reads, but the overall execution time is still around 3500ms, indistinguishable from the same query without the temporary table. The problem is that the query optimizer still doesn’t choose a parallel plan for this query, though the removal of the system table reference means that it could if it chose to: In fact the optimizer did enter the parallel plan phase of query optimization (running search 1 for a second time): Unfortunately, the parallel plan found seemed to be more expensive than the serial plan. This is a crazy result, caused by the optimizer’s cost model not reducing operator CPU costs on the inner side of a nested loops join. Don’t get me started on that, we’ll be here all night. In this plan, everything expensive happens on the inner side of a nested loops join. Without a CPU cost reduction to compensate for the added cost of exchange operators, candidate parallel plans always look more expensive to the optimizer than the equivalent serial plan. Parallel Collocated Merge Join We can produce the desired parallel plan using trace flag 8649 again: SELECT row_count = SUM(Subtotals.cnt) FROM #P AS p CROSS APPLY ( SELECT cnt = COUNT_BIG(*) FROM dbo.T1 AS T1 JOIN dbo.T2 AS T2 ON T2.TID = T1.TID WHERE $PARTITION.PFT(T1.TID) = p.partition_number AND $PARTITION.PFT(T2.TID) = p.partition_number ) AS SubTotals OPTION (QUERYTRACEON 8649); The actual execution plan is: One difference between this plan and the collocated hash join plan is that a Repartition Streams exchange operator is used instead of Distribute Streams. The effect is similar, though not quite identical. The Repartition uses round-robin partitioning, meaning the next partition id is pushed to the next thread in sequence. The Distribute Streams exchange seen earlier used Demand partitioning, meaning the next partition id is pulled across the exchange by the next thread that is ready for more work. There are subtle performance implications for each partitioning option, but going into that would again take us too far off the main point of this post. Performance The important thing is the performance of this parallel collocated merge join – just 1350ms on a typical run. The list below shows all the alternatives from this post (all timings include creation, population, and deletion of the temporary table where appropriate) from quickest to slowest: Collocated parallel merge join: 1350ms Parallel hash join: 2600ms Collocated serial merge join: 3500ms Serial merge join: 5000ms Parallel merge join: 8400ms Collated parallel hash join: 25,300ms (hash spill per partition) The parallel collocated merge join requires no memory grant (aside from a paltry 1.2MB used for exchange buffers). This plan uses 16 threads at DOP 8; but 8 of those are (rather pointlessly) allocated to the parallel scan of the temporary table. These are minor concerns, but it turns out there is a way to address them if it bothers you. Parallel Collocated Merge Join with Demand Partitioning This final tweak replaces the temporary table with a hard-coded list of partition ids (dynamic SQL could be used to generate this query from sys.partitions): SELECT row_count = SUM(Subtotals.cnt) FROM ( VALUES (1),(2),(3),(4),(5),(6),(7),(8),(9),(10), (11),(12),(13),(14),(15),(16),(17),(18),(19),(20), (21),(22),(23),(24),(25),(26),(27),(28),(29),(30), (31),(32),(33),(34),(35),(36),(37),(38),(39),(40),(41) ) AS P (partition_number) CROSS APPLY ( SELECT cnt = COUNT_BIG(*) FROM dbo.T1 AS T1 JOIN dbo.T2 AS T2 ON T2.TID = T1.TID WHERE $PARTITION.PFT(T1.TID) = p.partition_number AND $PARTITION.PFT(T2.TID) = p.partition_number ) AS SubTotals OPTION (QUERYTRACEON 8649); The actual execution plan is: The parallel collocated hash join plan is reproduced below for comparison: The manual rewrite has another advantage that has not been mentioned so far: the partial counts (per partition) can be computed earlier than the partial counts (per thread) in the optimizer’s collocated join plan. The earlier aggregation is performed by the extra Stream Aggregate under the nested loops join. The performance of the parallel collocated merge join is unchanged at around 1350ms. Final Words It is a shame that the current query optimizer does not consider a collocated merge join (Connect item closed as Won’t Fix). The example used in this post showed an improvement in execution time from 2600ms to 1350ms using a modestly-sized data set and limited parallelism. In addition, the memory requirement for the query was almost completely eliminated  – down from 569MB to 1.2MB. The problem with the parallel hash join selected by the optimizer is that it attempts to process the full data set all at once (albeit using eight threads). It requires a large memory grant to hold all 5 million rows from table T1 across the eight hash tables, and does not take advantage of the divide-and-conquer opportunity offered by the common partitioning. The great thing about the collocated join strategies is that each parallel thread works on a single partition from both tables, reading rows, performing the join, and computing a per-partition subtotal, before moving on to a new partition. From a thread’s point of view… If you have trouble visualizing what is happening from just looking at the parallel collocated merge join execution plan, let’s look at it again, but from the point of view of just one thread operating between the two Parallelism (exchange) operators. Our thread picks up a single partition id from the Distribute Streams exchange, and starts a merge join using ordered rows from partition 1 of table T1 and partition 1 of table T2. By definition, this is all happening on a single thread. As rows join, they are added to a (per-partition) count in the Stream Aggregate immediately above the Merge Join. Eventually, either T1 (partition 1) or T2 (partition 1) runs out of rows and the merge join stops. The per-partition count from the aggregate passes on through the Nested Loops join to another Stream Aggregate, which is maintaining a per-thread subtotal. Our same thread now picks up a new partition id from the exchange (say it gets id 9 this time). The count in the per-partition aggregate is reset to zero, and the processing of partition 9 of both tables proceeds just as it did for partition 1, and on the same thread. Each thread picks up a single partition id and processes all the data for that partition, completely independently from other threads working on other partitions. One thread might eventually process partitions (1, 9, 17, 25, 33, 41) while another is concurrently processing partitions (2, 10, 18, 26, 34) and so on for the other six threads at DOP 8. The point is that all 8 threads can execute independently and concurrently, continuing to process new partitions until the wider job (of which the thread has no knowledge!) is done. This divide-and-conquer technique can be much more efficient than simply splitting the entire workload across eight threads all at once. Related Reading Understanding and Using Parallelism in SQL Server Parallel Execution Plans Suck © 2013 Paul White – All Rights Reserved Twitter: @SQL_Kiwi

    Read the article

  • What Every Developer Should Know About MSI Components

    - by Alois Kraus
    Hopefully nothing. But if you have to do more than simple XCopy deployment and you need to support updates, upgrades and perhaps side by side scenarios there is no way around MSI. You can create Msi files with a Visual Studio Setup project which is severely limited or you can use the Windows Installer Toolset. I cannot talk about WIX with my German colleagues because WIX has a very special meaning. It is funny to always use the long name when I talk about deployment possibilities. Alternatively you can buy commercial tools which help you to author Msi files but I am not sure how good they are. Given enough pain with existing solutions you can also learn the MSI Apis and create your own packaging solution. If I were you I would use either a commercial visual tool when you do easy deployments or use the free Windows Installer Toolset. Once you know the WIX schema you can create well formed wix xml files easily with any editor. Then you can “compile” from the wxs files your Msi package. Recently I had the “pleasure” to get my hands dirty with C++ (again) and the MSI technology. Installation is a complex topic but after several month of digging into arcane MSI issues I can safely say that there should exist an easier way to install and update files as today. I am not alone with this statement as John Robbins (creator of the cool tool Paraffin) states: “.. It's a brittle and scary API in Windows …”. To help other people struggling with installation issues I present you the advice I (and others) found useful and what will happen if you ignore this advice. What is a MSI file? A MSI file is basically a database with tables which reference each other to control how your un/installation should work. The basic idea is that you declare via these tables what you want to install and MSI controls the how to get your stuff onto or off your machine. Your “stuff” consists usually of files, registry keys, shortcuts and environment variables. Therefore the most important tables are File, Registry, Environment and Shortcut table which define what will be un/installed. The key to master MSI is that every resource (file, registry key ,…) is associated with a MSI component. The actual payload consists of compressed files in the CAB format which can either be embedded into the MSI file or reside beside the MSI file or in a subdirectory below it. To examine MSI files you need Orca a free MSI editor provided by MS. There is also another free editor called Super Orca which does support diffs between MSI and it does not lock the MSI files. But since Orca comes with a shell extension I tend to use only Orca because it is so easy to right click on a MSI file and open it with this tool. How Do I Install It? Double click it. This does work for fresh installations as well as major upgrades. Updates need to be installed via the command line via msiexec /i <msi> REINSTALL=ALL REINSTALLMODE=vomus   This tells the installer to reinstall all already installed features (new features will NOT be installed). The reinstallmode letters do force an overwrite of the old cached package in the %WINDIR%\Installer folder. All files, shortcuts and registry keys are redeployed if they are missing or need to be replaced with a newer version. When things did go really wrong and you want to overwrite everything unconditionally use REINSTALLMODE=vamus. How To Enable MSI Logs? You can download a MSI from Microsoft which installs some registry keys to enable full MSI logging. The log files can be found in your %TEMP% folder and are called MSIxxxx.log. Alternatively you can add to your msiexec command line the option msiexec …. /l*vx <LogFileName> Personally I find it rather strange that * does not mean full logging. To really get all logs I need to add v and x which is documented in the msiexec help but I still find this behavior unintuitive. What are MSI components? The whole MSI logic is bound to the concept of MSI components. Nearly every msi table has a Component column which binds an installable resource to a component. Below are the screenshots of the FeatureComponents and Component table of an example MSI. The Feature table defines basically the feature hierarchy.  To find out what belongs to a feature you need to look at the FeatureComponents table where for each feature the components are listed which will be installed when a feature is installed. The MSI components are defined in the  Component table. This table has as first column the component name and as second column the component id which is a GUID. All resources you want to install belong to a MSI component. Therefore nearly all MSI tables have a Component_ column which contains the component name. If you look e.g. a the File table you see that every file belongs to a component which is true for all other tables which install resources. The component table is the glue between all other tables which contain the resources you want to install. So far so easy. Why is MSI then so complex? Most MSI problems arise from the fact that you did violate a MSI component rule in one or the other way. When you install a feature the reference count for all components belonging to this feature will increase by one. If your component is installed by more than one feature it will get a higher refcount. When you uninstall a feature its refcount will drop by one. Interesting things happen if the component reference count reaches zero: Then all associated resources will be deleted. That looks like a reasonable thing and it is. What it makes complex are the strange component rules you have to follow. Below are some important component rules from the Tao of the Windows Installer … Rule 16: Follow Component Rules Components are a very important part of the Installer technology. They are the means whereby the Installer manages the resources that make up your application. The SDK provides the following guidelines for creating components in your package: Never create two components that install a resource under the same name and target location. If a resource must be duplicated in multiple components, change its name or target location in each component. This rule should be applied across applications, products, product versions, and companies. Two components must not have the same key path file. This is a consequence of the previous rule. The key path value points to a particular file or folder belonging to the component that the installer uses to detect the component. If two components had the same key path file, the installer would be unable to distinguish which component is installed. Two components however may share a key path folder. Do not create a version of a component that is incompatible with all previous versions of the component. This rule should be applied across applications, products, product versions, and companies. Do not create components containing resources that will need to be installed into more than one directory on the user’s system. The installer installs all of the resources in a component into the same directory. It is not possible to install some resources into subdirectories. Do not include more than one COM server per component. If a component contains a COM server, this must be the key path for the component. Do not specify more than one file per component as a target for the Start menu or a Desktop shortcut. … And these rules do not even talk about component ids, update packages and upgrades which you need to understand as well. Lets suppose you install two MSIs (MSI1 and MSI2) which have the same ComponentId but different component names. Both do install the same file. What will happen when you uninstall MSI2?   Hm the file should stay there. But the component names are different. Yes and yes. But MSI uses not use the component name as key for the refcount. Instead the ComponentId column of the Component table which contains a GUID is used as identifier under which the refcount is stored. The components Comp1 and Comp2 are identical from the MSI perspective. After the installation of both MSIs the Component with the Id {100000….} has a refcount of two. After uninstallation of one MSI there is still a refcount of one which drops to zero just as expected when we uninstall the last msi. Then the file which was the same for both MSIs is deleted. You should remember that MSI keeps a refcount across MSIs for components with the same component id. MSI does manage components not the resources you did install. The resources associated with a component are then and only then deleted when the refcount of the component reaches zero.   The dependencies between features, components and resources can be described as relations. m,k are numbers >= 1, n can be 0. Inside a MSI the following relations are valid Feature    1  –> n Components Component    1 –> m Features Component      1  –>  k Resources These relations express that one feature can install several components and features can share components between them. Every (meaningful) component will install at least one resource which means that its name (primary key to stay in database speak) does occur in some other table in the Component column as value which installs some resource. Lets make it clear with an example. We want to install with the feature MainFeature some files a registry key and a shortcut. We can then create components Comp1..3 which are referenced by the resources defined in the corresponding tables.   Feature Component Registry File Shortcuts MainFeature Comp1 RegistryKey1     MainFeature Comp2   File.txt   MainFeature Comp3   File2.txt Shortcut to File2.txt   It is illegal that the same resource is part of more than one component since this would break the refcount mechanism. Lets illustrate this:            Feature ComponentId Resource Reference Count Feature1 {1000-…} File1.txt 1 Feature2 {2000-….} File1.txt 1 The installation part works well but what happens when you uninstall Feature2? Component {20000…} gets a refcount of zero where MSI deletes all resources belonging to this component. In this case File1.txt will be deleted. But Feature1 still has another component {10000…} with a refcount of one which means that the file was deleted too early. You just have ruined your installation. To fix it you then need to click on the Repair button under Add/Remove Programs to let MSI reinstall any missing registry keys, files or shortcuts. The vigilant reader might has noticed that there is more in the Component table. Beside its name and GUID it has also an installation directory, attributes and a KeyPath. The KeyPath is a reference to a file or registry key which is used to detect if the component is already installed. This becomes important when you repair or uninstall a component. To find out if the component is already installed MSI checks if the registry key or file referenced by the KeyPath property does exist. When it does not exist it assumes that it was either already uninstalled (can lead to problems during uninstall) or that it is already installed and all is fine. Why is this detail so important? Lets put all files into one component. The KeyPath should be then one of the files of your component to check if it was installed or not. When your installation becomes corrupt because a file was deleted you cannot repair it with the Repair button under Add/Remove Programs because MSI checks the component integrity via the Resource referenced by its KeyPath. As long as you did not delete the KeyPath file MSI thinks all resources with your component are installed and never executes any repair action. You get even more trouble when you try to remove files during an upgrade (you cannot remove files during an update) from your super component which contains all files. The only way out and therefore best practice is to assign for every resource you want to install an extra component. This ensures painless updatability and repairs and you have much less effort to remove specific files during an upgrade. In effect you get this best practice relation Feature 1  –> n Components Component   1  –>  1 Resources MSI Component Rules Rule 1 – One component per resource Every resource you want to install (file, registry key, value, environment value, shortcut, directory, …) must get its own component which does never change between versions as long as the install location is the same. Penalty If you add more than one resources to a component you will break the repair capability of MSI because the KeyPath is used to check if the component needs repair. MSI ComponentId Files MSI 1.0 {1000} File1-5 MSI 2.0 {2000} File2-5 You want to remove File1 in version 2.0 of your MSI. Since you want to keep the other files you create a new component and add them there. MSI will delete all files if the component refcount of {1000} drops to zero. The files you want to keep are added to the new component {2000}. Ok that does work if your upgrade does uninstall the old MSI first. This will cause the refcount of all previously installed components to reach zero which means that all files present in version 1.0 are deleted. But there is a faster way to perform your upgrade by first installing your new MSI and then remove the old one.  If you choose this upgrade path then you will loose File1-5 after your upgrade and not only File1 as intended by your new component design.   Rule 2 – Only add, never remove resources from a component If you did follow rule 1 you will not need Rule 2. You can add in a patch more resources to one component. That is ok. But you can never remove anything from it. There are tricky ways around that but I do not want to encourage bad component design. Penalty Lets assume you have 2 MSI files which install under the same component one file   MSI1 MSI2 {1000} - ComponentId {1000} – ComponentId File1.txt File2.txt   When you install and uninstall both MSIs you will end up with an installation where either File1 or File2 will be left. Why? It seems that MSI does not store the resources associated with each component in its internal database. Instead Windows will simply query the MSI that is currently uninstalled for all resources belonging to this component. Since it will find only one file and not two it will only uninstall one file. That is the main reason why you never can remove resources from a component!   Rule 3 Never Remove A Component From an Update MSI. This is the same as if you change the GUID of a component by accident for your new update package. The resulting update package will not contain all components from the previously installed package. Penalty When you remove a component from a feature MSI will set the feature state during update to Advertised and log a warning message into its log file when you did enable MSI logging. SELMGR: ComponentId '{2DCEA1BA-3E27-E222-484C-D0D66AEA4F62}' is registered to feature 'xxxxxxx, but is not present in the Component table.  Removal of components from a feature is not supported! MSI (c) (24:44) [07:53:13:436]: SELMGR: Removal of a component from a feature is not supported Advertised means that MSI treats all components of this feature as not installed. As a consequence during uninstall nothing will be removed since it is not installed! This is not only bad because uninstall does no longer work but this feature will also not get the required patches. All other features which have followed component versioning rules for update packages will be updated but the one faulty feature will not. This results in very hard to find bugs why an update was only partially successful. Things got better with Windows Installer 4.5 but you cannot rely on that nobody will use an older installer. It is a good idea to add to your update msiexec call MSIENFORCEUPGRADECOMPONENTRULES=1 which will abort the installation if you did violate this rule.

    Read the article

  • Basic Spatial Data with SQL Server and Entity Framework 5.0

    - by Rick Strahl
    In my most recent project we needed to do a bit of geo-spatial referencing. While spatial features have been in SQL Server for a while using those features inside of .NET applications hasn't been as straight forward as could be, because .NET natively doesn't support spatial types. There are workarounds for this with a few custom project like SharpMap or a hack using the Sql Server specific Geo types found in the Microsoft.SqlTypes assembly that ships with SQL server. While these approaches work for manipulating spatial data from .NET code, they didn't work with database access if you're using Entity Framework. Other ORM vendors have been rolling their own versions of spatial integration. In Entity Framework 5.0 running on .NET 4.5 the Microsoft ORM finally adds support for spatial types as well. In this post I'll describe basic geography features that deal with single location and distance calculations which is probably the most common usage scenario. SQL Server Transact-SQL Syntax for Spatial Data Before we look at how things work with Entity framework, lets take a look at how SQL Server allows you to use spatial data to get an understanding of the underlying semantics. The following SQL examples should work with SQL 2008 and forward. Let's start by creating a test table that includes a Geography field and also a pair of Long/Lat fields that demonstrate how you can work with the geography functions even if you don't have geography/geometry fields in the database. Here's the CREATE command:CREATE TABLE [dbo].[Geo]( [id] [int] IDENTITY(1,1) NOT NULL, [Location] [geography] NULL, [Long] [float] NOT NULL, [Lat] [float] NOT NULL ) Now using plain SQL you can insert data into the table using geography::STGeoFromText SQL CLR function:insert into Geo( Location , long, lat ) values ( geography::STGeomFromText ('POINT(-121.527200 45.712113)', 4326), -121.527200, 45.712113 ) insert into Geo( Location , long, lat ) values ( geography::STGeomFromText ('POINT(-121.517265 45.714240)', 4326), -121.517265, 45.714240 ) insert into Geo( Location , long, lat ) values ( geography::STGeomFromText ('POINT(-121.511536 45.714825)', 4326), -121.511536, 45.714825) The STGeomFromText function accepts a string that points to a geometric item (a point here but can also be a line or path or polygon and many others). You also need to provide an SRID (Spatial Reference System Identifier) which is an integer value that determines the rules for how geography/geometry values are calculated and returned. For mapping/distance functionality you typically want to use 4326 as this is the format used by most mapping software and geo-location libraries like Google and Bing. The spatial data in the Location field is stored in binary format which looks something like this: Once the location data is in the database you can query the data and do simple distance computations very easily. For example to calculate the distance of each of the values in the database to another spatial point is very easy to calculate. Distance calculations compare two points in space using a direct line calculation. For our example I'll compare a new point to all the points in the database. Using the Location field the SQL looks like this:-- create a source point DECLARE @s geography SET @s = geography:: STGeomFromText('POINT(-121.527200 45.712113)' , 4326); --- return the ids select ID, Location as Geo , Location .ToString() as Point , @s.STDistance( Location) as distance from Geo order by distance The code defines a new point which is the base point to compare each of the values to. You can also compare values from the database directly, but typically you'll want to match a location to another location and determine the difference for which you can use the geography::STDistance function. This query produces the following output: The STDistance function returns the straight line distance between the passed in point and the point in the database field. The result for SRID 4326 is always in meters. Notice that the first value passed was the same point so the difference is 0. The other two points are two points here in town in Hood River a little ways away - 808 and 1256 meters respectively. Notice also that you can order the result by the resulting distance, which effectively gives you results that are ordered radially out from closer to further away. This is great for searches of points of interest near a central location (YOU typically!). These geolocation functions are also available to you if you don't use the Geography/Geometry types, but plain float values. It's a little more work, as each point has to be created in the query using the string syntax, but the following code doesn't use a geography field but produces the same result as the previous query.--- using float fields select ID, geography::STGeomFromText ('POINT(' + STR (long, 15,7 ) + ' ' + Str(lat ,15, 7) + ')' , 4326), geography::STGeomFromText ('POINT(' + STR (long, 15,7 ) + ' ' + Str(lat ,15, 7) + ')' , 4326). ToString(), @s.STDistance( geography::STGeomFromText ('POINT(' + STR(long ,15, 7) + ' ' + Str(lat ,15, 7) + ')' , 4326)) as distance from geo order by distance Spatial Data in the Entity Framework Prior to Entity Framework 5.0 on .NET 4.5 consuming of the data above required using stored procedures or raw SQL commands to access the spatial data. In Entity Framework 5 however, Microsoft introduced the new DbGeometry and DbGeography types. These immutable location types provide a bunch of functionality for manipulating spatial points using geometry functions which in turn can be used to do common spatial queries like I described in the SQL syntax above. The DbGeography/DbGeometry types are immutable, meaning that you can't write to them once they've been created. They are a bit odd in that you need to use factory methods in order to instantiate them - they have no constructor() and you can't assign to properties like Latitude and Longitude. Creating a Model with Spatial Data Let's start by creating a simple Entity Framework model that includes a Location property of type DbGeography: public class GeoLocationContext : DbContext { public DbSet<GeoLocation> Locations { get; set; } } public class GeoLocation { public int Id { get; set; } public DbGeography Location { get; set; } public string Address { get; set; } } That's all there's to it. When you run this now against SQL Server, you get a Geography field for the Location property, which looks the same as the Location field in the SQL examples earlier. Adding Spatial Data to the Database Next let's add some data to the table that includes some latitude and longitude data. An easy way to find lat/long locations is to use Google Maps to pinpoint your location, then right click and click on What's Here. Click on the green marker to get the GPS coordinates. To add the actual geolocation data create an instance of the GeoLocation type and use the DbGeography.PointFromText() factory method to create a new point to assign to the Location property:[TestMethod] public void AddLocationsToDataBase() { var context = new GeoLocationContext(); // remove all context.Locations.ToList().ForEach( loc => context.Locations.Remove(loc)); context.SaveChanges(); var location = new GeoLocation() { // Create a point using native DbGeography Factory method Location = DbGeography.PointFromText( string.Format("POINT({0} {1})", -121.527200,45.712113) ,4326), Address = "301 15th Street, Hood River" }; context.Locations.Add(location); location = new GeoLocation() { Location = CreatePoint(45.714240, -121.517265), Address = "The Hatchery, Bingen" }; context.Locations.Add(location); location = new GeoLocation() { // Create a point using a helper function (lat/long) Location = CreatePoint(45.708457, -121.514432), Address = "Kaze Sushi, Hood River" }; context.Locations.Add(location); location = new GeoLocation() { Location = CreatePoint(45.722780, -120.209227), Address = "Arlington, OR" }; context.Locations.Add(location); context.SaveChanges(); } As promised, a DbGeography object has to be created with one of the static factory methods provided on the type as the Location.Longitude and Location.Latitude properties are read only. Here I'm using PointFromText() which uses a "Well Known Text" format to specify spatial data. In the first example I'm specifying to create a Point from a longitude and latitude value, using an SRID of 4326 (just like earlier in the SQL examples). You'll probably want to create a helper method to make the creation of Points easier to avoid that string format and instead just pass in a couple of double values. Here's my helper called CreatePoint that's used for all but the first point creation in the sample above:public static DbGeography CreatePoint(double latitude, double longitude) { var text = string.Format(CultureInfo.InvariantCulture.NumberFormat, "POINT({0} {1})", longitude, latitude); // 4326 is most common coordinate system used by GPS/Maps return DbGeography.PointFromText(text, 4326); } Using the helper the syntax becomes a bit cleaner, requiring only a latitude and longitude respectively. Note that my method intentionally swaps the parameters around because Latitude and Longitude is the common format I've seen with mapping libraries (especially Google Mapping/Geolocation APIs with their LatLng type). When the context is changed the data is written into the database using the SQL Geography type which looks the same as in the earlier SQL examples shown. Querying Once you have some location data in the database it's now super easy to query the data and find out the distance between locations. A common query is to ask for a number of locations that are near a fixed point - typically your current location and order it by distance. Using LINQ to Entities a query like this is easy to construct:[TestMethod] public void QueryLocationsTest() { var sourcePoint = CreatePoint(45.712113, -121.527200); var context = new GeoLocationContext(); // find any locations within 5 kilometers ordered by distance var matches = context.Locations .Where(loc => loc.Location.Distance(sourcePoint) < 5000) .OrderBy( loc=> loc.Location.Distance(sourcePoint) ) .Select( loc=> new { Address = loc.Address, Distance = loc.Location.Distance(sourcePoint) }); Assert.IsTrue(matches.Count() > 0); foreach (var location in matches) { Console.WriteLine("{0} ({1:n0} meters)", location.Address, location.Distance); } } This example produces: 301 15th Street, Hood River (0 meters)The Hatchery, Bingen (809 meters)Kaze Sushi, Hood River (1,074 meters)   The first point in the database is the same as my source point I'm comparing against so the distance is 0. The other two are within the 5 mile radius, while the Arlington location which is 65 miles or so out is not returned. The result is ordered by distance from closest to furthest away. In the code, I first create a source point that is the basis for comparison. The LINQ query then selects all locations that are within 5km of the source point using the Location.Distance() function, which takes a source point as a parameter. You can either use a pre-defined value as I'm doing here, or compare against another database DbGeography property (say when you have to points in the same database for things like routes). What's nice about this query syntax is that it's very clean and easy to read and understand. You can calculate the distance and also easily order by the distance to provide a result that shows locations from closest to furthest away which is a common scenario for any application that places a user in the context of several locations. It's now super easy to accomplish this. Meters vs. Miles As with the SQL Server functions, the Distance() method returns data in meters, so if you need to work with miles or feet you need to do some conversion. Here are a couple of helpers that might be useful (can be found in GeoUtils.cs of the sample project):/// <summary> /// Convert meters to miles /// </summary> /// <param name="meters"></param> /// <returns></returns> public static double MetersToMiles(double? meters) { if (meters == null) return 0F; return meters.Value * 0.000621371192; } /// <summary> /// Convert miles to meters /// </summary> /// <param name="miles"></param> /// <returns></returns> public static double MilesToMeters(double? miles) { if (miles == null) return 0; return miles.Value * 1609.344; } Using these two helpers you can query on miles like this:[TestMethod] public void QueryLocationsMilesTest() { var sourcePoint = CreatePoint(45.712113, -121.527200); var context = new GeoLocationContext(); // find any locations within 5 miles ordered by distance var fiveMiles = GeoUtils.MilesToMeters(5); var matches = context.Locations .Where(loc => loc.Location.Distance(sourcePoint) <= fiveMiles) .OrderBy(loc => loc.Location.Distance(sourcePoint)) .Select(loc => new { Address = loc.Address, Distance = loc.Location.Distance(sourcePoint) }); Assert.IsTrue(matches.Count() > 0); foreach (var location in matches) { Console.WriteLine("{0} ({1:n1} miles)", location.Address, GeoUtils.MetersToMiles(location.Distance)); } } which produces: 301 15th Street, Hood River (0.0 miles)The Hatchery, Bingen (0.5 miles)Kaze Sushi, Hood River (0.7 miles) Nice 'n simple. .NET 4.5 Only Note that DbGeography and DbGeometry are exclusive to Entity Framework 5.0 (not 4.4 which ships in the same NuGet package or installer) and requires .NET 4.5. That's because the new DbGeometry and DbGeography (and related) types are defined in the 4.5 version of System.Data.Entity which is a CLR assembly and is only updated by major versions of .NET. Why this decision was made to add these types to System.Data.Entity rather than to the frequently updated EntityFramework assembly that would have possibly made this work in .NET 4.0 is beyond me, especially given that there are no native .NET framework spatial types to begin with. I find it also odd that there is no native CLR spatial type. The DbGeography and DbGeometry types are specific to Entity Framework and live on those assemblies. They will also work for general purpose, non-database spatial data manipulation, but then you are forced into having a dependency on System.Data.Entity, which seems a bit silly. There's also a System.Spatial assembly that's apparently part of WCF Data Services which in turn don't work with Entity framework. Another example of multiple teams at Microsoft not communicating and implementing the same functionality (differently) in several different places. Perplexed as a I may be, for EF specific code the Entity framework specific types are easy to use and work well. Working with pre-.NET 4.5 Entity Framework and Spatial Data If you can't go to .NET 4.5 just yet you can also still use spatial features in Entity Framework, but it's a lot more work as you can't use the DbContext directly to manipulate the location data. You can still run raw SQL statements to write data into the database and retrieve results using the same TSQL syntax I showed earlier using Context.Database.ExecuteSqlCommand(). Here's code that you can use to add location data into the database:[TestMethod] public void RawSqlEfAddTest() { string sqlFormat = @"insert into GeoLocations( Location, Address) values ( geography::STGeomFromText('POINT({0} {1})', 4326),@p0 )"; var sql = string.Format(sqlFormat,-121.527200, 45.712113); Console.WriteLine(sql); var context = new GeoLocationContext(); Assert.IsTrue(context.Database.ExecuteSqlCommand(sql,"301 N. 15th Street") > 0); } Here I'm using the STGeomFromText() function to add the location data. Note that I'm using string.Format here, which usually would be a bad practice but is required here. I was unable to use ExecuteSqlCommand() and its named parameter syntax as the longitude and latitude parameters are embedded into a string. Rest assured it's required as the following does not work:string sqlFormat = @"insert into GeoLocations( Location, Address) values ( geography::STGeomFromText('POINT(@p0 @p1)', 4326),@p2 )";context.Database.ExecuteSqlCommand(sql, -121.527200, 45.712113, "301 N. 15th Street") Explicitly assigning the point value with string.format works however. There are a number of ways to query location data. You can't get the location data directly, but you can retrieve the point string (which can then be parsed to get Latitude and Longitude) and you can return calculated values like distance. Here's an example of how to retrieve some geo data into a resultset using EF's and SqlQuery method:[TestMethod] public void RawSqlEfQueryTest() { var sqlFormat = @" DECLARE @s geography SET @s = geography:: STGeomFromText('POINT({0} {1})' , 4326); SELECT Address, Location.ToString() as GeoString, @s.STDistance( Location) as Distance FROM GeoLocations ORDER BY Distance"; var sql = string.Format(sqlFormat, -121.527200, 45.712113); var context = new GeoLocationContext(); var locations = context.Database.SqlQuery<ResultData>(sql); Assert.IsTrue(locations.Count() > 0); foreach (var location in locations) { Console.WriteLine(location.Address + " " + location.GeoString + " " + location.Distance); } } public class ResultData { public string GeoString { get; set; } public double Distance { get; set; } public string Address { get; set; } } Hopefully you don't have to resort to this approach as it's fairly limited. Using the new DbGeography/DbGeometry types makes this sort of thing so much easier. When I had to use code like this before I typically ended up retrieving data pks only and then running another query with just the PKs to retrieve the actual underlying DbContext entities. This was very inefficient and tedious but it did work. Summary For the current project I'm working on we actually made the switch to .NET 4.5 purely for the spatial features in EF 5.0. This app heavily relies on spatial queries and it was worth taking a chance with pre-release code to get this ease of integration as opposed to manually falling back to stored procedures or raw SQL string queries to return spatial specific queries. Using native Entity Framework code makes life a lot easier than the alternatives. It might be a late addition to Entity Framework, but it sure makes location calculations and storage easy. Where do you want to go today? ;-) Resources Download Sample Project© Rick Strahl, West Wind Technologies, 2005-2012Posted in ADO.NET  Sql Server  .NET   Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs"); (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

    Read the article

  • Advanced TSQL Tuning: Why Internals Knowledge Matters

    - by Paul White
    There is much more to query tuning than reducing logical reads and adding covering nonclustered indexes.  Query tuning is not complete as soon as the query returns results quickly in the development or test environments.  In production, your query will compete for memory, CPU, locks, I/O and other resources on the server.  Today’s entry looks at some tuning considerations that are often overlooked, and shows how deep internals knowledge can help you write better TSQL. As always, we’ll need some example data.  In fact, we are going to use three tables today, each of which is structured like this: Each table has 50,000 rows made up of an INTEGER id column and a padding column containing 3,999 characters in every row.  The only difference between the three tables is in the type of the padding column: the first table uses CHAR(3999), the second uses VARCHAR(MAX), and the third uses the deprecated TEXT type.  A script to create a database with the three tables and load the sample data follows: USE master; GO IF DB_ID('SortTest') IS NOT NULL DROP DATABASE SortTest; GO CREATE DATABASE SortTest COLLATE LATIN1_GENERAL_BIN; GO ALTER DATABASE SortTest MODIFY FILE ( NAME = 'SortTest', SIZE = 3GB, MAXSIZE = 3GB ); GO ALTER DATABASE SortTest MODIFY FILE ( NAME = 'SortTest_log', SIZE = 256MB, MAXSIZE = 1GB, FILEGROWTH = 128MB ); GO ALTER DATABASE SortTest SET ALLOW_SNAPSHOT_ISOLATION OFF ; ALTER DATABASE SortTest SET AUTO_CLOSE OFF ; ALTER DATABASE SortTest SET AUTO_CREATE_STATISTICS ON ; ALTER DATABASE SortTest SET AUTO_SHRINK OFF ; ALTER DATABASE SortTest SET AUTO_UPDATE_STATISTICS ON ; ALTER DATABASE SortTest SET AUTO_UPDATE_STATISTICS_ASYNC ON ; ALTER DATABASE SortTest SET PARAMETERIZATION SIMPLE ; ALTER DATABASE SortTest SET READ_COMMITTED_SNAPSHOT OFF ; ALTER DATABASE SortTest SET MULTI_USER ; ALTER DATABASE SortTest SET RECOVERY SIMPLE ; USE SortTest; GO CREATE TABLE dbo.TestCHAR ( id INTEGER IDENTITY (1,1) NOT NULL, padding CHAR(3999) NOT NULL,   CONSTRAINT [PK dbo.TestCHAR (id)] PRIMARY KEY CLUSTERED (id), ) ; CREATE TABLE dbo.TestMAX ( id INTEGER IDENTITY (1,1) NOT NULL, padding VARCHAR(MAX) NOT NULL,   CONSTRAINT [PK dbo.TestMAX (id)] PRIMARY KEY CLUSTERED (id), ) ; CREATE TABLE dbo.TestTEXT ( id INTEGER IDENTITY (1,1) NOT NULL, padding TEXT NOT NULL,   CONSTRAINT [PK dbo.TestTEXT (id)] PRIMARY KEY CLUSTERED (id), ) ; -- ============= -- Load TestCHAR (about 3s) -- ============= INSERT INTO dbo.TestCHAR WITH (TABLOCKX) ( padding ) SELECT padding = REPLICATE(CHAR(65 + (Data.n % 26)), 3999) FROM ( SELECT TOP (50000) n = ROW_NUMBER() OVER (ORDER BY (SELECT 0)) - 1 FROM master.sys.columns C1, master.sys.columns C2, master.sys.columns C3 ORDER BY n ASC ) AS Data ORDER BY Data.n ASC ; -- ============ -- Load TestMAX (about 3s) -- ============ INSERT INTO dbo.TestMAX WITH (TABLOCKX) ( padding ) SELECT CONVERT(VARCHAR(MAX), padding) FROM dbo.TestCHAR ORDER BY id ; -- ============= -- Load TestTEXT (about 5s) -- ============= INSERT INTO dbo.TestTEXT WITH (TABLOCKX) ( padding ) SELECT CONVERT(TEXT, padding) FROM dbo.TestCHAR ORDER BY id ; -- ========== -- Space used -- ========== -- EXECUTE sys.sp_spaceused @objname = 'dbo.TestCHAR'; EXECUTE sys.sp_spaceused @objname = 'dbo.TestMAX'; EXECUTE sys.sp_spaceused @objname = 'dbo.TestTEXT'; ; CHECKPOINT ; That takes around 15 seconds to run, and shows the space allocated to each table in its output: To illustrate the points I want to make today, the example task we are going to set ourselves is to return a random set of 150 rows from each table.  The basic shape of the test query is the same for each of the three test tables: SELECT TOP (150) T.id, T.padding FROM dbo.Test AS T ORDER BY NEWID() OPTION (MAXDOP 1) ; Test 1 – CHAR(3999) Running the template query shown above using the TestCHAR table as the target, we find that the query takes around 5 seconds to return its results.  This seems slow, considering that the table only has 50,000 rows.  Working on the assumption that generating a GUID for each row is a CPU-intensive operation, we might try enabling parallelism to see if that speeds up the response time.  Running the query again (but without the MAXDOP 1 hint) on a machine with eight logical processors, the query now takes 10 seconds to execute – twice as long as when run serially. Rather than attempting further guesses at the cause of the slowness, let’s go back to serial execution and add some monitoring.  The script below monitors STATISTICS IO output and the amount of tempdb used by the test query.  We will also run a Profiler trace to capture any warnings generated during query execution. DECLARE @read BIGINT, @write BIGINT ; SELECT @read = SUM(num_of_bytes_read), @write = SUM(num_of_bytes_written) FROM tempdb.sys.database_files AS DBF JOIN sys.dm_io_virtual_file_stats(2, NULL) AS FS ON FS.file_id = DBF.file_id WHERE DBF.type_desc = 'ROWS' ; SET STATISTICS IO ON ; SELECT TOP (150) TC.id, TC.padding FROM dbo.TestCHAR AS TC ORDER BY NEWID() OPTION (MAXDOP 1) ; SET STATISTICS IO OFF ; SELECT tempdb_read_MB = (SUM(num_of_bytes_read) - @read) / 1024. / 1024., tempdb_write_MB = (SUM(num_of_bytes_written) - @write) / 1024. / 1024., internal_use_MB = ( SELECT internal_objects_alloc_page_count / 128.0 FROM sys.dm_db_task_space_usage WHERE session_id = @@SPID ) FROM tempdb.sys.database_files AS DBF JOIN sys.dm_io_virtual_file_stats(2, NULL) AS FS ON FS.file_id = DBF.file_id WHERE DBF.type_desc = 'ROWS' ; Let’s take a closer look at the statistics and query plan generated from this: Following the flow of the data from right to left, we see the expected 50,000 rows emerging from the Clustered Index Scan, with a total estimated size of around 191MB.  The Compute Scalar adds a column containing a random GUID (generated from the NEWID() function call) for each row.  With this extra column in place, the size of the data arriving at the Sort operator is estimated to be 192MB. Sort is a blocking operator – it has to examine all of the rows on its input before it can produce its first row of output (the last row received might sort first).  This characteristic means that Sort requires a memory grant – memory allocated for the query’s use by SQL Server just before execution starts.  In this case, the Sort is the only memory-consuming operator in the plan, so it has access to the full 243MB (248,696KB) of memory reserved by SQL Server for this query execution. Notice that the memory grant is significantly larger than the expected size of the data to be sorted.  SQL Server uses a number of techniques to speed up sorting, some of which sacrifice size for comparison speed.  Sorts typically require a very large number of comparisons, so this is usually a very effective optimization.  One of the drawbacks is that it is not possible to exactly predict the sort space needed, as it depends on the data itself.  SQL Server takes an educated guess based on data types, sizes, and the number of rows expected, but the algorithm is not perfect. In spite of the large memory grant, the Profiler trace shows a Sort Warning event (indicating that the sort ran out of memory), and the tempdb usage monitor shows that 195MB of tempdb space was used – all of that for system use.  The 195MB represents physical write activity on tempdb, because SQL Server strictly enforces memory grants – a query cannot ‘cheat’ and effectively gain extra memory by spilling to tempdb pages that reside in memory.  Anyway, the key point here is that it takes a while to write 195MB to disk, and this is the main reason that the query takes 5 seconds overall. If you are wondering why using parallelism made the problem worse, consider that eight threads of execution result in eight concurrent partial sorts, each receiving one eighth of the memory grant.  The eight sorts all spilled to tempdb, resulting in inefficiencies as the spilled sorts competed for disk resources.  More importantly, there are specific problems at the point where the eight partial results are combined, but I’ll cover that in a future post. CHAR(3999) Performance Summary: 5 seconds elapsed time 243MB memory grant 195MB tempdb usage 192MB estimated sort set 25,043 logical reads Sort Warning Test 2 – VARCHAR(MAX) We’ll now run exactly the same test (with the additional monitoring) on the table using a VARCHAR(MAX) padding column: DECLARE @read BIGINT, @write BIGINT ; SELECT @read = SUM(num_of_bytes_read), @write = SUM(num_of_bytes_written) FROM tempdb.sys.database_files AS DBF JOIN sys.dm_io_virtual_file_stats(2, NULL) AS FS ON FS.file_id = DBF.file_id WHERE DBF.type_desc = 'ROWS' ; SET STATISTICS IO ON ; SELECT TOP (150) TM.id, TM.padding FROM dbo.TestMAX AS TM ORDER BY NEWID() OPTION (MAXDOP 1) ; SET STATISTICS IO OFF ; SELECT tempdb_read_MB = (SUM(num_of_bytes_read) - @read) / 1024. / 1024., tempdb_write_MB = (SUM(num_of_bytes_written) - @write) / 1024. / 1024., internal_use_MB = ( SELECT internal_objects_alloc_page_count / 128.0 FROM sys.dm_db_task_space_usage WHERE session_id = @@SPID ) FROM tempdb.sys.database_files AS DBF JOIN sys.dm_io_virtual_file_stats(2, NULL) AS FS ON FS.file_id = DBF.file_id WHERE DBF.type_desc = 'ROWS' ; This time the query takes around 8 seconds to complete (3 seconds longer than Test 1).  Notice that the estimated row and data sizes are very slightly larger, and the overall memory grant has also increased very slightly to 245MB.  The most marked difference is in the amount of tempdb space used – this query wrote almost 391MB of sort run data to the physical tempdb file.  Don’t draw any general conclusions about VARCHAR(MAX) versus CHAR from this – I chose the length of the data specifically to expose this edge case.  In most cases, VARCHAR(MAX) performs very similarly to CHAR – I just wanted to make test 2 a bit more exciting. MAX Performance Summary: 8 seconds elapsed time 245MB memory grant 391MB tempdb usage 193MB estimated sort set 25,043 logical reads Sort warning Test 3 – TEXT The same test again, but using the deprecated TEXT data type for the padding column: DECLARE @read BIGINT, @write BIGINT ; SELECT @read = SUM(num_of_bytes_read), @write = SUM(num_of_bytes_written) FROM tempdb.sys.database_files AS DBF JOIN sys.dm_io_virtual_file_stats(2, NULL) AS FS ON FS.file_id = DBF.file_id WHERE DBF.type_desc = 'ROWS' ; SET STATISTICS IO ON ; SELECT TOP (150) TT.id, TT.padding FROM dbo.TestTEXT AS TT ORDER BY NEWID() OPTION (MAXDOP 1, RECOMPILE) ; SET STATISTICS IO OFF ; SELECT tempdb_read_MB = (SUM(num_of_bytes_read) - @read) / 1024. / 1024., tempdb_write_MB = (SUM(num_of_bytes_written) - @write) / 1024. / 1024., internal_use_MB = ( SELECT internal_objects_alloc_page_count / 128.0 FROM sys.dm_db_task_space_usage WHERE session_id = @@SPID ) FROM tempdb.sys.database_files AS DBF JOIN sys.dm_io_virtual_file_stats(2, NULL) AS FS ON FS.file_id = DBF.file_id WHERE DBF.type_desc = 'ROWS' ; This time the query runs in 500ms.  If you look at the metrics we have been checking so far, it’s not hard to understand why: TEXT Performance Summary: 0.5 seconds elapsed time 9MB memory grant 5MB tempdb usage 5MB estimated sort set 207 logical reads 596 LOB logical reads Sort warning SQL Server’s memory grant algorithm still underestimates the memory needed to perform the sorting operation, but the size of the data to sort is so much smaller (5MB versus 193MB previously) that the spilled sort doesn’t matter very much.  Why is the data size so much smaller?  The query still produces the correct results – including the large amount of data held in the padding column – so what magic is being performed here? TEXT versus MAX Storage The answer lies in how columns of the TEXT data type are stored.  By default, TEXT data is stored off-row in separate LOB pages – which explains why this is the first query we have seen that records LOB logical reads in its STATISTICS IO output.  You may recall from my last post that LOB data leaves an in-row pointer to the separate storage structure holding the LOB data. SQL Server can see that the full LOB value is not required by the query plan until results are returned, so instead of passing the full LOB value down the plan from the Clustered Index Scan, it passes the small in-row structure instead.  SQL Server estimates that each row coming from the scan will be 79 bytes long – 11 bytes for row overhead, 4 bytes for the integer id column, and 64 bytes for the LOB pointer (in fact the pointer is rather smaller – usually 16 bytes – but the details of that don’t really matter right now). OK, so this query is much more efficient because it is sorting a very much smaller data set – SQL Server delays retrieving the LOB data itself until after the Sort starts producing its 150 rows.  The question that normally arises at this point is: Why doesn’t SQL Server use the same trick when the padding column is defined as VARCHAR(MAX)? The answer is connected with the fact that if the actual size of the VARCHAR(MAX) data is 8000 bytes or less, it is usually stored in-row in exactly the same way as for a VARCHAR(8000) column – MAX data only moves off-row into LOB storage when it exceeds 8000 bytes.  The default behaviour of the TEXT type is to be stored off-row by default, unless the ‘text in row’ table option is set suitably and there is room on the page.  There is an analogous (but opposite) setting to control the storage of MAX data – the ‘large value types out of row’ table option.  By enabling this option for a table, MAX data will be stored off-row (in a LOB structure) instead of in-row.  SQL Server Books Online has good coverage of both options in the topic In Row Data. The MAXOOR Table The essential difference, then, is that MAX defaults to in-row storage, and TEXT defaults to off-row (LOB) storage.  You might be thinking that we could get the same benefits seen for the TEXT data type by storing the VARCHAR(MAX) values off row – so let’s look at that option now.  This script creates a fourth table, with the VARCHAR(MAX) data stored off-row in LOB pages: CREATE TABLE dbo.TestMAXOOR ( id INTEGER IDENTITY (1,1) NOT NULL, padding VARCHAR(MAX) NOT NULL,   CONSTRAINT [PK dbo.TestMAXOOR (id)] PRIMARY KEY CLUSTERED (id), ) ; EXECUTE sys.sp_tableoption @TableNamePattern = N'dbo.TestMAXOOR', @OptionName = 'large value types out of row', @OptionValue = 'true' ; SELECT large_value_types_out_of_row FROM sys.tables WHERE [schema_id] = SCHEMA_ID(N'dbo') AND name = N'TestMAXOOR' ; INSERT INTO dbo.TestMAXOOR WITH (TABLOCKX) ( padding ) SELECT SPACE(0) FROM dbo.TestCHAR ORDER BY id ; UPDATE TM WITH (TABLOCK) SET padding.WRITE (TC.padding, NULL, NULL) FROM dbo.TestMAXOOR AS TM JOIN dbo.TestCHAR AS TC ON TC.id = TM.id ; EXECUTE sys.sp_spaceused @objname = 'dbo.TestMAXOOR' ; CHECKPOINT ; Test 4 – MAXOOR We can now re-run our test on the MAXOOR (MAX out of row) table: DECLARE @read BIGINT, @write BIGINT ; SELECT @read = SUM(num_of_bytes_read), @write = SUM(num_of_bytes_written) FROM tempdb.sys.database_files AS DBF JOIN sys.dm_io_virtual_file_stats(2, NULL) AS FS ON FS.file_id = DBF.file_id WHERE DBF.type_desc = 'ROWS' ; SET STATISTICS IO ON ; SELECT TOP (150) MO.id, MO.padding FROM dbo.TestMAXOOR AS MO ORDER BY NEWID() OPTION (MAXDOP 1, RECOMPILE) ; SET STATISTICS IO OFF ; SELECT tempdb_read_MB = (SUM(num_of_bytes_read) - @read) / 1024. / 1024., tempdb_write_MB = (SUM(num_of_bytes_written) - @write) / 1024. / 1024., internal_use_MB = ( SELECT internal_objects_alloc_page_count / 128.0 FROM sys.dm_db_task_space_usage WHERE session_id = @@SPID ) FROM tempdb.sys.database_files AS DBF JOIN sys.dm_io_virtual_file_stats(2, NULL) AS FS ON FS.file_id = DBF.file_id WHERE DBF.type_desc = 'ROWS' ; TEXT Performance Summary: 0.3 seconds elapsed time 245MB memory grant 0MB tempdb usage 193MB estimated sort set 207 logical reads 446 LOB logical reads No sort warning The query runs very quickly – slightly faster than Test 3, and without spilling the sort to tempdb (there is no sort warning in the trace, and the monitoring query shows zero tempdb usage by this query).  SQL Server is passing the in-row pointer structure down the plan and only looking up the LOB value on the output side of the sort. The Hidden Problem There is still a huge problem with this query though – it requires a 245MB memory grant.  No wonder the sort doesn’t spill to tempdb now – 245MB is about 20 times more memory than this query actually requires to sort 50,000 records containing LOB data pointers.  Notice that the estimated row and data sizes in the plan are the same as in test 2 (where the MAX data was stored in-row). The optimizer assumes that MAX data is stored in-row, regardless of the sp_tableoption setting ‘large value types out of row’.  Why?  Because this option is dynamic – changing it does not immediately force all MAX data in the table in-row or off-row, only when data is added or actually changed.  SQL Server does not keep statistics to show how much MAX or TEXT data is currently in-row, and how much is stored in LOB pages.  This is an annoying limitation, and one which I hope will be addressed in a future version of the product. So why should we worry about this?  Excessive memory grants reduce concurrency and may result in queries waiting on the RESOURCE_SEMAPHORE wait type while they wait for memory they do not need.  245MB is an awful lot of memory, especially on 32-bit versions where memory grants cannot use AWE-mapped memory.  Even on a 64-bit server with plenty of memory, do you really want a single query to consume 0.25GB of memory unnecessarily?  That’s 32,000 8KB pages that might be put to much better use. The Solution The answer is not to use the TEXT data type for the padding column.  That solution happens to have better performance characteristics for this specific query, but it still results in a spilled sort, and it is hard to recommend the use of a data type which is scheduled for removal.  I hope it is clear to you that the fundamental problem here is that SQL Server sorts the whole set arriving at a Sort operator.  Clearly, it is not efficient to sort the whole table in memory just to return 150 rows in a random order. The TEXT example was more efficient because it dramatically reduced the size of the set that needed to be sorted.  We can do the same thing by selecting 150 unique keys from the table at random (sorting by NEWID() for example) and only then retrieving the large padding column values for just the 150 rows we need.  The following script implements that idea for all four tables: SET STATISTICS IO ON ; WITH TestTable AS ( SELECT * FROM dbo.TestCHAR ), TopKeys AS ( SELECT TOP (150) id FROM TestTable ORDER BY NEWID() ) SELECT T1.id, T1.padding FROM TestTable AS T1 WHERE T1.id = ANY (SELECT id FROM TopKeys) OPTION (MAXDOP 1) ; WITH TestTable AS ( SELECT * FROM dbo.TestMAX ), TopKeys AS ( SELECT TOP (150) id FROM TestTable ORDER BY NEWID() ) SELECT T1.id, T1.padding FROM TestTable AS T1 WHERE T1.id IN (SELECT id FROM TopKeys) OPTION (MAXDOP 1) ; WITH TestTable AS ( SELECT * FROM dbo.TestTEXT ), TopKeys AS ( SELECT TOP (150) id FROM TestTable ORDER BY NEWID() ) SELECT T1.id, T1.padding FROM TestTable AS T1 WHERE T1.id IN (SELECT id FROM TopKeys) OPTION (MAXDOP 1) ; WITH TestTable AS ( SELECT * FROM dbo.TestMAXOOR ), TopKeys AS ( SELECT TOP (150) id FROM TestTable ORDER BY NEWID() ) SELECT T1.id, T1.padding FROM TestTable AS T1 WHERE T1.id IN (SELECT id FROM TopKeys) OPTION (MAXDOP 1) ; SET STATISTICS IO OFF ; All four queries now return results in much less than a second, with memory grants between 6 and 12MB, and without spilling to tempdb.  The small remaining inefficiency is in reading the id column values from the clustered primary key index.  As a clustered index, it contains all the in-row data at its leaf.  The CHAR and VARCHAR(MAX) tables store the padding column in-row, so id values are separated by a 3999-character column, plus row overhead.  The TEXT and MAXOOR tables store the padding values off-row, so id values in the clustered index leaf are separated by the much-smaller off-row pointer structure.  This difference is reflected in the number of logical page reads performed by the four queries: Table 'TestCHAR' logical reads 25511 lob logical reads 000 Table 'TestMAX'. logical reads 25511 lob logical reads 000 Table 'TestTEXT' logical reads 00412 lob logical reads 597 Table 'TestMAXOOR' logical reads 00413 lob logical reads 446 We can increase the density of the id values by creating a separate nonclustered index on the id column only.  This is the same key as the clustered index, of course, but the nonclustered index will not include the rest of the in-row column data. CREATE UNIQUE NONCLUSTERED INDEX uq1 ON dbo.TestCHAR (id); CREATE UNIQUE NONCLUSTERED INDEX uq1 ON dbo.TestMAX (id); CREATE UNIQUE NONCLUSTERED INDEX uq1 ON dbo.TestTEXT (id); CREATE UNIQUE NONCLUSTERED INDEX uq1 ON dbo.TestMAXOOR (id); The four queries can now use the very dense nonclustered index to quickly scan the id values, sort them by NEWID(), select the 150 ids we want, and then look up the padding data.  The logical reads with the new indexes in place are: Table 'TestCHAR' logical reads 835 lob logical reads 0 Table 'TestMAX' logical reads 835 lob logical reads 0 Table 'TestTEXT' logical reads 686 lob logical reads 597 Table 'TestMAXOOR' logical reads 686 lob logical reads 448 With the new index, all four queries use the same query plan (click to enlarge): Performance Summary: 0.3 seconds elapsed time 6MB memory grant 0MB tempdb usage 1MB sort set 835 logical reads (CHAR, MAX) 686 logical reads (TEXT, MAXOOR) 597 LOB logical reads (TEXT) 448 LOB logical reads (MAXOOR) No sort warning I’ll leave it as an exercise for the reader to work out why trying to eliminate the Key Lookup by adding the padding column to the new nonclustered indexes would be a daft idea Conclusion This post is not about tuning queries that access columns containing big strings.  It isn’t about the internal differences between TEXT and MAX data types either.  It isn’t even about the cool use of UPDATE .WRITE used in the MAXOOR table load.  No, this post is about something else: Many developers might not have tuned our starting example query at all – 5 seconds isn’t that bad, and the original query plan looks reasonable at first glance.  Perhaps the NEWID() function would have been blamed for ‘just being slow’ – who knows.  5 seconds isn’t awful – unless your users expect sub-second responses – but using 250MB of memory and writing 200MB to tempdb certainly is!  If ten sessions ran that query at the same time in production that’s 2.5GB of memory usage and 2GB hitting tempdb.  Of course, not all queries can be rewritten to avoid large memory grants and sort spills using the key-lookup technique in this post, but that’s not the point either. The point of this post is that a basic understanding of execution plans is not enough.  Tuning for logical reads and adding covering indexes is not enough.  If you want to produce high-quality, scalable TSQL that won’t get you paged as soon as it hits production, you need a deep understanding of execution plans, and as much accurate, deep knowledge about SQL Server as you can lay your hands on.  The advanced database developer has a wide range of tools to use in writing queries that perform well in a range of circumstances. By the way, the examples in this post were written for SQL Server 2008.  They will run on 2005 and demonstrate the same principles, but you won’t get the same figures I did because 2005 had a rather nasty bug in the Top N Sort operator.  Fair warning: if you do decide to run the scripts on a 2005 instance (particularly the parallel query) do it before you head out for lunch… This post is dedicated to the people of Christchurch, New Zealand. © 2011 Paul White email: @[email protected] twitter: @SQL_Kiwi

    Read the article

  • Understanding G1 GC Logs

    - by poonam
    The purpose of this post is to explain the meaning of GC logs generated with some tracing and diagnostic options for G1 GC. We will take a look at the output generated with PrintGCDetails which is a product flag and provides the most detailed level of information. Along with that, we will also look at the output of two diagnostic flags that get enabled with -XX:+UnlockDiagnosticVMOptions option - G1PrintRegionLivenessInfo that prints the occupancy and the amount of space used by live objects in each region at the end of the marking cycle and G1PrintHeapRegions that provides detailed information on the heap regions being allocated and reclaimed. We will be looking at the logs generated with JDK 1.7.0_04 using these options. Option -XX:+PrintGCDetails Here's a sample log of G1 collection generated with PrintGCDetails. 0.522: [GC pause (young), 0.15877971 secs] [Parallel Time: 157.1 ms] [GC Worker Start (ms): 522.1 522.2 522.2 522.2 Avg: 522.2, Min: 522.1, Max: 522.2, Diff: 0.1] [Ext Root Scanning (ms): 1.6 1.5 1.6 1.9 Avg: 1.7, Min: 1.5, Max: 1.9, Diff: 0.4] [Update RS (ms): 38.7 38.8 50.6 37.3 Avg: 41.3, Min: 37.3, Max: 50.6, Diff: 13.3] [Processed Buffers : 2 2 3 2 Sum: 9, Avg: 2, Min: 2, Max: 3, Diff: 1] [Scan RS (ms): 9.9 9.7 0.0 9.7 Avg: 7.3, Min: 0.0, Max: 9.9, Diff: 9.9] [Object Copy (ms): 106.7 106.8 104.6 107.9 Avg: 106.5, Min: 104.6, Max: 107.9, Diff: 3.3] [Termination (ms): 0.0 0.0 0.0 0.0 Avg: 0.0, Min: 0.0, Max: 0.0, Diff: 0.0] [Termination Attempts : 1 4 4 6 Sum: 15, Avg: 3, Min: 1, Max: 6, Diff: 5] [GC Worker End (ms): 679.1 679.1 679.1 679.1 Avg: 679.1, Min: 679.1, Max: 679.1, Diff: 0.1] [GC Worker (ms): 156.9 157.0 156.9 156.9 Avg: 156.9, Min: 156.9, Max: 157.0, Diff: 0.1] [GC Worker Other (ms): 0.3 0.3 0.3 0.3 Avg: 0.3, Min: 0.3, Max: 0.3, Diff: 0.0] [Clear CT: 0.1 ms] [Other: 1.5 ms] [Choose CSet: 0.0 ms] [Ref Proc: 0.3 ms] [Ref Enq: 0.0 ms] [Free CSet: 0.3 ms] [Eden: 12M(12M)->0B(10M) Survivors: 0B->2048K Heap: 13M(64M)->9739K(64M)] [Times: user=0.59 sys=0.02, real=0.16 secs] This is the typical log of an Evacuation Pause (G1 collection) in which live objects are copied from one set of regions (young OR young+old) to another set. It is a stop-the-world activity and all the application threads are stopped at a safepoint during this time. This pause is made up of several sub-tasks indicated by the indentation in the log entries. Here's is the top most line that gets printed for the Evacuation Pause. 0.522: [GC pause (young), 0.15877971 secs] This is the highest level information telling us that it is an Evacuation Pause that started at 0.522 secs from the start of the process, in which all the regions being evacuated are Young i.e. Eden and Survivor regions. This collection took 0.15877971 secs to finish. Evacuation Pauses can be mixed as well. In which case the set of regions selected include all of the young regions as well as some old regions. 1.730: [GC pause (mixed), 0.32714353 secs] Let's take a look at all the sub-tasks performed in this Evacuation Pause. [Parallel Time: 157.1 ms] Parallel Time is the total elapsed time spent by all the parallel GC worker threads. The following lines correspond to the parallel tasks performed by these worker threads in this total parallel time, which in this case is 157.1 ms. [GC Worker Start (ms): 522.1 522.2 522.2 522.2Avg: 522.2, Min: 522.1, Max: 522.2, Diff: 0.1] The first line tells us the start time of each of the worker thread in milliseconds. The start times are ordered with respect to the worker thread ids – thread 0 started at 522.1ms and thread 1 started at 522.2ms from the start of the process. The second line tells the Avg, Min, Max and Diff of the start times of all of the worker threads. [Ext Root Scanning (ms): 1.6 1.5 1.6 1.9 Avg: 1.7, Min: 1.5, Max: 1.9, Diff: 0.4] This gives us the time spent by each worker thread scanning the roots (globals, registers, thread stacks and VM data structures). Here, thread 0 took 1.6ms to perform the root scanning task and thread 1 took 1.5 ms. The second line clearly shows the Avg, Min, Max and Diff of the times spent by all the worker threads. [Update RS (ms): 38.7 38.8 50.6 37.3 Avg: 41.3, Min: 37.3, Max: 50.6, Diff: 13.3] Update RS gives us the time each thread spent in updating the Remembered Sets. Remembered Sets are the data structures that keep track of the references that point into a heap region. Mutator threads keep changing the object graph and thus the references that point into a particular region. We keep track of these changes in buffers called Update Buffers. The Update RS sub-task processes the update buffers that were not able to be processed concurrently, and updates the corresponding remembered sets of all regions. [Processed Buffers : 2 2 3 2Sum: 9, Avg: 2, Min: 2, Max: 3, Diff: 1] This tells us the number of Update Buffers (mentioned above) processed by each worker thread. [Scan RS (ms): 9.9 9.7 0.0 9.7 Avg: 7.3, Min: 0.0, Max: 9.9, Diff: 9.9] These are the times each worker thread had spent in scanning the Remembered Sets. Remembered Set of a region contains cards that correspond to the references pointing into that region. This phase scans those cards looking for the references pointing into all the regions of the collection set. [Object Copy (ms): 106.7 106.8 104.6 107.9 Avg: 106.5, Min: 104.6, Max: 107.9, Diff: 3.3] These are the times spent by each worker thread copying live objects from the regions in the Collection Set to the other regions. [Termination (ms): 0.0 0.0 0.0 0.0 Avg: 0.0, Min: 0.0, Max: 0.0, Diff: 0.0] Termination time is the time spent by the worker thread offering to terminate. But before terminating, it checks the work queues of other threads and if there are still object references in other work queues, it tries to steal object references, and if it succeeds in stealing a reference, it processes that and offers to terminate again. [Termination Attempts : 1 4 4 6 Sum: 15, Avg: 3, Min: 1, Max: 6, Diff: 5] This gives the number of times each thread has offered to terminate. [GC Worker End (ms): 679.1 679.1 679.1 679.1 Avg: 679.1, Min: 679.1, Max: 679.1, Diff: 0.1] These are the times in milliseconds at which each worker thread stopped. [GC Worker (ms): 156.9 157.0 156.9 156.9 Avg: 156.9, Min: 156.9, Max: 157.0, Diff: 0.1] These are the total lifetimes of each worker thread. [GC Worker Other (ms): 0.3 0.3 0.3 0.3Avg: 0.3, Min: 0.3, Max: 0.3, Diff: 0.0] These are the times that each worker thread spent in performing some other tasks that we have not accounted above for the total Parallel Time. [Clear CT: 0.1 ms] This is the time spent in clearing the Card Table. This task is performed in serial mode. [Other: 1.5 ms] Time spent in the some other tasks listed below. The following sub-tasks (which individually may be parallelized) are performed serially. [Choose CSet: 0.0 ms] Time spent in selecting the regions for the Collection Set. [Ref Proc: 0.3 ms] Total time spent in processing Reference objects. [Ref Enq: 0.0 ms] Time spent in enqueuing references to the ReferenceQueues. [Free CSet: 0.3 ms] Time spent in freeing the collection set data structure. [Eden: 12M(12M)->0B(13M) Survivors: 0B->2048K Heap: 14M(64M)->9739K(64M)] This line gives the details on the heap size changes with the Evacuation Pause. This shows that Eden had the occupancy of 12M and its capacity was also 12M before the collection. After the collection, its occupancy got reduced to 0 since everything is evacuated/promoted from Eden during a collection, and its target size grew to 13M. The new Eden capacity of 13M is not reserved at this point. This value is the target size of the Eden. Regions are added to Eden as the demand is made and when the added regions reach to the target size, we start the next collection. Similarly, Survivors had the occupancy of 0 bytes and it grew to 2048K after the collection. The total heap occupancy and capacity was 14M and 64M receptively before the collection and it became 9739K and 64M after the collection. Apart from the evacuation pauses, G1 also performs concurrent-marking to build the live data information of regions. 1.416: [GC pause (young) (initial-mark), 0.62417980 secs] ….... 2.042: [GC concurrent-root-region-scan-start] 2.067: [GC concurrent-root-region-scan-end, 0.0251507] 2.068: [GC concurrent-mark-start] 3.198: [GC concurrent-mark-reset-for-overflow] 4.053: [GC concurrent-mark-end, 1.9849672 sec] 4.055: [GC remark 4.055: [GC ref-proc, 0.0000254 secs], 0.0030184 secs] [Times: user=0.00 sys=0.00, real=0.00 secs] 4.088: [GC cleanup 117M->106M(138M), 0.0015198 secs] [Times: user=0.00 sys=0.00, real=0.00 secs] 4.090: [GC concurrent-cleanup-start] 4.091: [GC concurrent-cleanup-end, 0.0002721] The first phase of a marking cycle is Initial Marking where all the objects directly reachable from the roots are marked and this phase is piggy-backed on a fully young Evacuation Pause. 2.042: [GC concurrent-root-region-scan-start] This marks the start of a concurrent phase that scans the set of root-regions which are directly reachable from the survivors of the initial marking phase. 2.067: [GC concurrent-root-region-scan-end, 0.0251507] End of the concurrent root region scan phase and it lasted for 0.0251507 seconds. 2.068: [GC concurrent-mark-start] Start of the concurrent marking at 2.068 secs from the start of the process. 3.198: [GC concurrent-mark-reset-for-overflow] This indicates that the global marking stack had became full and there was an overflow of the stack. Concurrent marking detected this overflow and had to reset the data structures to start the marking again. 4.053: [GC concurrent-mark-end, 1.9849672 sec] End of the concurrent marking phase and it lasted for 1.9849672 seconds. 4.055: [GC remark 4.055: [GC ref-proc, 0.0000254 secs], 0.0030184 secs] This corresponds to the remark phase which is a stop-the-world phase. It completes the left over marking work (SATB buffers processing) from the previous phase. In this case, this phase took 0.0030184 secs and out of which 0.0000254 secs were spent on Reference processing. 4.088: [GC cleanup 117M->106M(138M), 0.0015198 secs] Cleanup phase which is again a stop-the-world phase. It goes through the marking information of all the regions, computes the live data information of each region, resets the marking data structures and sorts the regions according to their gc-efficiency. In this example, the total heap size is 138M and after the live data counting it was found that the total live data size dropped down from 117M to 106M. 4.090: [GC concurrent-cleanup-start] This concurrent cleanup phase frees up the regions that were found to be empty (didn't contain any live data) during the previous stop-the-world phase. 4.091: [GC concurrent-cleanup-end, 0.0002721] Concurrent cleanup phase took 0.0002721 secs to free up the empty regions. Option -XX:G1PrintRegionLivenessInfo Now, let's look at the output generated with the flag G1PrintRegionLivenessInfo. This is a diagnostic option and gets enabled with -XX:+UnlockDiagnosticVMOptions. G1PrintRegionLivenessInfo prints the live data information of each region during the Cleanup phase of the concurrent-marking cycle. 26.896: [GC cleanup ### PHASE Post-Marking @ 26.896### HEAP committed: 0x02e00000-0x0fe00000 reserved: 0x02e00000-0x12e00000 region-size: 1048576 Cleanup phase of the concurrent-marking cycle started at 26.896 secs from the start of the process and this live data information is being printed after the marking phase. Committed G1 heap ranges from 0x02e00000 to 0x0fe00000 and the total G1 heap reserved by JVM is from 0x02e00000 to 0x12e00000. Each region in the G1 heap is of size 1048576 bytes. ### type address-range used prev-live next-live gc-eff### (bytes) (bytes) (bytes) (bytes/ms) This is the header of the output that tells us about the type of the region, address-range of the region, used space in the region, live bytes in the region with respect to the previous marking cycle, live bytes in the region with respect to the current marking cycle and the GC efficiency of that region. ### FREE 0x02e00000-0x02f00000 0 0 0 0.0 This is a Free region. ### OLD 0x02f00000-0x03000000 1048576 1038592 1038592 0.0 Old region with address-range from 0x02f00000 to 0x03000000. Total used space in the region is 1048576 bytes, live bytes as per the previous marking cycle are 1038592 and live bytes with respect to the current marking cycle are also 1038592. The GC efficiency has been computed as 0. ### EDEN 0x03400000-0x03500000 20992 20992 20992 0.0 This is an Eden region. ### HUMS 0x0ae00000-0x0af00000 1048576 1048576 1048576 0.0### HUMC 0x0af00000-0x0b000000 1048576 1048576 1048576 0.0### HUMC 0x0b000000-0x0b100000 1048576 1048576 1048576 0.0### HUMC 0x0b100000-0x0b200000 1048576 1048576 1048576 0.0### HUMC 0x0b200000-0x0b300000 1048576 1048576 1048576 0.0### HUMC 0x0b300000-0x0b400000 1048576 1048576 1048576 0.0### HUMC 0x0b400000-0x0b500000 1001480 1001480 1001480 0.0 These are the continuous set of regions called Humongous regions for storing a large object. HUMS (Humongous starts) marks the start of the set of humongous regions and HUMC (Humongous continues) tags the subsequent regions of the humongous regions set. ### SURV 0x09300000-0x09400000 16384 16384 16384 0.0 This is a Survivor region. ### SUMMARY capacity: 208.00 MB used: 150.16 MB / 72.19 % prev-live: 149.78 MB / 72.01 % next-live: 142.82 MB / 68.66 % At the end, a summary is printed listing the capacity, the used space and the change in the liveness after the completion of concurrent marking. In this case, G1 heap capacity is 208MB, total used space is 150.16MB which is 72.19% of the total heap size, live data in the previous marking was 149.78MB which was 72.01% of the total heap size and the live data as per the current marking is 142.82MB which is 68.66% of the total heap size. Option -XX:+G1PrintHeapRegions G1PrintHeapRegions option logs the regions related events when regions are committed, allocated into or are reclaimed. COMMIT/UNCOMMIT events G1HR COMMIT [0x6e900000,0x6ea00000]G1HR COMMIT [0x6ea00000,0x6eb00000] Here, the heap is being initialized or expanded and the region (with bottom: 0x6eb00000 and end: 0x6ec00000) is being freshly committed. COMMIT events are always generated in order i.e. the next COMMIT event will always be for the uncommitted region with the lowest address. G1HR UNCOMMIT [0x72700000,0x72800000]G1HR UNCOMMIT [0x72600000,0x72700000] Opposite to COMMIT. The heap got shrunk at the end of a Full GC and the regions are being uncommitted. Like COMMIT, UNCOMMIT events are also generated in order i.e. the next UNCOMMIT event will always be for the committed region with the highest address. GC Cycle events G1HR #StartGC 7G1HR CSET 0x6e900000G1HR REUSE 0x70500000G1HR ALLOC(Old) 0x6f800000G1HR RETIRE 0x6f800000 0x6f821b20G1HR #EndGC 7 This shows start and end of an Evacuation pause. This event is followed by a GC counter tracking both evacuation pauses and Full GCs. Here, this is the 7th GC since the start of the process. G1HR #StartFullGC 17G1HR UNCOMMIT [0x6ed00000,0x6ee00000]G1HR POST-COMPACTION(Old) 0x6e800000 0x6e854f58G1HR #EndFullGC 17 Shows start and end of a Full GC. This event is also followed by the same GC counter as above. This is the 17th GC since the start of the process. ALLOC events G1HR ALLOC(Eden) 0x6e800000 The region with bottom 0x6e800000 just started being used for allocation. In this case it is an Eden region and allocated into by a mutator thread. G1HR ALLOC(StartsH) 0x6ec00000 0x6ed00000G1HR ALLOC(ContinuesH) 0x6ed00000 0x6e000000 Regions being used for the allocation of Humongous object. The object spans over two regions. G1HR ALLOC(SingleH) 0x6f900000 0x6f9eb010 Single region being used for the allocation of Humongous object. G1HR COMMIT [0x6ee00000,0x6ef00000]G1HR COMMIT [0x6ef00000,0x6f000000]G1HR COMMIT [0x6f000000,0x6f100000]G1HR COMMIT [0x6f100000,0x6f200000]G1HR ALLOC(StartsH) 0x6ee00000 0x6ef00000G1HR ALLOC(ContinuesH) 0x6ef00000 0x6f000000G1HR ALLOC(ContinuesH) 0x6f000000 0x6f100000G1HR ALLOC(ContinuesH) 0x6f100000 0x6f102010 Here, Humongous object allocation request could not be satisfied by the free committed regions that existed in the heap, so the heap needed to be expanded. Thus new regions are committed and then allocated into for the Humongous object. G1HR ALLOC(Old) 0x6f800000 Old region started being used for allocation during GC. G1HR ALLOC(Survivor) 0x6fa00000 Region being used for copying old objects into during a GC. Note that Eden and Humongous ALLOC events are generated outside the GC boundaries and Old and Survivor ALLOC events are generated inside the GC boundaries. Other Events G1HR RETIRE 0x6e800000 0x6e87bd98 Retire and stop using the region having bottom 0x6e800000 and top 0x6e87bd98 for allocation. Note that most regions are full when they are retired and we omit those events to reduce the output volume. A region is retired when another region of the same type is allocated or we reach the start or end of a GC(depending on the region). So for Eden regions: For example: 1. ALLOC(Eden) Foo2. ALLOC(Eden) Bar3. StartGC At point 2, Foo has just been retired and it was full. At point 3, Bar was retired and it was full. If they were not full when they were retired, we will have a RETIRE event: 1. ALLOC(Eden) Foo2. RETIRE Foo top3. ALLOC(Eden) Bar4. StartGC G1HR CSET 0x6e900000 Region (bottom: 0x6e900000) is selected for the Collection Set. The region might have been selected for the collection set earlier (i.e. when it was allocated). However, we generate the CSET events for all regions in the CSet at the start of a GC to make sure there's no confusion about which regions are part of the CSet. G1HR POST-COMPACTION(Old) 0x6e800000 0x6e839858 POST-COMPACTION event is generated for each non-empty region in the heap after a full compaction. A full compaction moves objects around, so we don't know what the resulting shape of the heap is (which regions were written to, which were emptied, etc.). To deal with this, we generate a POST-COMPACTION event for each non-empty region with its type (old/humongous) and the heap boundaries. At this point we should only have Old and Humongous regions, as we have collapsed the young generation, so we should not have eden and survivors. POST-COMPACTION events are generated within the Full GC boundary. G1HR CLEANUP 0x6f400000G1HR CLEANUP 0x6f300000G1HR CLEANUP 0x6f200000 These regions were found empty after remark phase of Concurrent Marking and are reclaimed shortly afterwards. G1HR #StartGC 5G1HR CSET 0x6f400000G1HR CSET 0x6e900000G1HR REUSE 0x6f800000 At the end of a GC we retire the old region we are allocating into. Given that its not full, we will carry on allocating into it during the next GC. This is what REUSE means. In the above case 0x6f800000 should have been the last region with an ALLOC(Old) event during the previous GC and should have been retired before the end of the previous GC. G1HR ALLOC-FORCE(Eden) 0x6f800000 A specialization of ALLOC which indicates that we have reached the max desired number of the particular region type (in this case: Eden), but we decided to allocate one more. Currently it's only used for Eden regions when we extend the young generation because we cannot do a GC as the GC-Locker is active. G1HR EVAC-FAILURE 0x6f800000 During a GC, we have failed to evacuate an object from the given region as the heap is full and there is no space left to copy the object. This event is generated within GC boundaries and exactly once for each region from which we failed to evacuate objects. When Heap Regions are reclaimed ? It is also worth mentioning when the heap regions in the G1 heap are reclaimed. All regions that are in the CSet (the ones that appear in CSET events) are reclaimed at the end of a GC. The exception to that are regions with EVAC-FAILURE events. All regions with CLEANUP events are reclaimed. After a Full GC some regions get reclaimed (the ones from which we moved the objects out). But that is not shown explicitly, instead the non-empty regions that are left in the heap are printed out with the POST-COMPACTION events.

    Read the article

  • JavaNullPointerException/Layout Error when working with lists and ListView on Android

    - by psyhclo
    Hey, I'm trying to implement a ListView on Android, which will print the data retrieved from the SQLite Database. So I want to retrieve a lot of columns from the table and add this to a list, so I will print this list as a ListView. For this I created a method that will select all the columns from the table in a separate class, and I will print the ListView in a ListActivity. I want to retrieve 6 columns of the table, which is represented by the ids 2, 4, 5, 6, 7, 9. But it shows a lot of errors: 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): FATAL EXCEPTION: main 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): java.lang.NullPointerException 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.widget.ArrayAdapter.createViewFromResource(ArrayAdapter.java:355) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.widget.ArrayAdapter.getView(ArrayAdapter.java:323) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.widget.AbsListView.obtainView(AbsListView.java:1418) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.widget.ListView.makeAndAddView(ListView.java:1745) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.widget.ListView.fillDown(ListView.java:670) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.widget.ListView.fillFromTop(ListView.java:727) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.widget.ListView.layoutChildren(ListView.java:1598) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.widget.AbsListView.onLayout(AbsListView.java:1248) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.view.View.layout(View.java:7175) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.widget.FrameLayout.onLayout(FrameLayout.java:338) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.view.View.layout(View.java:7175) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.widget.FrameLayout.onLayout(FrameLayout.java:338) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.view.View.layout(View.java:7175) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.widget.FrameLayout.onLayout(FrameLayout.java:338) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.view.View.layout(View.java:7175) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.widget.LinearLayout.setChildFrame(LinearLayout.java:1254) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.widget.LinearLayout.layoutVertical(LinearLayout.java:1130) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.widget.LinearLayout.onLayout(LinearLayout.java:1047) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.view.View.layout(View.java:7175) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.widget.FrameLayout.onLayout(FrameLayout.java:338) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.view.View.layout(View.java:7175) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.widget.FrameLayout.onLayout(FrameLayout.java:338) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.view.View.layout(View.java:7175) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.widget.LinearLayout.setChildFrame(LinearLayout.java:1254) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.widget.LinearLayout.layoutVertical(LinearLayout.java:1130) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.widget.LinearLayout.onLayout(LinearLayout.java:1047) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.view.View.layout(View.java:7175) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.widget.FrameLayout.onLayout(FrameLayout.java:338) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.view.View.layout(View.java:7175) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.view.ViewRoot.performTraversals(ViewRoot.java:1140) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.view.ViewRoot.handleMessage(ViewRoot.java:1859) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.os.Handler.dispatchMessage(Handler.java:99) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.os.Looper.loop(Looper.java:123) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at android.app.ActivityThread.main(ActivityThread.java:3647) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at java.lang.reflect.Method.invokeNative(Native Method) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at java.lang.reflect.Method.invoke(Method.java:507) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:839) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:597) 12-24 19:19:04.066: ERROR/AndroidRuntime(22630): at dalvik.system.NativeStart.main(Native Method) Here is the code of the method that select the data. public List<String> selectAll() { List<String> list1 = new ArrayList<String>(); List<String> list2 = new ArrayList<String>(); List<String> list3 = new ArrayList<String>(); List<String> list4 = new ArrayList<String>(); List<String> list5 = new ArrayList<String>(); List<String> list6 = new ArrayList<String>(); Cursor cursor = this.db.query(TABLE_NAME, null, null, null, null, null, "duration desc"); if (cursor.moveToFirst()) { do { list1.add(cursor.getString(2)); list2.add(cursor.getString(4)); list3.add(cursor.getString(5)); list4.add(cursor.getString(6)); list5.add(cursor.getString(7)); list6.add(cursor.getString(9)); list1.addAll(list2); list1.addAll(list3); list1.addAll(list4); list1.addAll(list5); list1.addAll(list6); } while (cursor.moveToNext()); Log.i(TAG, "After cursor.moveToNext()"); } if (cursor != null && !cursor.isClosed()) { cursor.close(); } Log.i(TAG, "Before selectAll returnment"); return list1; } And here is the code of the ListActivity class: public class RatedCalls extends ListActivity { private static final String LOG_TAG = "RatedCallsActivity"; private CallDataHelper cdh; StringBuilder sb = new StringBuilder(); OpenHelper openHelper = new OpenHelper(RatedCalls.this); @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); Log.i(LOG_TAG, "calling from onCreate()"); cdh = new CallDataHelper(this); Log.i(LOG_TAG, "--->>> before calling the service"); startService(new Intent(this, RatedCallsService.class)); Log.i(LOG_TAG, "Service called."); Log.i(LOG_TAG, "--->>> after calling the service"); fillList(); } public void fillList() { List<String> ratedCalls = this.cdh.selectAll(); setListAdapter(new ArrayAdapter<String>(this, R.layout.listitem, ratedCalls)); ListView lv = getListView(); lv.setTextFilterEnabled(true); lv.setOnItemClickListener(new OnItemClickListener() { public void onItemClick(AdapterView<?> parent, View view, int position, long id) { // When clicked, show a toast with the TextView text Toast.makeText(getApplicationContext(), ((TextView) view).getText(), Toast.LENGTH_SHORT).show(); } }); } }

    Read the article

< Previous Page | 61 62 63 64 65 66  | Next Page >