Search Results

Search found 115763 results on 4631 pages for 'new tab page'.

Page 652/4631 | < Previous Page | 648 649 650 651 652 653 654 655 656 657 658 659  | Next Page >

  • Vaadin: Downloaded file has whole path as file name

    - by javydreamercsw
    I have a download action implemented on my Vaadin application but for some reason the downloaded file has the original file's full path as the file name. Any idea? You can see the code on this post. Edit: Here's the important part of the code: package com.bluecubs.xinco.core.server.vaadin; import com.bluecubs.xinco.core.server.XincoConfigSingletonServer; import com.vaadin.Application; import com.vaadin.terminal.DownloadStream; import com.vaadin.terminal.FileResource; import java.io.*; import java.net.URLEncoder; import java.util.UUID; import java.util.logging.Level; import java.util.logging.Logger; import java.util.zip.CRC32; import java.util.zip.CheckedInputStream; /** * * @author Javier A. Ortiz Bultrón<[email protected]> */ public class FileDownloadResource extends FileResource { private final String fileName; private File download; private File newFile; public FileDownloadResource(File sourceFile, String fileName, Application application) { super(sourceFile, application); this.fileName = fileName; } protected void cleanup() { if (newFile != null && newFile.exists()) { newFile.delete(); } if (download != null && download.exists() && download.listFiles().length == 0) { download.delete(); } } @Override public DownloadStream getStream() { try { //Copy file to directory for downloading InputStream in = new CheckedInputStream(new FileInputStream(getSourceFile()), new CRC32()); download = new File(XincoConfigSingletonServer.getInstance().FileRepositoryPath + System.getProperty("file.separator") + UUID.randomUUID().toString()); newFile = new File(download.getAbsolutePath() + System.getProperty("file.separator") + fileName); download.mkdirs(); OutputStream out = new FileOutputStream(newFile); newFile.deleteOnExit(); download.deleteOnExit(); byte[] buf = new byte[1024]; int len; while ((len = in.read(buf)) > 0) { out.write(buf, 0, len); } in.close(); out.close(); final DownloadStream ds = new DownloadStream( new FileInputStream(newFile), getMIMEType(), fileName); ds.setParameter("Content-Disposition", "attachment; filename=" + URLEncoder.encode(fileName, "utf-8")); ds.setCacheTime(getCacheTime()); return ds; } catch (final FileNotFoundException ex) { Logger.getLogger(FileDownloadResource.class.getName()).log(Level.SEVERE, null, ex); return null; } catch (IOException ex) { Logger.getLogger(FileDownloadResource.class.getName()).log(Level.SEVERE, null, ex); return null; } } } I already debugged and verified that fileName only contains the file's name not the whole path.

    Read the article

  • How can i take only integer input from keyboard and if input is invalid how do i ask user agaian

    - by fari
    This is what i have written so far but when exception is raised it does not again ask teh user for input. do{ System.out.println("Enter the number of stones to play with: "); BufferedReader br = new BufferedReader(new InputStreamReader(System.in)); String temp=br.readLine(); }while (key<0 && key>9); if(key<0 || key>10) throw new InvalidStartingStonesException(key); player1=new KeyBoardPlayer(); player2 = new KeyBoardPlayer(); this.player1=player1; this.player2=player2; state=new KalaGameState(key); } catch(NumberFormatException nFE) { System.out.println("Not an Integer");} catch(IOException e) { System.out.println(e); }

    Read the article

  • Hibernate save() and transaction rollback

    - by Marco
    Hi, In Hibernate when i save() an object in a transaction, and then i rollback it, the saved object still remains in the DB. It's strange because this issue doesn't happen with the update() or delete() method, just with save(). Here is the code i'm using: DbEntity dbEntity = getDbEntity(); HibernateUtil.beginTransaction(); Session session = HibernateUtil.getCurrentSession(); session.save(dbEntity); HibernateUtil.rollbackTransaction(); And here is the HibernateUtil class (just the involved functions, i guarantee the getSessionFactory() method works well - there is an Interceptor handler, but it doesn't matter now): private static final ThreadLocal<Session> threadSession = new ThreadLocal<Session>(); private static final ThreadLocal<Transaction> threadTransaction = new ThreadLocal<Transaction>(); /** * Retrieves the current Session local to the thread. * <p/> * If no Session is open, opens a new Session for the running thread. * * @return Session */ public static Session getCurrentSession() throws HibernateException { Session s = (Session) threadSession.get(); try { if (s == null) { log.debug("Opening new Session for this thread."); if (getInterceptor() != null) { log.debug("Using interceptor: " + getInterceptor().getClass()); s = getSessionFactory().openSession(getInterceptor()); } else { s = getSessionFactory().openSession(); } threadSession.set(s); } } catch (HibernateException ex) { throw new HibernateException(ex); } return s; } /** * Start a new database transaction. */ public static void beginTransaction() throws HibernateException { Transaction tx = (Transaction) threadTransaction.get(); try { if (tx == null) { log.debug("Starting new database transaction in this thread."); tx = getCurrentSession().beginTransaction(); threadTransaction.set(tx); } } catch (HibernateException ex) { throw new HibernateException(ex); } } /** * Rollback the database transaction. */ public static void rollbackTransaction() throws HibernateException { Transaction tx = (Transaction) threadTransaction.get(); try { threadTransaction.set(null); if ( tx != null && !tx.wasCommitted() && !tx.wasRolledBack() ) { log.debug("Tyring to rollback database transaction of this thread."); tx.rollback(); } } catch (HibernateException ex) { throw new HibernateException(ex); } finally { closeSession(); } } Thanks

    Read the article

  • Trying to capture stage area using BitmapData

    - by Dimitree
    I am trying to grab part of stage area using BitmapData and copyPixels method: bmd = new BitmapData(stage.stageWidth, stage.stageHeight); bmdRect = new BitmapData(320, 240); rectangle = new Rectangle(360, 20, 320, 240); bmdRect.copyPixels(bmd, rectangle, new Point()); bmd.draw(bmp); bmp = new Bitmap(bmdRect); var myEncoder:JPGEncoder = new JPGEncoder(100); var byteArray:ByteArray = myEncoder.encode(bmd); The result i get is an empty .jpg I m pretty sure that the error is in the Bitmap procedure and not the saving one...

    Read the article

  • augment the factory pattern in java

    - by TP
    I am trying to use a factory pattern to create a QuestionTypeFactory where the instantiated classes will be like MultipleChoice, TrueFalseQuestion etc. The factory code looks something like this class QuestionFactory { public enum QuestionType { TrueFalse, MultipleChoice, Essay } public static Question createQuestion(QuestionType quesType) { switch (quesType) { case TrueFalse: return new TrueFalseQuestion(); case MultipleChoice: return new MultipleChoiceQuestion(); case Essay: return new EssayQuestion(); } throw new IllegalArgumentException("Not recognized."); } } This works ok for now. If I want to add another question type I will need to modify the factory class and I do not want to do that. How can I set it up so that each question class registers itself with the Factory so that when I add a new question type, I do not have to change the code for the factory? I am a bit new to java and am not sure how to do this.

    Read the article

  • How to add items rows to a listview WPF and VB.net

    - by leviatan1001
    Im getting crazy with it. It is so easy in windows form, but in wpf it seems to be different. Every example i find is in C# and i cant addapt it. Well, this is the code i have. Atm, i have just defined the columns: 'diseño de las columnas Dim item As ListViewItem = New ListViewItem Dim Mi_Lista As GridView = New GridView Mi_Lista.AllowsColumnReorder = True Dim cine As New GridViewColumn() Dim Si3d As New GridViewColumn cine.Header = "Cine" cine.DisplayMemberBinding = New Binding("Cine") Si3d.DisplayMemberBinding = New Binding("si3D") cine.Width = 140 Si3d.Header = "3D" Si3d.Width = 50 Mi_Lista.Columns.Add(cine) Mi_Lista.Columns.Add(Si3d) Thanks in advance.

    Read the article

  • What is a custom collection?

    - by Win Coder
    A Group of objects. However i am having confusion in the following case. A sample class Class A { public string; } Class A_list { public A[] list; public A_list(A[] _list) { list = new A[_list.length]; for (int i = 0; i < _list.Length; i++) { list[i] = _list[i]; } } } static void Main(String[] args) { A[] names = new A[3] { new A("some"), new A("another"), new A("one"), }; A_list just_an_object = new A_list(names); } Which of the above is a custom collection the array or the object that holds array as a field or are both custom collections.

    Read the article

  • Qt Qbrush issue

    - by Solitaire
    What is the difference in the following code, QGraphicsScene * scence = new QGraphicsScene(); QBrush *brush = new QBrush((QColor(60,20,20))); scence->setBackgroundBrush(*brush); QGraphicsView *view = new QGraphicsView(); view->setScene(scence); //view->setBackgroundBrush(*brush); //view->setCacheMode(QGraphicsView::CacheBackground); view->showFullScreen(); gives black color background QGraphicsScene * scence = new QGraphicsScene(); QBrush *brush = new QBrush(); brush->setColor(QColor(60,20,20)); scence->setBackgroundBrush(*brush); QGraphicsView *view = new QGraphicsView(); view->setScene(scence); //view->setBackgroundBrush(*brush); //view->setCacheMode(QGraphicsView::CacheBackground); view->showFullScreen(); it gives nothing.

    Read the article

  • Learning MVC - Maintaining model state

    - by GenericTypeTea
    First of all, I'm very new to MVC. Bought the books, but not got the T-Shirt yet. I've put together my first little application, but I'm looking at the way I'm maintaining my model and I don't think it looks right. My form contains the following: <% using (Html.BeginForm("Reconfigured", null, FormMethod.Post, new { id = "configurationForm" })) { %> <%= Html.DropDownList("selectedCompany", new SelectList(Model.Companies, Model.SelectedCompany), new { onchange = "$('#configurationForm').submit()" })%> <%= Html.DropDownList("selectedDepartment", new SelectList(Model.Departments, Model.SelectedDepartment), new { onchange = "$('#configurationForm').submit()" })%> <%=Html.TextArea("comment", Model.Comment) %> <%} %> My controller has the following: public ActionResult Index(string company, string department, string comment) { TestModel form = new TestModel(); form.Departments = _someRepository.GetList(); form.Companies = _someRepository.GetList(); form.Comment = comment; form.SelectedCompany = company; form.SelectedDepartment = department; return View(form); } [HttpPost] public ActionResult Reconfigured(string selectedCompany, string selectedDepartment, string comment) { return RedirectToAction("Index", new { company = selectedCompany, department = selectedDepartment, comment = comment}); } And finally, this is my route: routes.MapRoute( "Default", "{controller}/{company}/{department}", new { controller = "CompanyController", action = "Index", company="", department="" } ); Now, every time I change DropDownList value, all my values are maintained. I end up with a URL like the following after the Reconfigure action is called: http://localhost/Main/Index/Company/Sales?comment=Foo%20Bar Ideally I'd like the URL to remain as: http://localhost/Main/Index My routing object is probably wrong. This can't be the right way? It seems totally wrong to me as for each extra field I add, I have to add the property into the Index() method? I had a look at this answer where the form is passed through TempData. This is obviously an improvement, but it's not strongly typed? Is there a way to do something similar but have it strongly typed? This may be a simple-enough question, but the curse of 10 years of WinForms/WebForms makes this MVC malarky hard to get your head 'round.

    Read the article

  • Creating keystore for jarsigner programmatically

    - by skayred
    I'm trying to generate keystore with certificate to use it with JarSigner. Here is my code: System.out.println("Keystore generation..."); Security.addProvider(new BouncyCastleProvider()); String domainName = "example.org"; KeyPairGenerator keyGen = KeyPairGenerator.getInstance("RSA"); SecureRandom random = SecureRandom.getInstance("SHA1PRNG", "SUN"); keyGen.initialize(1024, random); KeyPair pair = keyGen.generateKeyPair(); X509V3CertificateGenerator v3CertGen = new X509V3CertificateGenerator(); int serial = new SecureRandom().nextInt(); v3CertGen.setSerialNumber(BigInteger.valueOf(serial < 0 ? -1 * serial : serial)); v3CertGen.setIssuerDN(new X509Principal("CN=" + domainName + ", OU=None, O=None L=None, C=None")); v3CertGen.setNotBefore(new Date(System.currentTimeMillis() - 1000L * 60 * 60 * 24 * 30)); v3CertGen.setNotAfter(new Date(System.currentTimeMillis() + (1000L * 60 * 60 * 24 * 365*10))); v3CertGen.setSubjectDN(new X509Principal("CN=" + domainName + ", OU=None, O=None L=None, C=None")); v3CertGen.setPublicKey(pair.getPublic()); v3CertGen.setSignatureAlgorithm("MD5WithRSAEncryption"); X509Certificate PKCertificate = v3CertGen.generateX509Certificate(pair.getPrivate()); FileOutputStream fos = new FileOutputStream("/Users/dmitrysavchenko/testCert.cert"); fos.write(PKCertificate.getEncoded()); fos.close(); KeyStore ks = KeyStore.getInstance(KeyStore.getDefaultType()); char[] password = "123".toCharArray(); ks.load(null, password); ks.setCertificateEntry("hive", PKCertificate); fos = new FileOutputStream("/Users/dmitrysavchenko/hive-keystore.pkcs12"); ks.store(fos, password); fos.close(); It works, but when I'm trying to sign my JAR with this keystore, I get the following error: jarsigner: Certificate chain not found for: hive. hive must reference a valid KeyStore key entry containing a private key and corresponding public key certificate chain. I've discovered that there must be a private key, but I don't know how to add it to certificate. Can you help me?

    Read the article

  • Comparing Values with newlines in Selenium IDE

    - by Zachary
    I am writing a Selenium test case using the IDE, and I have a that I want to verify is equal to the value I expect. The newlines in the box seem to be causing some trouble, as when I use the "verifyValue" command I get this: # [info] Executing: |verifyValue | organizationContainer.organization.defaultLegalText | This is some test legal text. I just did a new line. Hopefully these new lines will get preserved. | # [error] Actual value 'This is some test legal text. I just did a new line. Hopefully these new lines will get preserved.' did not match 'This is some test legal text. I just did a new line. Hopefully these new lines will get preserved. ' Is there a better way to compare strings in the Selenium IDE

    Read the article

  • How do you insert 9 MB file into a Blob Field Using Oracle.DataAccess?

    - by discwiz
    Trying to insert a large audio file into an Oracle 10g database and keep getting this error: ORA-01460: unimplemented or unreasonable conversion requested The byte array length of the audio file is 2702577. The procedure works with smaller array lengths, but not the larger ones. Here is my code and Thanks! Dim oracleConnection As New OracleClient.OracleConnection Dim Cmd As New OracleClient.OracleCommand Dim oracleDataAdapter As New OracleDataAdapter oracleConnection.ConnectionString = System.Configuration.ConfigurationManager.AppSettings("MasterConnectionODT") Cmd.Connection = oracleConnection Cmd.CommandText = "Audio.ADD_AUDIO" Cmd.CommandType = CommandType.StoredProcedure Dim aParam As New OracleClient.OracleParameter aParam.ParameterName = "I_FACILITY_ID_C" aParam.OracleType = OracleType.Char aParam.Value = FacID aParam.Direction = ParameterDirection.Input Cmd.Parameters.Add(aParam) aParam = New OracleParameter aParam.ParameterName = "I_TARP_ID_N" aParam.OracleType = OracleType.Number aParam.Value = TarpID aParam.Direction = ParameterDirection.Input Cmd.Parameters.Add(aParam) aParam = New OracleParameter aParam.ParameterName = "I_AUDIO_BLOB" aParam.OracleType = OracleType.Blob aParam.Value = Audio aParam.Direction = ParameterDirection.Input Cmd.Parameters.Add(aParam) Using oracleConnection oracleConnection.Open() Cmd.ExecuteNonQuery() End Using

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • Compare values for audit trail

    - by kagaku
    I'm attempting to develop an audit trail/tracking solution for an existing database written in PLSQL/PHP - however I'm still unsure as of yet on an easy (to implement and maintain) solution for tracking changes to fields/values. For instance, the project tracking portion of the DB APP tracks over 200 fields and ideally I'd like a nice way to show a history of changes, such as: 5/10/2010 - Project 435232 updated by John Doe Changed Project Name (Old: Test Project; New: Super Test Project) Changed Submission Date (Old: 5/10/2010; New: 5/11/2010) Changed Description (Old: This is an example!; New: This is a test example) Essentially for each field (db column) it would output a new line to show the old/new values. So far my current idea is saving the current version of the data to a temporary table, updating the primary table with the new data then loading each row into an array and doing an array compare to determine the differences. This seems a bit convoluted, and if there is an easier method I'd love to know it. Any ideas or suggestions are much appreciated!

    Read the article

  • Empty namespace using Linq Xml

    - by porum
    I'm trying to create a sitemap using Linq to Xml, but am getting an empty namespace attribute, which I would like to get rid of. e.g. XNamespace ns = "http://www.sitemaps.org/schemas/sitemap/0.9"; XDocument xdoc = new XDocument(new XDeclaration("1.0", "utf-8", "true"), new XElement(ns + "urlset", new XElement("url", new XElement("loc", "http://www.example.com/page"), new XElement("lastmod", "2008-09-14")))); The result is ... <urlset xmlns="http://www.sitemaps.org/schemas/sitemap/0.9"> <url xmlns=""> <loc>http://www.example.com/page</loc> <lastmod>2008-09-14</lastmod> </url> </urlset> I would rather not have the xmlns="" on the url element. I can strip it out using Replace on the final xdoc.ToString(), but is there a more correct way?

    Read the article

  • How to bind a List to a WPF treeview using Xaml?

    - by Joan Venge
    I don't know how to bind a List of Drink to a WPF TreeView. struct Drink { public string Name { get; private set; } public int Popularity { get; private set; } public Drink ( string name, int popularity ) : this ( ) { this.Name = name; this.Popularity = popularity; } } List<Drink> coldDrinks = new List<Drink> ( ){ new Drink ( "Water", 1 ), new Drink ( "Fanta", 2 ), new Drink ( "Sprite", 3 ), new Drink ( "Coke", 4 ), new Drink ( "Milk", 5 ) }; } } I have searched the web, for instance saw here. But what's this even mean: ItemsSource="{x:Static local:TreeTest.BoatList}" x:? static? local? How do you specify a collection in your code in the xaml?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Google Site Data fetching

    - by inTagger
    Hail! I want to fetch image from NOT PUBLIC Google Site's page. I'm using WebClient for this purposes. var uri = new Uri("http://sites.google.com/a/MYDOMAIN.COM/SITENAME/" + "_/rsrc/1234567890/MYIMAGE.jpg"); string fileName = "d:\\!temp\\MYIMAGE.jpg"; if (File.Exists(fileName)) File.Delete(fileName); using (var webClient = new WebClient()) { var networkCredential = new NetworkCredential("USERNAME", "PASSWORD"); var credentialCache = new CredentialCache { {new Uri("sites.google.com"), "Basic", networkCredential}, {new Uri("www.google.com"), "Basic", networkCredential} }; webClient.Credentials = credentialCache; webClient.DownloadFile(uri, fileName); } It doesn't download image, but html file with login form is downloaded. If i open this link in browser it shows me login form then i enter username and password and then i can see the image. How i must use my credentials to download file with WebClient or HttpWebRequest?

    Read the article

  • How to print a JTable header in two lines?

    - by Eruls
    Program is to print a JTabel and used function is JTabel jt=new JTable(); MessageFormat headerFormat= new MessageFormat("My World Tomorrow"); MessageFormat footerFormat = new MessageFormat("Page {0}"); jt.Print(JTabel.Format,headerFormat,footerFormat); Query is: How to print the header in two lines that is My World Tomorrow Tired following solutions: new MessageFormat("My world \n Tomorrow"); new MessageFormat("My world \r\n Tomorrow"); new MessageFormat("My world" System.getProperty("line.separator")+"Tomorrow" ); Nothing works.

    Read the article

  • Remove .net ContextMenuStrip Padding

    - by Frosty840
    Hi, When creating a ContextMenuStrip, there is a huge amount of padding around the contained controls. For example: Me.myMenu = New ContextMenuStrip 'unset all obvious padding settings' Me.myMenu.ShowCheckMargin = False Me.myMenu.ShowImageMargin = False Me.myMenu.Margin = New System.Windows.Forms.Padding(0) Me.myMenu.Padding = New System.Windows.Forms.Padding(0) Dim addButton As New Button addButton.Size = New Size(60, 60) addButton.Text = "Button" Dim addControlHost As New ToolStripControlHost(addButton) Me.myMenu.Items.Add(addcontrolhost) Me.ContextMenuStrip = Me.myMenu This, ideally, would cause a 60x60 button to pop up at the cursor location. What actually pops up is this: The button is there, as expected, but despite there being no margin, no padding, and having set both Show*Margin settings to False, there is a massive border around the Button. I'm probably missing something blindingly obvious, but how can I get rid of all the white bordering, especially that huge right-hand margin?

    Read the article

  • shuffling array javascript

    - by Dennis Callanan
    <!doctype html> <html lang="en"> <head> <meta charset="utf=8" /> <title>Blackjack</title> <link rel="stylesheet" href="blackjack.css" /> <script type="text/javascript"> var H2 = 2; var S2 = 2; var D2 = 2; var C2 = 2; var H3 = 3; var S3 = 3; var D3 = 3; var C3 = 3; var deck = new Array(H2, S2, D2, C2, H3, S3, D3, C3); var new_deck = new Array(); var r; document.write("deck = ") for (r =0; r<deck.length; r++){ document.write(deck[r]); } document.write("</br>") document.write("new deck = ") for (r=0; r<new_deck.length; r++){ document.write(new_deck[r]); } document.write("</br>") for (r=0;r<deck.length;r++){ var randomindex = Math.floor(Math.random()*deck.length); new_deck.push(randomindex) deck.pop(randomindex) } document.write("deck = ") for (r =0; r<deck.length; r++){ document.write(deck[r]); } document.write("</br>") document.write("new deck = ") for (r=0; r<new_deck.length; r++){ document.write(new_deck[r]); } document.write("</br>") </script> </head> <body> </body> </html> Obviously this isn't the full Blackjack game here. It's just a test to see if shuffling the array works by printing the contents of both decks (arrays) before and after the shuffle. I'm only using 8 cards at the moment, 4 2's and 4 3's. What I am getting from this is: deck = 22223333 new deck = deck = 2222 new deck = 7502 What I'm hoping to get is: deck = 22223333 new deck = deck = new deck = 23232323 (or any of the 8 numbers, generated randomly) So it should be shuffling those 8 cards, what am I doing wrong? I'm only new to javascript but I've used some python before. I've done something similar in python and worked perfectly, but I'm not sure what's wrong here. Thanks for any answers in advance!!

    Read the article

  • Cannot find suitable formatter for custom class object

    - by Ganesha87
    I'm writing messages to a Message Queue in C# as follows: ObjectMsg objMsg = new ObjMsg(1,"ascii",20090807); Message m = new Message(); m.Formatter = new BinaryMessageFormatter(); m.body = objMsg; queue.Send(m); and I'm trying to read the messages as follows: Message m = new Message() m.Formatter = new BinaryMessageFormatter(); MessageQueue mq = new MessageQueue("./pqueue"); m = mq.Recieve(); ObjMsg msg = (ObjMsg )m.Body; However I'm getting an error message which says: "Cannot find a formatter capable of reading this message."

    Read the article

  • pass an ID with hyperlik but cant get this ID value from a fk in one table when i click in insert

    - by susan
    Something strange happened in my codes, actually I have a hyperlink that pass ID value in a query string to second page.in second page i have 2 sql datasource that both these sql datasources should get this id value and pass it to a filter parameter to show sth in datalist. so in another word I have a first page that has an hyperlink read ID value from a datasource and pass it to second page.its like below: <asp:HyperLink ID="HyperLink1" runat="server" NavigateUrl='<%# "~/forumpage.aspx?ID="+Eval("ID")%>'><%#Eval("title")%> </asp:HyperLink> then in second page i have one sql datasource with a query like this ...where ID=@id and get this id in query string from db.it work great . but i have problem with second sql datasource in second page it has a query sth like below:...forms.question_id=@id then in sql reference both to query string as ID that get by first page in hyperlink. but when i click in insert button show me error with fk. error:Error:The INSERT statement conflicted with the FOREIGN KEY constraint "FK_forumreply_forumquestions". The conflict occurred in database "forum", table "dbo.forumquestions", column 'ID'. The statement has been terminated. my tables (question(ID,user_id(fk),Cat_id(fk),title,bodytext) (reply(ID,userr_id(fk),questionn_id(fk),titlereply,bodytestreply); When by hand in cb i gave a number in questionn_id like 1 it show me successful but when it want read from a filter by datasource this field face with problem. plzzzz help i really need skip from this part.and cause i am new i guess I cant understand the logic way clearly. <asp:SqlDataSource ID="sdsreply" runat="server" ConnectionString="<%$ ConnectionStrings:forumConnectionString %>" SelectCommand="SELECT forumreply.ID, forumreply.userr_id, forumreply.questionn_id, forumreply.bodytextreply, forumreply.datetimereply, forumquestions.ID AS Expr1, forumusers.ID AS Expr2, forumusers.username FROM forumquestions INNER JOIN forumreply ON forumquestions.ID = forumreply.questionn_id INNER JOIN forumusers ON forumquestions.user_id = forumusers.ID AND forumreply.userr_id = forumusers.ID where forumreply.questionn_id=@questionn_id"> <SelectParameters> <asp:QueryStringParameter Name="questionn_id" QueryStringField="ID" /> </SelectParameters> </asp:SqlDataSource> it is cb for second page in insert button: { if (Session["userid"] != null) { lblreply.Text = Session["userid"].ToString(); } else { Session["userid"]=null; } if (HttpContext.Current.User.Identity.IsAuthenticated) { lblshow.Text = string.Empty; string d = HttpContext.Current.User.Identity.Name; lblshow.Text =d + "???? ??? ?????." ; foreach (DataListItem item in DataList2.Items) { Label questionn_idLabel = (Label)item.FindControl("questionn_idLabel"); Label userr_idLabel = (Label)item.FindControl("userr_idLabel"); lbltest.Text = string.Empty; lbltest.Text = questionn_idLabel.Text; lblreply.Text = string.Empty; lblreply.Text = userr_idLabel.Text; } } else { lblshow.Text = "??? ??? ??? ??? ?? ?? ?????? ???? ???? ???? ????? ??? ??? ? ??? ????? ???????."; } } { if(HttpContext.Current.User.Identity.IsAuthenticated) { if (Page.IsValid) { SqlConnection con = new SqlConnection(ConfigurationManager.ConnectionStrings["forumConnectionString"].ConnectionString); try { con.Open(); SqlCommand cmd = new SqlCommand("insert into forumreply (userr_id,questionn_id,bodytextreply,datetimereply)values(@userr_id,@questionn_id,@bodytextreply,@datetimereply)", con); cmd.Parameters.AddWithValue("userr_id",lblreply.Text); cmd.Parameters.AddWithValue("questionn_id",lbltest.Text); cmd.Parameters.AddWithValue("bodytextreply",txtbody.Text); cmd.Parameters.AddWithValue("datetimereply",DateTime.Now ); cmd.ExecuteNonQuery(); } catch (Exception exp) { Response.Write("<b>Error:</b>"); Response.Write(exp.Message); } finally { con.Close(); } lblmsg.Text = "???? ??? ?? ?????? ??? ?????.thx"; lblshow.Visible = false; //lbltxt.Text = txtbody.Text; txtbody.Text = string.Empty; } } else { lblmsg.Text = string.Empty; Session["rem"] = Request.UrlReferrer.AbsoluteUri; Response.Redirect("~/login.aspx"); } }

    Read the article

  • windows phone deserialization json

    - by user2042227
    I have a weird issue. so I am making a few calls in my app to a webservice, which replies with data. However I am using a token based login system, so the first time the user enters the app I get a token from the webservice to login for that specific user and that token returns only that users details. The problem I am having is when the user changes I need to make the calls again, to get the new user's details, but using visual studio's breakpoint debugging, it shows the new user's token making the call however the problem is when the json is getting deserialized, it is as if it still reads the old data and deserializes that, when I exit my app with the new user it works fine, so its as if it is reading cached values, but I have no idea how to clear it? I am sure the new calls are being made and the problem lies with the deserializing, but I have tried clearing the values before deserializing them again, however nothing works. am I missing something with the json deserializer, how van I clear its cached values? here I make the call and set it not to cache so it makes a new call everytime: client.Headers[HttpRequestHeader.CacheControl] = "no-cache"; var token_details = await client.DownloadStringTaskAsync(uri); and here I deserialize the result, it is at this section the old data gets shown, so the raw json being shown inside "token_details" is correct, only once I deserialize the token_details, it shows the wrong data. deserialized = JsonConvert.DeserializeObject(token_details); and the class I am deserializing into is a simple class nothing special happening here, I have even tried making the constructor so that it clears the values each time it gets called. public class test { public string status { get; set; } public string name{ get; set; } public string birthday{ get; set; } public string errorDes{ get; set; } public test() { status = ""; name= ""; birthday= ""; errorDes= ""; } } uri's before making the calls: {https://whatever.co.za/token/?code=BEBCg==&id=WP7&junk=121edcd5-ad4d-4185-bef0-22a4d27f2d0c} - old call "UBCg==" - old reply {https://whatever.co.za/token/?code=ABCg==&id=WP7&junk=56cc2285-a5b8-401e-be21-fec8259de6dd} - new call "UBCg==" - new response which is the same response as old call as you can see i did attach a new GUID everytime i make the call, but then the new uri is read before making the downloadstringtaskasync method call, but it returns with the old data

    Read the article

  • Get the first and second objects from a list using LINQ

    - by Vahid
    I have a list of Person objects. How can I get the first and second Person objects that meet a certain criteria from List<Person> People using LINQ? Let's say here is the list I've got. How can I get the first and second persons that are over 18 that is James and Jodie. public class Person { public string Name; public int age; } var People = new List<Person> { new Person {Name = "Jack", Age = 15}, new Person {Name = "James" , Age = 19}, new Person {Name = "John" , Age = 14}, new Person {Name = "Jodie" , Age = 21}, new Person {Name = "Jessie" , Age = 19} }

    Read the article

< Previous Page | 648 649 650 651 652 653 654 655 656 657 658 659  | Next Page >