Search Results

Search found 3825 results on 153 pages for 'regex negation'.

Page 67/153 | < Previous Page | 63 64 65 66 67 68 69 70 71 72 73 74  | Next Page >

  • Fix YAML syntax highlighting in VIM

    - by Kevin Burke
    The YAML syntax highlighting in Vim 7.3 isn't great. Putting an apostrophe in a line of text triggers quote highlighting even when there's no quote. The same thing happens in other files sometimes too. I've posted a screenshot below. Is there any way to fix this behavior, or is there a different YAML syntax file I can use that won't trigger this behavior? This occurs in both MacVim and Vim in the Terminal. I'm running v7.3. Thanks for your help, Kevin

    Read the article

  • Mechanism behind user forwarding in ScriptAliasMatch

    - by jolivier
    I am following this tutorial to setup gitolite and at some point the following ScriptAliasMatch is used: ScriptAliasMatch \ "(?x)^/(.*/(HEAD | \ info/refs | \ objects/(info/[^/]+ | \ [0-9a-f]{2}/[0-9a-f]{38} | \ pack/pack-[0-9a-f]{40}\.(pack|idx)) | \ git-(upload|receive)-pack))$" \ /var/www/bin/gitolite-suexec-wrapper.sh/$1 And the target script starts with USER=$1 So I am guessing this is used to forward the user name from apache to the suexec script (which indeed requires it). But I cannot see how this is done. The ScriptAliasMatch documentation makes me think that the /$1 will be replaced by the first matching group of the regexp before it. For me it captures from (?x)^/(.* to ))$ so there is nothing about a user here. My underlying problem is that USER is empty in my script so I get no authorizations in gitolite. I give my username to apache via a basic authentication: <Location /> # Crowd auth AuthType Basic AuthName "Git repositories" ... Require valid-user </Location> defined just under the previous ScriptAliasMatch. So I am really wondering how this is supposed to work and what part of the mechanism I missed so that I don't retrieve the user in my script.

    Read the article

  • How to combine RewriteRule of index.php and queries rewrite and avoid Server Error 404?

    - by Binyamin
    Both RewriteRule's works fine, except when used together. 1.Remove all queries except query ?callback=.*: # /api?callback=foo has no rewrite # /whatever?whatever=foo has 301 redirect /whatever RewriteCond %{THE_REQUEST} ^[A-Z]{3,9}\ /([^?#\ ]*)\?[^\ ]*\ HTTP/ [NC] RewriteCond %{REQUEST_URI}?%{QUERY_STRING} !/api(/.*)?\?callback=.* RewriteRule .*$ %{REQUEST_URI}? [R=301,L] 2.Rewrite index.php queries api and url=$1: # /api returns data index.php?api&url= # /api/whatever returns data index.php?api&url=whatever RewriteRule ^api(?:/([^/]*))?$ index.php?api&url=$1 [QSA,L] RewriteRule ^([^.]*)$ index.php?url=$1 [QSA,L] Any valid combination to this RewriteRule's on keeping its functionality? This combination will return Server Error 404 to /api/?callback=foo: # Remove all queries except query "callback" RewriteCond %{THE_REQUEST} ^[A-Z]{3,9}\ /([^?#\ ]*)\?[^\ ]*\ HTTP/ [NC] RewriteCond %{REQUEST_URI}?%{QUERY_STRING} !/api(/.*)?\?callback=.* RewriteRule .*$ %{REQUEST_URI}? [R=301,L] # Rewrite index.php queries RewriteCond %{REQUEST_URI}?%{QUERY_STRING} !/api(/.*)?\?callback=.* # Server Error 404 on /api/?callback=foo and /api/whatever?callback=foo RewriteRule ^api(?:/([^/]*))?$ index.php?api&url=$1 [QSA,L] RewriteCond %{REQUEST_URI}?%{QUERY_STRING} !/api(/.*)?\?callback=.* RewriteRule ^([^.]*)$ index.php?url=$1 [QSA,L]

    Read the article

  • remove words containing non-alpha characters

    - by dnkb
    Given a text file with space separated string and a tab separated integer, I'd ;like to get rid of all words that have non-alpha characters but keep words consisting of alpha only characters and the tab plus the integer afterwards. My attempts like the ones below didin't yield any good. What I was trying to express is something like: "replace anything within word boundaries that starts and ends with 0 or more whatever and there is at least one :digits: or :punct: in between". sed 's/\b.[:digits::punct:]+.\b//g' sed 's/\b.[^:alpha:]+.\b//g' What am I missing? See sample input data below. Thank you! asdf 754m 563 a2a 754mm 291 754n 463 754 ppp 1409 754pin 4652 pin pin 462 754pins 652 754 ppp 1409 754pin 4652 pi$n pin 462 754/p ins 652 754 pp+p 1409 754 p=in 4652

    Read the article

  • Regular Expression to replace part of URL in XML file

    - by Richie086
    I need a regular expression in Notepad++ to search/replace a string. My document (xml) has serveral thousand lines that look similar to this: <Url Source="Output/username/project/Content/Volume1VolumeName/TopicFileName.htm" /> I need to replace everything starting from Volume1 to .htm" / to replaced with X's or some other character to mask the actual file names in this file. So the resulting string would look like this after the search/replace was performed: <Url Source="Output/username/project/Content/Volume1XxxxxxXxxx/XxxxxXxxxXxxx.htm" /> I am working with confidential information that I cannot release to people outside of my company, but i need to send an example log file to a 3rd party for troubleshooting purposes. FYI the X's do not need to follow the upper/lower case after the replacement, i was just using different case X's for the hell of it :)

    Read the article

  • Word Find - find any highlighted text that starts with a squared bracket

    - by user2953311
    Is there a way to Find highlighted text that ONLY begins with a open square bracket? I've tried using the square bracket as a wildcard, but it won't find any adjoining words. For example, I have a document containing conditional paragraphs, in squared brackets, with the "name" of the paragraph highlighted at the beginning: "[Document to return Thank you for sending the documents requested earlier.]" (the section in bold is highlighted in blue in Word) Is there a way to find "[Document to return"? I hope this makes sense Thanks in advance

    Read the article

  • Add constant value to numeric XML attribute

    - by Dave Jarvis
    Background Add a constant value to numbers matched with a regular expression, using vim (gvim). Problem The following regular expression will match width="32": /width="\([0-9]\{2\}\)" Question How do you replace the numeric value of the width attribute with the results from a mathematical expression that uses the attribute's value? For example, I would like to perform the following global replacement: :%s/width="\([0-9]\{2\}\)"/width="\1+10"/g That would produce width="42" for width="32" and width="105" for width="95". Thank you!

    Read the article

  • Trouble Letting Users Get to Certain Sites through Squid Proxy

    - by armani
    We have Squid running on a RHEL server. We want to block users from getting to Facebook, other than a couple specific sites, like our organization's page. Unfortunately, I can't get those specific pages unblocked without allowing ALL of Facebook through. [squid.conf] # Local users: acl local_c src 192.168.0.0/16 # HTTP & HTTPS: acl Safe_ports port 80 443 # File containing blocked sites, including Facebook: acl blocked dst_dom_regex "/etc/squid/blocked_content" # Whitelist: acl whitelist url_regex "/etc/squid/whitelist" # I do know that order matters: http_access allow local_c whitelist http_access allow local_c !blocked http_access deny all [blocked_content] .porn_site.com .porn_site_2.com [...] facebook.com [whitelist] facebook.com/pages/Our-Organization/2828242522 facebook.com/OurOrganization facebook.com/media/set/ facebook.com/photo.php www.facebook.com/OurOrganization My biggest weakness is regular expressions, so I'm not 100% sure about if this is all correct. If I remove the "!blocked" part of the http_access rule, all of Facebook works. If I remove "facebook.com" from the blocked_content file, all of Facebook works. Right now, visiting facebook.com/OurOrganization gives a "The website declined to show this webpage / HTTP 403" error in Internet Explorer, and "Error 111 (net::ERR_TUNNEL_CONNECTION_FAILED): Unknown error" in Chrome. WhereGoes.com tells me the URL redirects for that URL goes like this: facebook.com/OurOrganization -- [301 Redirect] -- http://www.facebook.com/OurOrganization -- [302 Redirect] -- https://www.facebook.com/OurOrganization I tried turning up the debug traffic out of squid using "debug_options ALL,6" but I can't narrow anything down in /var/log/access.log and /var/log/cache.log. I know to issue "squid -k reconfigure" whenever I make changes to any files.

    Read the article

  • How to delete files on the command line with regular expressions?

    - by Jack
    Lets say I have 20 files named FOOXX, where XX is the number of the file, eg 01, 02 etc. At the moment, if I want to delete all files lower than the number 10, this is easy and I just use a wildcard, eg rm FOO0* However, if I want to delete specific files ina range, eg 13-15, this becomes more difficult. rm FPP[13-15] does not work, and asks me if I wish to delete all files. Likewse rm FOO1[3-5] wishes to delete all files that begin with FOO1 So, what is the best way to delete ranges of files like this? I have tried with both bash and zsh, and I don't think they differ so much for such a basic task?

    Read the article

  • sed syntax to remove xml

    - by mjb
    I'm trying to sanitize this output from it's metadata to plug this output into GreekTools, but I am getting stuck on sed. curl --silent www.brainyquote.com | egrep '(span class="body")|(span class="bodybold")' | sed -n '6p; 7p; ' | sed 's/\<*\>//g' [ex] <span class="body">Literature is news that stays news.</span><br> <span class="bodybold">Ezra Pound</span> Could someone help me along on this track?

    Read the article

  • How to search a text file for strings between two tokens in Ubuntu terminal and save the output?

    - by Blue
    How can I search a text file for this pattern in Ubuntu terminal and save the output as a text file? I'm looking for everything between the string "abc" and the string "cde" in a long list of data. For example: blah blah abc fkdljgn cde blah blah blah blah blah blah abc skdjfn cde blah In the example above I would be looking for an output such as this: fkdljgn skdjfn It is important that I can also save the data output as a text file. Can I use grep or agrep and if so, what is the format?

    Read the article

  • Checking version of Applications installed in ~/Applications with unknown username

    - by ridogi
    I'd like to check the version of Firefox through Apple Remote Desktop of all managed computers. I have written this, but it only checks for Firefox in /Applications /bin/cat /Applications/Firefox.app/Contents/Info.plist | grep -A 1 CFBundleShortVersionString | grep string | sed 's/[/]//' | sed 's/<string>//g' For standard users Firefox auto update breaks if it is in /Applications so I instead have it installed in ~/Applications I'd like to check that copy (if it exists), but I can't specify the path in the command since it is unique to each computer. For example: /Users/jon/Applications/Firefox.app /Users/arya/Applications/Firefox.app Presumably I want to use find and pipe the result to my command. This should work for 10.6 through 10.8

    Read the article

  • how to substitude in multiple lines between {{{ and }}} with sed or awk

    - by chris
    First give out the text example: .... text ,.. {{{python string1 = 'abcde' string2 = '12345' print(string1[[1:3]]) print(string2[[:-1]]) }}} .... text ,.. the [[ and ]] happened outside of {{{ too. And maybe there is spaces and tabs before {{{ and }}}. I want to substitude all [[ and ]] into [ and ] between {{{ and }}}. NOTICE: I need to write the result back to original file. ( Maybe sed or awk is not the only way to do this ? )

    Read the article

  • cut text from each line in a txt file

    - by bboyreason
    i have a text file where each line looks like this: <img border=0 width=555 height=555 src=http://websitelinkimagelinkhere> each line is like that for like 1500 lines, i want to sort of 'grep' (i dont think that will work because it returns the whole line) each line for 'http://websiteimagelinkhere' output file should have newlines or tabs after each image link, like the original file. or if someone only knows a way to do this with each element being in a cell of the same column that would be okay too.

    Read the article

  • Debugging nginx URL rewrite: How do I figure out where the problem is?

    - by pjmorse
    I have a specific URL pattern on a site which needs to be redirected to the HTTPS version. This is a Django site; Nginx checks each URL in memcached, and if it doesn't find a cached version it proxies the request to Apache/mod_python for Django to render the page. The relevant configuration block is rewrite ^/certificate https://mysite.com/certificate ; rewrite ^/([a-zA-Z]{2})/certificate https://mysite.com/certificate ; ...and it doesn't appear to be working at all. Nginx is: $ nginx -V nginx version: nginx/0.7.65 built by gcc 4.2.4 (Ubuntu 4.2.4-1ubuntu4) TLS SNI support disabled configure arguments: --prefix=/usr/local/nginx --pid-path=/var/run/nginx.pid --with-http_gzip_static_module --with-http_ssl_module How can I figure out if the problem is my patterns not matching, or a more obscure configuration problem? (The site is localized to three languages, and the localization is in the URL string, e.g. /US/news/, /DE/about, etc. It tracks localization in the session as well, defaulting to US, so if you just requested /news Django will rewrite to /US/news unless the user has a cookie indicating they're using a different localization. Django handles this, though, not Nginx.)

    Read the article

  • set chars to uppercase between parenthesis

    - by emzap79
    let's assume in vim I have following lines: all what (strong) people have to do is pushing (heavy) weights over (and over) again in order to gain muscles and I need to convert words inside parenthesis to uppercase, what is the most convenient way to do so? How do I tell vim it needs to select everything to the first (!) closing parenthesis? So far I came up with :%s/\s(.*)\s/\U&/g unfortunately this will uppercase everything between 'strong' and 'heavy' which is not what I want. Any chance to tell vim it should select the chars to the next closing bracket only? (sorry for the silly example, couldn't think of something more sophisticated... or at least vim related... huh)

    Read the article

  • Search for specific call in asterisk log files

    - by chiborg
    In my Asterisk log file, I have a line like this (truncated): Executing [123@mycontext:1] Set("SIP/myhost-b7111840", "__INCOMINGCLI=4711") Now I want to do the following filtering while looking at the log file with tail -f: Match lines with a specific value for "INCOMINGCLI", storing the call ID (the "SIP/myhost-b7111840" part) Output all subsequent lines that contain the call ID. As a bonus, having a grep-like option like -A would be nice. I could do that easily in various programming languages, but how would I do it with standard UNIX commands like sed or awk? Can it be done with these commands?

    Read the article

  • nginx rewrite base url

    - by ptn777
    I would like the root url http://www.example.com to redirect to http://www.example.com/something/else This is because some weird WP plugin always sets a cookie on the base url, which doesn't let me cache it. I tried this directive: location / { rewrite ^ /something/else break; } But 1) there is no redirect and 2) pages start shooting more than 1,000 requests to my server. With this one: location / { rewrite ^ http://www.example.com/something/else break; } Chrome reports a redirect loop. What's the correct regexp to use?

    Read the article

  • Notepad++ Search & Replace with Regular Expressions

    - by Jeremy
    I know its simple, but I can't get it to work... I have a strings like {span style="display:none"}123{/span} and {span style="display:none"}456{/span} and {span style="display:none"}789{/span} in a file. I want to remove all of these string. So, I thought a simple regular expression replace in NotePad++ should be like {span style="display:none"}[(.)]{/span} but, this is not working. Thank for your help!

    Read the article

  • Zabbix doesn't update value from file neither with log[] nor with vfs.file.regexp[] item

    - by tymik
    I am using Zabbix 2.2. I have a very specific environment, where I have to generate desired data to file via script, then upload that file to ftp from host and download it to Zabbix server from ftp. After file is downloaded, I check it with log[] and vfs.file.regexp[] items. I use these items as below: log[/path/to/file.txt,"C.*\s([0-9]+\.[0-9])$",Windows-1250,,"all",\1] vfs.file.regexp[/path/to/file.txt,"C.*\s([0-9]+\.[0-9])$",Windows-1250,,,\1] The line I am parsing looks like below: C: 8195Mb 5879Mb 2316Mb 28.2 The value I want to extract is 28.2 at the end of file. The problem I am currently trying to solve is that when I update the file (upload from host to ftp, then download from ftp to Zabbix server), the value does not update. I was trying only log[] at start, but I suspect, that log[] treat the file as real log file and doesn't check the same lines (althought, following the documentation, it should with "all" value), so I added vfs.file.regexp[] item too. The log[] has received a value in past, but it doesn't update. The vfs.file.regexp[] hasn't received any value so far. file.txt has got reuploaded and redownloaded several times and situation doesn't change. It seems that log[] reads only new lines in the file, it doesn't check lines already caught if there are any changes. The zabbix_agentd.log file doesn't report any problem with access to file, nor with regexp construction (it did report "unsupported" for log[] key, when I had something set up wrong). I use debug logging level for agent - I haven't found any interesting info about that problem. I have no idea what I might be doing wrong or what I do not know about how Zabbix is performing these checks. I see 2 solutions for that: adding more lines to the file instead of making new one or making new files and check them with logrt[], but those doesn't satisfy my desires. Any help is greatly appreciated. Of course I will provide additional information, if requested - for now I don't know what else might be useful.

    Read the article

  • Change number in last row in data seperated with commas in NotePad++

    - by user329311
    I have rows of data all separated with commas. How can I replace the last numbers after the last commas with the number 5 in NotePad++? For example: How do I replace 9, 17 and 124 with 5 in the below data? I have millions of rows though of data and Excel doesn't have enough rows for all the data. Sample data: 2009.10.21,05:31,1.49312,1.49312,1.49306,1.49306,9 2009.10.21,05:32,1.49306,1.49308,1.49303,1.49305,17 2009.10.21,05:33,1.49305,1.4931,1.49305,1.49309,124 Thank you for your help.

    Read the article

  • sed: replace only the first range of numbers

    - by Marit Hoen
    Imagine I have an input file like this: INSERT INTO video_item_theme VALUES('9', '29'); INSERT INTO video_item_theme VALUES('19', '312'); INSERT INTO video_item_theme VALUES('414', '1'); And I wish to add 10000 to only the first range of numbers, so I end up with something like this: INSERT INTO video_item_theme VALUES('10009', '29'); INSERT INTO video_item_theme VALUES('10019', '312'); INSERT INTO video_item_theme VALUES('10414', '1'); My approach would be to prefix "1000" to one digit numbers, "100" Something like...: sed 's/[0-9]\{2\}/10&/g' ... isn't very helpful, since it changes each occurance of two numbers, not only in the first occurance of numbers: INSERT INTO video_item_theme VALUES('9', '10029'); INSERT INTO video_item_theme VALUES('10019', '100312'); INSERT INTO video_item_theme VALUES('100414', '1');

    Read the article

  • How can I delete everything after the first column in Notepad++?

    - by Bob J
    I'm trying to get rid of everything after a column in Notepad++. Column mode is not an option. Is it possible? What I have 70.97.110.40 159 ms [n/a] 21 70.97.117.177 134 ms [n/a] 21 70.97.120.10 75 ms [n/a] 21 70.97.122.105 87 ms www.portless.net 21 70.97.122.106 89 ms www.popovetsky.org 21 70.97.122.107 95 ms www.psmythe.net 21 70.97.122.104 98 ms wasabi.prostructure.com 21 70.97.122.108 89 ms crm.prostructure.com 21 70.97.122.109 87 ms internal.prostructure.com21 What I want 70.97.110.40 70.97.117.177 70.97.120.10 70.97.122.105 70.97.122.106 70.97.122.107 70.97.122.104 70.97.122.108 70.97.122.109 Thanks

    Read the article

  • Textmate: Find and replace across project with contents of one file from said project

    - by griotspeak
    I have a regular expression to find the text I want (I wrapped the relevant section in custom tags), and I can do it by hand without much issue, but what I want is a way to automatically find and replace throughout the entire project. A macro seems like an OK idea, but it would be nice to have a command (to edit and tweak). sed seems like a good bet, but I am pretty unfamiliar with it. I am not so much asking for a complete solution as I am asking for an example that does something close to what I want. I don't really know of a good way to start.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

< Previous Page | 63 64 65 66 67 68 69 70 71 72 73 74  | Next Page >