Search Results

Search found 38141 results on 1526 pages for 'google chrome os'.

Page 672/1526 | < Previous Page | 668 669 670 671 672 673 674 675 676 677 678 679  | Next Page >

• Blacklist a single access point of a wireless network

  - by Zr40

  At my university, one of the wireless access points is failing. When something tries to associate to the network using that access point, it deassociates the client, claiming 802.1X authentication failure. Other access points do work normally using the same credentials. The issue has been reported, but after a month it still has still not been fixed. Now, I'm looking for a way to blacklist the access point's BSSID, so the OS prefers other access points on the same SSID. How can I blacklist specific BSSIDs in either Mac OS X Snow Leopard or Windows 7?

  Read the article

• Eclipse Juno Switch Editor in Order

  - by inspectorG4dget

  In case it matters: OS: Mac OS X Lion (10.7.4) Eclipse: Juno, Build id: 20120614-1722 I have several files open in my eclipse workspace as tabs. The default shortcuts for previous and next editors are ?F6 and ?shiftF6. I know how to change these shortcuts, that's not the issue. However, what I want to do, is switch between editors in the way in which they're ordered in the tab bar. Currently, the editors change in order of last used/viewed. So, if I had three files (A, B and C in order) open and I'm currently editing A and I edited B last, when I use the shortcut for "Previous Editor", it takes me to B instead of C (and vice versa). Is there any way for me to get this functionality out of eclipse (if so, how)? Thank you

  Read the article

• Solaris 11 installed, no updates?

  - by Paul De Niro

  I was messing around with solaris and decided to give Solaris 11 a try so I downloaded it from the Oracle website. After installing the OS, I went into the package manager and did an update. It told me that there were to available updates! I find this hard to believe considering that it's running a vulnerable version of firefox and java, its own in-house software product! Many of the other software products that came with the default install are also out of date and vulnerable. Is this normal for an Oracle install, or did I do something wrong with the upgrade process? I typed "pkg update" at the prompt, and I noticed that it did call out to pkg.oracle.com looking for updates. I find it bizarre that there are no updates available for an OS that was released a couple months ago with vulnerable software...

  Read the article

• Compiz problems in Ubuntu 12.10

  - by Antonio Raffaele Iannaccone

  I have installed ubuntu 12.10 x64 on my notebook and I wanted to make a little customization in the UI, so i downloaded Compiz Settings Manager and opened it up. Once I opened it up, I found out that in the compiz are not all those settings and animations (that I could apply like on the photos, videos etc.) so I reinstalled it few times. Once I get bored with the reinstalling I checked one field in there and Ubuntu (OS) started to get "lagged" (Dash get hid, OS started to do not respond very well). So please, can anyone help me? How can I customize my ubuntu without get lagged and with all the animations that have to be available in the compiz? Thanks to all! thank you! It seems that it helped to fix the Dash-hide problem, but I still do not have all the animations and features that have to be in the Compiz (program). Can you help me with this too please? Thanks a lot!

  Read the article

• node.js server not running

  - by CMDadabo

  I am trying to learn node.js, but I'm having trouble getting the simple server to run on localhost:8888. Here is the code for server.js: var http = require("http"); http.createServer(function(request, response) { response.writeHead(200, {"Content-Type": "text/plain"}); response.write("Hello World"); response.end(); }).listen(8888); server.js runs without errors, and trying netstat -an | grep 8888 from terminal returns tcp4 0 0 *.8888 *.* LISTEN However, when I go to localhost:8888 in a browser, it says that it cannot be found. I've looked at all the related questions, and nothing has worked so far. I've tried different ports, etc. I know that my router blocks incoming traffic on port 8888, but shouldn't that not matter if I'm trying to access it locally? I've run tomcat servers on this port before, for example. Thanks so much for your help! node.js version: v0.6.15 OS: Mac OS 10.6.8

  Read the article

• What is the simplest way for a slippy SVG visualization?

  - by totymedli

  I have a big SVG file representing a complicated graph with hundreds of points. I want to represent this in a web page. My idea was that I could make it like Google Maps represent their maps, in those slippy, dragable, moveable maps. I'am looking for an easy and fast JavaScript library which could do the work. What I need for my "map" is the drag/move, zoom ability, and some way to click on the points of the picture, which makes a little information apear about that point, like Google maps markers. I'am looking for a free/open source library. I saw some solutions but I'am uncertain about them, and none of them seemed to be perfet: Polymaps - I love the technique it uses, but I don't know much about this library. Leaflet - I love the simplicity of it, but I dont know how could I apply it for my SVG. Raphael - I heard the awesomeness of this, but It seemed a lots of work to do this task. What would be the best/easiest solution for my problem, and what is your opinion aboute the above libraries?

  Read the article

• What do I do for dependencies installing wine1.7 on 14.04

  - by user285207

  user@chrubuntu:~$ sudo apt-get install wine1.7 [sudo] password for user: user Sorry, try again. [sudo] password for user: Reading package lists... Done Building dependency tree Reading state information... Done Some packages could not be installed. This may mean that you have requested an impossible situation or if you are using the unstable distribution that some required packages have not yet been created or been moved out of Incoming. The following information may help to resolve the situation: The following packages have unmet dependencies: wine1.7 : Depends: wine1.7-i386 (= 1:1.7.19-0ubuntu2~trusty2) but it is not installable Recommends: gnome-exe-thumbnailer but it is not going to be installed or kde-runtime but it is not going to be installed Recommends: ttf-mscorefonts-installer but it is not going to be installed Recommends: fonts-horai-umefont but it is not going to be installed Recommends: fonts-unfonts-core but it is not going to be installed Recommends: ttf-wqy-microhei Recommends: winetricks but it is not going to be installed E: Unable to correct problems, you have held broken packages. user@chrubuntu:~$ Trying to install wine1.7 on Ubuntu 14.04 64 bit, and i'm not sure what this means, help is greatly appreciated. I already ran sudo apt-get update and get this: Reading package lists... Done W: Duplicate sources.list entry http://dl.google.com/linux/chrome/deb/ stable/main amd64 Packages (/var/lib/apt/lists/dl.google.com_linux_chrome_deb_dists_stable_main_binary-amd64_Packages) W: You may want to run apt-get update to correct these problems So I run apt-get update and: E: Could not open lock file /var/lib/apt/lists/lock - open (13: Permission denied) E: Unable to lock directory /var/lib/apt/lists/ E: Could not open lock file /var/lib/dpkg/lock - open (13: Permission denied) E: Unable to lock the administration directory (/var/lib/dpkg/), are you root? This is all very stressing because I have been trying to get Wine for the past week and had to reinstall and IT STILL WON'T WORK.

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Is it OK to create all primary partitions.?

  - by james

  I have a 320GB hard disk. I only use either ubuntu or kubuntu (12.04 for now). I don't want to use windows or any other dual boot os. And i need only 3 partitions on my hard disk. One for the OS and remaining two for data storage. I don't want to create swap also. Now can i create all primary partitions on the hard disk. Are there any disadvantages in doing so. If all the partitions are primary i think i can easily resize partitions in future. On second thought i have the idea of using seperate partition for /home. Is it good practice . If i have to do this, i will create 4 partitions all primary. In any case i don't want to create more than 4 partitions . And i know the limit will be 4. So is it safe to create all 3 or 4 primary partitions. Pls suggest me, What are the good practices . (previously i used win-xp and win-7 on dual boot with 2 primary partitions and that bugged me somehow i don't remember. Since then i felt there should be only one primary partition in a hard disk.) EDIT 1 : Now i will use four partitions in the sequence - / , /home , /for-data , /swap . I have another question. Does a partition need continuous blocks on the disk. I mean if i want to resize partitions later, can i add space from sda3 to sda1. Is it possible and is it safe to do ?

  Read the article

• How to partition my hard drive, quicker?

  - by Sam

  When I install Windows 7 on my hard drive, it makes three partitions. One with the OS itself, one with bootmgr inside (that is 100 MiB), and one with the factory image (all the crapware from HP). My final goal is to have the OS on a partition of 100 GiB and keep the rest (900 GiB) for storage. I thought it would be easy using gparted, but it is taking so long. It will take hours. There must a way to partition the drive before installing Windows. Yeah, because what I think makes the shrinking/moving of the partitions take so long is because they are not empty (am I wrong?).

  Read the article

• Starting VM as an executable with as low overhead as possible

  - by Robert Koritnik

  Is there a solution to create a virtual machine and start it by having an executable file, that will start the machine? If possible to start as quickly as possible. Strange situation? Not at all. Read on... Real life scenario Since we can't have domain controller on a non-server OS it would be nice to have domain controller in an as thin as possible machine (possibly Samba or similar because we'd like to make it startup as quickly as possible - in a matter of a few seconds) packed in a single executable. We could then configure our non-server OS to run the executable when it starts and before user logs in. This would make it possible to login into a domain.

  Read the article

• Why am I getting [mount error(22): Invalid argument] while trying to mount SMB network drive?

  - by Steve_

  Disclaimer: I am very new to Linux :) Anyway, onward: I have a fresh instance of Ubuntu Server (12.04.1 LTS) running on my network and I want to mount a network drive to the server so I can access the contents. The network drive is a SAMBA compatible drive running Darwin OS. If I run the following command: smbclient -L //192.168.0.2 -U myuser It prompts me for the password and then displays output similar to: Domain=[SERVER01] OS=[Darwin] Server=[@(#)PROGRAM:smbd PROJECT:smbx-105.4.0] Sharename Type Comment --------- ---- ------- Comp Staff's Public Folder Disk CompRaid03 Disk Dropbox Disk Groups Disk IPC$ IPC Public Disk Users Disk compstaff Disk However, when I try and mount the CompRaid03 share, using this command: sudo mount -t cifs //192.168.0.2/CompRaid03 /mnt/myshare -o username=myuser I get the same password prompt, but after putting the correct password in, I received this error: mount error(22): Invalid argument dmesg | tail returns: [23576.037373] CIFS VFS: cifs_mount failed w/return code = -22 I don't understand what is wrong with this command. I've managed to mount a share on my current (Windows 8) machine using basically the same command but with a different IP address and share name (obviously). I've spent a good few hours trying to solve this and got no where. Any help or pointers would be greatly appreciated. Thanks Steve EDIT As suggested I've also trued using "user=" instead of "username=": sudo mount -t cifs //192.168.0.2/CompRaid03 /mnt/svnrepo -o user=myuser This results in the same "Invalid argument" error.

  Read the article

• Multi-monitor resolution and position settings lost after reboot

  - by SoftDeveloper

  I've had two 1280x1024 monitors running for years on an nVidia 8800GT card with no problems. I've now replaced one monitor with a new 2560x1440 one. The card seems to support both fine, however every time I reboot the resolutions and monitor positions revert to the old settings. I've tried upgrading, downgrading, stripping out and reinstalling many versions of the nvidia drivers to no avail. Logging in as another user doesn't help - same problem. Booting into another another OS (Win7 64) works OK, so it is just this OS installation. During boot up everything looks fine (ie native 2450x1440 res) until the nVidia control panel or something is loaded which flips it back into the old mode. I have no old saved nvidia profiles. I can't find anything in the registry relating to these old settings. Its driving me crazy having to set resolutions and realign monitors on every reboot! Can anybody help?

  Read the article

• Building intranet search

  - by gmkv

  At work, we have lots of information squirreled away in many different sites -- wikis, product docs, ticketing system, etc -- many of which require authentication. I'm very interested in having a single way to search all our various silos, and in my spare time have looked at Nutch, Grub, Django + Haystack, etc. None of these is a complete solution a la Google Mini or Google Search Appliance. Has anybody built a basic intranet search engine out of a mixture of these tools? Would you have recommendations about how to go about it? I like Django, and Haystack seems to be a mildly popular search solution for it, but I'd need to wire up a crawler that can support crawling authenticated sites to it.

  Read the article

• Top causes of slow ssh logins

  - by Peter Lyons

  I'd love for one of you smart and helpful folks to post a list of common causes of delays during an ssh login. Specifically, there are 2 spots where I see a range from instantaneous to multi-second delays. Between issuing the ssh command and getting a login prompt and between entering the passphrase and having the shell load Now, specifically I'm looking at ssh details only here. Obviously network latency, speed of the hardware and OSes involved, complex login scripts, etc can cause delays. For context I ssh to a vast multitude of linux distributions and some Solaris hosts using mostly Ubuntu, CentOS, and MacOS X as my client systems. Almost all of the time, the ssh server configuration is unchanged from the OS's default settings. What ssh server configurations should I be interested in? Are there OS/kernel parameters that can be tuned? Login shell tricks? Etc?

  Read the article

• Installing drivers and getting -> Error Code 28

  - by Adrov

  I've recently upgraded mainboard, without reinstalling OS, so I guess that's the issue. I really don't want to install OS at this moment. Issue is I can't install USB drivers, if I right-click uninstall, just installs same driver, which isn't working ofc. and giving error code 28. I fixed such issue once long long time ago, with editing registry, but I really can't remember what and where I have to do, so if anyone know please let me know, I'm also open to all other solutions to this issue. http://i.stack.imgur.com/AuBtB.png

  Read the article

• Squid throws error, The requested URL could not be retrieved

  - by Supratik

  Hi Sometimes I am getting the following error The requested URL could not be retrieved While trying to retrieve the URL: http://groups.google.com/ The following error was encountered: Unable to determine IP address from host name for groups.google.com The dnsserver returned: Refused: The name server refuses to perform the specified operation. This means that: The cache was not able to resolve the hostname presented in the URL. Check if the address is correct. Your cache administrator is root. What could be the reason for the above error ? Regards Supratik

  Read the article

• Sudden complaint that Windows is not genuine - some questions

  - by blade

  Hi, I used to use VMWare Workstation and made several VMs with Win Server 2008, which worked fine. My first tasks were to setup RDP, updates, and activate the OS. I deleted Workstation and thus did not have my VMs available to use for about 2 months. Now I have VMWare Server 2.0.2 as I this is free and I am going to get Hyper-V on a host Win Server in about March, but when I have accessed one of my VMs (haven't tried the others yet), it complains that the copy of Windows is not genuine. I now have a black screen but can access all my apps on the VM. Will the OS eventually shut me out from accessing it? I got my key from the Action Pack but the standard R2 key has been taken down and replaced with the Enteprise R2 key. I have Enterprise R2 but apparently the autorun is corrupt! Thanks

  Read the article

• Migrating users and IIS settings from a workgroup win2k3 machine to a new win2k8r2

  - by amber

  I am retiring my old Windows Server 2003 Standard 32bit machine to a new machine with Windows Server 2008 R2 Standard. The two sticking points are migrating user accounts (and there are a lot of them) and IIS settings/websites (again, there are a lot). The new machine has not been provisioned yet. I'm at that point where I'm about install the OS on it. The old machibe is configured with a mirrored set for its OS and data partitions. I have broken the mirror set, replicated all of the data to an external drive, and then rebuilt the mirror set. In short, I have an image of the old machine to play with while safely leaving it up and running. Thanks!

  Read the article

• Win7 Professional x64 16GB (4.99GB usable)

  - by Killrawr

  I've installed Corsair Vengeance CMZ16GX3M2A1600C10, 2x8GB, DDR3-1600, PC3-12800, CL10, DIMM and my BIOS picks up that there is 16GB, Windows says there is 16GB, CPU-z says there is 16GB. But it only says I can use 4.99GB out of 16GB. Motherboard is P55-GD65 (MS-7583) Supports four unbuffered DIMM of 1.5 Volt DDR3 1066/1333/1600*/2000*/2133* (OC) DRAM, 16GB Max Windows (Above screenshot specifies that I am on a System type: 64-bit OS) CPU-z Microsoft says that the physical memory limit on a 64 bit win7 professional operating system is 192GB. Dxdiag Run Command BIOS Screenshot #1 BIOS Screenshot #2 Why is my OS limiting me to just over a quarter of the available memory? is there anyway to increase it?

  Read the article

• how to recover lost partitions data

  - by TheJoester

  I have a 2TB SATA drive that was being used as file storage on my UBUNTU computer. I was re-imaging my windows box so I used that drive to back up some files to it. I did this by taking the drive from my windows PC and putting it in my UBUNTU PC, mounted it and copied the files over. After the windows refresh I thought it would be easier to take the 2 TB drive and dock it in the external dock my Windows case has built in. Anyway it would recognize in BIOS but windows would not see it (because it was EXT3 or EXT4) so when I went into the disk manager it advised me the drive needed to be initialized. Me not thinking I initialized it as a GUID Partition table. Now it sees it as a blank drive, even in UBUNTU. I have done nothing else to write or change the drive. I was wondering if there is a qay to repair the old partitioning and get access to my files back? many thanks! EDIT: I followed the instructions in the link @kniwor sent me. I used the command sudo gpart -W /dev/sda /dev/sda and here was the result: Guessed primary partition table: Primary partition(1) type: 007(0x07)(OS/2 HPFS, NTFS, QNX or Advanced UNIX) size: 0mb #s(1) s(2861671176-2861671176) chs: (1023/254/63)-(1023/254/63)d (178130/202/1)-(178130/202/1)r Primary partition(2) type: 007(0x07)(OS/2 HPFS, NTFS, QNX or Advanced UNIX) size: 0mb #s(1) s(3484550160-3484550160) chs: (1023/254/63)-(1023/254/63)d (216903/55/1)-(216903/55/1)r Primary partition(3) type: 000(0x00)(unused) size: 0mb #s(0) s(0-0) chs: (0/0/0)-(0/0/0)d (0/0/0)-(0/0/0)r Primary partition(4) type: 000(0x00)(unused) size: 0mb #s(0) s(0-0) chs: (0/0/0)-(0/0/0)d (0/0/0)-(0/0/0)r Not sure it found what I wanted. suggestions?

  Read the article

• Why is heap size fixed on JVMs?

  - by themel

  Can anyone explain to me why JVMs (I didn't check too many, but I've never seen one that didn't do it that way) need to run on a fixed heap size? I know it's easier to implement on a simple contiguous heap, but the Sun JVM is now over a decade old, so I'd expect them to have had time to improve this. Needing to define the maximum memory size of your program at startup time seems such a 1960s thing to do, and then there are the bad interactions with OS virtual memory management (GC retrieving swapped out data, inability to determine how much memory the Java process is really using from the OS side, huge amounts of VM space wasted (I know, you don't care on your fancy 48bit machines...)). I also guess that the various sad attempts to build small operating systems inside the JVM (EE application servers, OSGi) are at least partially to blame on this circumstance, because running multiple Java processes on a system invariably leads to wasted resources because you have to give each of them the memory it might have to use at peak. Surprisingly, Google didn't yield the storms of outrage over this that I would expect, but they may just have been buried under the millions of people finding out about fixed heap size and just accepting it for a fact.

  Read the article

• Procedure for dual booting (2 copies of Win-7) off 2 partitions on same disk

  - by Sam Holder

  What procedure should I follow to set a dual boot (both Win-7 x64) on a machine where (ideally): Both operating systems will be installed on the same physical disk in different partitions When booting into either operating system the contents of the other OS partition disk will not be seen (this just seems safer) Other hard drives in the system will be visible by both OS's 1 copy of Win7 is already installed. Is it as simple as shrinking the existing volume and creating the partition, then sticking the CD in and booting off it and formatting the new partition and then installing another copy of windows onto the new partition? Or will that not work? Or are there gotchas?

  Read the article

• How to use HFS formatted pen drive in Windows 7?

  - by row-sun

  I recently used disk utility in my mac book pro to format my 8 GB pen drive to install OS X. After that I formatted my pen drive from disk utility as FAT32 so that I would be able to use it in windows. But in windows the pen drive does not show up. When I right click on my computer and click manage and then disk management, the pen drive is listed there, but it doesn't show up in the explorer and I cant use it. I tried to do many things but I'm still not being able to use it in windows though I can use it in Mac OS X. Could anyone help? Thanks.

  Read the article

• How do I monitor my PC and see what people do when they're on my PC?

  - by bigitalynyc

  I need to know what people are doing when they use my PC? The OS is Windows XP.

  Read the article

< Previous Page | 668 669 670 671 672 673 674 675 676 677 678 679  | Next Page >