Search Results

Search found 89481 results on 3580 pages for 'new technology'.

Page 683/3580 | < Previous Page | 679 680 681 682 683 684 685 686 687 688 689 690  | Next Page >

  • Directory "Bookmarking" in Linux

    - by Jason R. Mick
    Aside from aliasing and links, is there an easy way in Linux to tag commonly used directories and to navigate to a commonly used directory from the terminal. To be clear the disadvantages I see with alternative approaches, and why I want a bookmark/favorites like system: alias Cons: Too specific (every new favorite requires a new alias...although you could in theory make an alias that echo append your dir as a new alias, which would be sort of clever). Can't nest favorites in folders (can't think of a simple solution to this outside of heavy config scripting). links Cons: Clutter directory make ls a headache. pushd/popd Cons: Non-permanent (without shell config file scripting), can't nest favorites in directories, etc. Granted I have multiple ideas for making my own non-standard solution, but before I have at it I wanted to get some perspective on what's out there and if there is nothing, what is a recommended approach. Does anyone know of such a favorites/bookmark-like terminal solution?

    Read the article

  • Copying Data from another Excel Workbook based on a matching id

    - by Kyle Begeman
    I have 2 workbooks I am working with. One workbook has an id and a category name. The other workbook shows a name and category section that has an id number (but not the actual description). Basically I want to copy the full category text to my current workbook from the old one based on the id number into a new column What kind of formula can I use to check the id number category pair and then copy it into the new workbook in a new column? Any help is great!

    Read the article

  • Extensions disappear when I close and open Google Chrome

    - by PavanM
    I am running the latest version of Google Chrome 23.0.1271.97 (Official Build 171054) m on Windows 7. Any new extension I install simply disappears(not disabled, total disappearance) once I close and re-start google chrome. This is not happening to one of my old extension. It stays there across chrome re-starts. I tried everything google help suggested- I created new user profile by renaming the Defaults folder I checked for any permission change that the extensions might have undergone. This is not the case. I am not running in developer mode. This happens when I close ALL instances of google chrome. Even if one instance of chrome is running, this doesn't happen. But I cant have an instance of Google Chrome always running :( I even reported the issue to Google Chrome team to no avail and new.crbug.com is offline. And I skimmed through many threads opened for the same issue only to find souls like me. SE is my last resort :)

    Read the article

  • Will Windows Barf on Constant Video Driver Overwrite?

    - by Maarx
    So, I've got a Win7 64-bit gaming PC with GTX 260's. Recently, StarCraft 2 had an issue with flickering, which NVidia fixed with a new set of drivers. However, these new drivers induce unplayable graphical errors with Neverwinter Nights 2, something me and my friends still play from time to time. I am seeking advice on the "best" way to rectify this situation, to be able to switch between two driver releases, without compromising the stability of my system (if Windows stability isn't an oxymoron). I'm wondering if Windows 7 is structured in such a way that I can constantly reinstall these two sets of drivers back and forth overtop each other, possibly six or eight times a day, without very quickly driving myself to reformat to maintain that "just like new" performance. I'm loathe to have to reformat the drive and maintain two copies of the operating system, but I'll do it if I have to.

    Read the article

  • 'IPv6' Newbie with IPv6 address assigment

    - by Cute Puppy
    I am new to IP v6 and I am looking to translate some existing private IPv4 addresses into v6 address assignment. Can someone please help me to answer/explain the questions below? If I have an v4 address of: 10.10.0.0/22 10.10.1.0/22 10.10.2.0/22 10.10.3.0/22 10.10.8.0/20 10.20.1.0/24 What will the new v6 address to be? I have been looking online @ http://www.subnetonline.com/pages/subnet-calculators/ipv4-to-ipv6-converter.php or other sites, Seems like they translated it directly to be: fe80::a0a:0 /118 fe80::a0a:100 /118 fe80::a0a:200 /118 fe80::a0a:300 /118 fe80::a0a:800 /118 fe80::a14:100 /120 Can someone please explain to me how we get to /118 from either "/22 or /24" (1. and 5) In addition, I would like to create the new private address based on the Unique local address "fc00::/16" How do I expand from there? Any help is greatly appreciated it!! Thanks,

    Read the article

  • Cisco ASA 5505 inside interface multiple ip addresses

    - by Oneiroi
    I have an issue this morning where I want to be able to assign multiple ip addresses to the inside interface to facilitate an ip range migration for an office. Namely from a 192.168.1.x range to the new range, with the minimum of interruption for those working in the office. (New DHCP leases will use the new range, whilst those still on the 192.168.1.x range can continue to work until their lease is renewed). However I can not for the life of me figure out how to achieve this, trying to create multiple interfaces for the job leads to complaints about the license only allowing 2 active interfaces. Any suggestions? thanks in advance.

    Read the article

  • Where are Wireless Profiles stored in Ubuntu

    - by LonnieBest
    Where does Ubuntu store profiles that allow it to remember the credentials to private wireless networks that it has previously authenticate to and used? I just replaced my Uncle's hard drive with a new one and installed Ubuntu 10.04 on it (he had Ubuntu 9.10 on his old hard drive. He is at my house right now, and I want him to be able to access his private wireless network when he gets home. Usually, when I upgrade Ubuntu, I have his /home directory on another partition, so his wireless profile to his own network persists. However, right now, I'm trying to figure out which .folder I need to copy from his /home/user folder on the old hard drive, to the new hard drive, so that he will be able to have wireless Internet when he gets home. Does anyone know with certainty, exactly which folder I need to copy to the new hard drive to achieve this?

    Read the article

  • I cannot access my flickr account

    - by AtanuCSE
    I was using Google account to log in to my Flickr. After several days, I entered into the Flickr account and found out that Flickr is moving into only Yahoo login. So I tried the Google login and it shows This account is not connected with any Yahoo account. Sign up for new........ or use existing etc... Can't remember the exact words. So I provided my Yahoo mail credentials. Now every time it is giving me a brand new account, rather taking me to my previous Flickr account. I can view the previous account photos, but After going there, it treated me as a outsider. New account showing me that I've not uploaded any photo. What's wrong? How can I connect with my previous account?

    Read the article

  • Moving Domain Controller Guests between Hyper-V Hosts

    - by Jim
    We're moving our domain controller to a new Hyper-V host. I read it on TechNet about not using export on a VM running as DC (although I saw a lot of answers on TechNet suggesting doing so to move DC). What we plan to do is shutdown the VM, move the VHD to the new Hyper-V host, then create a new VM using that VHD. I don't think USN rollback would occur since it's like shutting down the VM and starting it back up. We have another Hyper-V host with a DC guest that will be running during the migration. All the hosts and VMs are running Windows Server 2008 R2. Is it a good way to move virtualize DC b/t hosts? If not, how should I proceed?

    Read the article

  • how to set up domain name, bad request invalid hostname

    - by user45645
    assume i have a domain name which will be forwarded to my public ip (web server) automatically. in IIS 6, ip is public ip port is 6666, advanced - host value is www.hello.com firewall is open for 6666(web server port) and 53(DNS port), DMZ of router is my physical address in DNS, i have already had a zone called oldhello.com. And i expect a new domain name. So i have addded a new zone called hello.com and checked SOA server (P) is one.hello.local. then added a new host called one, full name is one.hello.com, ip address 192.168.7.3(my address in router) and then add a alias(CNAME) www, full name is www.hello.com, FQDN i choose the host i added before (one.hello.com) i expected that when i type the public ip in browser, can it be changed to domain name automatically. if not set host value www.hello.com, use public ip i can see the web however, after set up host value www.hello.com, browser show bad request invalid hostname

    Read the article

  • How do I remotely run a Powershell workflow that uses a custom module?

    - by drawsmcgraw
    I have a custom Powershell module that I wrote for various tasks. Now I want to craft a workflow whose activities will use commands from the module. Here's my test workflow: workflow New-TestWorkflow{ InlineScript { Import-Module custom.ps1 New-CommandFromTheModule } } Then I run the workflow with: New-TestWorkflow -PSComputerName remoteComputer When I do this, the import fails because it can't find the module. I imagine this is because the workflow is executing on the remote machine, where my module does not exist. I can see myself running this across many machines so I'd really rather not have to install this module and maintain it on all of the machines. Is there some way to have my module in a central place and use it in workflows?

    Read the article

  • safari 5 doesnt work on my computer.

    - by Amairani409
    I just got the new version of safari y downloaded because my mac tell me there was new version that I should be getting. but when I try to run my this new version of the aplication .nothing happends¡ I mean the program seems to be working but nothing apears in the screen and so when I try to see my top sites a little window show up but it just dont show anything. then 3 seconds later the program shut down¡ I dont know why is happening this Im not so a expert in computers but this really is away of all I see on safari and on mac I got Mac OS X version 10.5.8 2.66ghz intel core 2 duo 4gb 1067 MHz DDR3

    Read the article

  • Applescript won't open applications on my external monitor

    - by jpadvo
    I'm trying to open a new MacVim window with Applescript, and have found partial success with this: do shell script "cd \"~/code/application\"; ~/bin/mvim > /dev/null 2>&1" This works fine, and opens a new MacVim window with it's working directory set to ~/code/application. BUT it always opens on the screen of my laptop, not on the external monitor with the currently active space where I am working. Is there a way to get MacVim to open in the current space? Edit: same problem with opening a finder window: tell application "Finder" to make new Finder window

    Read the article

  • How to handle knowledge handover effectively?

    - by Zizzencs
    Let's say a large enterprise opens a new office in (insert random location here) and want the new colleges up to speed as fast as possible. Let's also say this enterprise is a very typical one with a complex environment, lots of history and almost full lack of documentation. What's already been decided is that the new colleges will receive howto-style documentation for the most typical tasks and will get seme architecture documentation for some of the more complicated systems. Any ideas about improving this process? And more specifically, how should such a howto document look like to be helpful?

    Read the article

  • .htaccess redirect root directory and subpages with parameters

    - by wali
    I am having difficulty trying to redirect a root directory while at the same time redirect pages in a sub directory to a different URL. For example: http://test.example.com/olddir/sub/page.php?v=one to http://test.example.com/new/one while also redirecting the any request to the root of the olddir folder. I have tried RewriteCond %{QUERY_STRING} v=one RewriteRule ^/olddir/sub/page.php /new/? [R=301] and RedirectMatch /oldir "test.example.com" RedirectMatch /olddir/sub/page.php?v=one "test.example.com/new/one" Any help at this point will be extremely appreciated...Thanks!

    Read the article

  • Re-cased my computer now the power plug keeps shorting

    - by dunc
    I've just re-cased my computer. I got the new case free and thought I'd be able to swap everything over myself but apparently I've done something wrong. I'm OK with components generally but wasn't totally confident about doing this. So, my question is, when setting up a new PC or moving old components into a new case, what could I have done which causes the power cable plug to short/fuse when I plug it in?. Is this likely to be an issue with the cables from my PSU, or could it be the internal case connectors? What steps would you take to diagnose the problem? I'd rather not start again if I don't have to...! Thanks in advance,

    Read the article

  • Migrating Magento Concern

    - by Pankaj Upadhyay
    We have a Magento 1.5.0.1 store running at a hosting provider. Now, we need to migrate the same from that server to a new hosting provider. I had talk with a technical guy from the new hosting provider who told me to do following things. Go into the cPanel Backup Wizard . Make a FULL BACKUP and download the zip file Then upload that zip file on their server in my root folder. Then tell them and they will do the restore. My Concern :- Will everything work as expected. What about the connectionstrings and database and all. Will database be automatically created and work the same. Also, somewhere I read that ver 1.5.0.1 used older type of database which might not work on new MySQLs. Can this too have any impact. Should i proceed in the same manner or I need to take care of some additional things to ensure smooth running.

    Read the article

  • How to change the computer name on a server configured by Puppet

    - by David Sulpy
    I am new to Puppet and I'm trying to get Puppet to configure my EC2 instances after they're started from a Cloud Formation Template in AWS. The problem is that all the nodes that get started from the Cloud Formation Template all have the same name (the name from the AMI that the new nodes derive from). I would love to find a way to have puppet rename the nodes when the nodes start up. (although, as far as I know, a Computer Name change requires reboot, a separate issue...) If you can point me to some documentation that can help me figure this out or if you have any ideas that would be great. My ultimate goal is to have each EC2 start with a unique name so that I can use New Relic server monitoring to report the different servers.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • SharePoint Session Management - which SQL Server option?

    - by frumious
    We're developing some custom web parts for our WSS 3 intranet, and have just run into something we'd like to use ASP.NET sessions for. This isn't currently enabled on the development server. We'd like to use SQL Server as the storage mechanism, because the production environment is a web farm with very simple load-balancing. There are 3 options you can choose from to set up the SQL Server session storage, tempdb, default separate DB, named DB. Both tempdb and default separate DB create a new DB to store certain information in; tempdb stores the actual session info in tempdb, which doesn't survive a reboot, and default separate DB stores everything in the new DB. Since you've got to create the new DB either way, my question is this: why would you ever choose to store the session info in tempdb? The only thing I can think of is if you'd like to have the ability to wipe the session by rebooting the server, but that seems quite apocalyptic!

    Read the article

  • A Duplicate name exists on the network

    - by Adam
    Recently we changed out office IT structure from having a dedicated server to be the DC, a dedicated server for the exchange etc... (Each running Windows Server 2003 R2) Now we have a single server running Windows SBS 2008 and created a new domain (with a different domain name) We then changed every PC so it connected to the new domain and renamed every PC with a new naming structure. After I had done this, we were getting several PCs that would get the following message just before the login screen (Alt+Ctrl+Del Screen) A Duplicate name exists on the network I have checked the ADUC and have removed the trouble PCs from the list and renamed each PC and changed the SID before connecting back onto the domain but still getting this message. I have tried everything that i can think of but still getting the problem. Any help would be greatly appreticated.

    Read the article

  • Do I have a bad SD card?

    - by User1
    I'm trying to copy data from my computer to an SD card. After a few hundred megs, I keep getting the following errors in dmesg: [34542.836192] end_request: I/O error, dev mmcblk0, sector 855936 [34542.836284] FAT: unable to read inode block for updating (i_pos 13694981) [34542.836306] MMC: killing requests for dead queue [34542.836310] end_request: I/O error, dev mmcblk0, sector 9280 [34542.837035] FAT: unable to read inode block for updating (i_pos 148486) [34542.837062] MMC: killing requests for dead queue [34542.837066] end_request: I/O error, dev mmcblk0, sector 1 [34542.837074] FAT: bread failed in fat_clusters_flush [34542.837085] MMC: killing requests for dead queue These were all files I copied from a smaller SD card. I just want to transfer them to my new, larger card for my phone. I tried the same experiment with different files on a different machine and the card failed again. Reading data from the old card went fine. My systems are older and the new SD card is new (16GB Class 4). Could this be that my computers are too old? Is there a definitive test to verify if my SD card is bad?

    Read the article

  • Permission denied in Ubuntu

    - by gcc
    I have a file which includes new icons for my system. Anyway, How can I change my old icons down with new ones? The name of the new icon pack is "myFAV-TUX" and it's sitting on my desktop. The problem is, I can't copy them into the usr/share/icons/ folder. It says, permission denied. I also tried ls -l .... But i couldn't do it. How can I change the icon theme? Please help.

    Read the article

  • AS2 Server Software Costs

    - by CandyCo
    We're currently using Cleo LexiCom as our server software for receiving EDI transmissions via the AS2 protocol. We have 7 trading partners per year, and this runs us about $800/year for support from Cleo. We need to expand from 7 trading partners to 10 or so, and Cleo charges roughly $600 per new host, plus an expanded yearly support fee. My question(s) are: Does anyone know of a cheaper developer of AS2 server software, and perhaps one that doesn't charge per new host? Does anyone have any clue why we are being charged an upfront fee for new hosts, and if this is a standard practice for AS2 software providers? It seems really odd that we are required to pay upfront costs for this. I could completely understand an increase in the yearly support, however.

    Read the article

  • DVI monitor detected only on computer startup

    - by kamil
    I've recently connected a new monitor, LG M2252D-PZ, to a rather outdated computer with Windows XP and Radeon 9600. XP has SP3 installed, video drivers are the latest version back from the times the video card was still supported. My problem is that the monitor works fine only as long as I don't turn it off or switch it to a different input. When I turn it back on, it says "no signal". The key to the problem must be the DVI port, to which the new monitor is connected. The previous monitor was connected to the VGA output, and I've tested that the new one also works fine when connected to the analogue port. Apparently, the computer tests for the presence of a monitor on the DVI port only on startup. The question is, how do I change this?

    Read the article

< Previous Page | 679 680 681 682 683 684 685 686 687 688 689 690  | Next Page >