Search Results

Search found 5758 results on 231 pages for 'contents'.

Page 69/231 | < Previous Page | 65 66 67 68 69 70 71 72 73 74 75 76  | Next Page >

  • Back button of Adobe PDF Reader after clicking a hyperlink whose target is on the same document

    - by artknish
    PDF documents have hyperlinks to the contents on the same document (analogous to "#section" hrefs for an HTML document). Where's the back button to go back to the page I was on (where I clicked the hyperlink). Let's say I'm on the index of a PDF tutorial, page 4, and I click on Chapter 2's hyperlink in the index that takes me to page 38. Now, if I want to go back to page 4 again, which button or shortcut should I use?

    Read the article

  • EXC_BAD_INSTRUCTION (SIGILL) at random during use of app. Bug in AppKit?

    - by Ger Teunis
    I'm currently testing a new version of an app of mine on OSX 10.5 An user reported some weird crashes during use of the application, sadly not reproducible by me. At first sight it seems to happen randomly, once he had the crash while opening an NSOpenPanel and once during focusing an NSTextField and once during NSView switch in a parent view. If you have any idea which area I should look at it would be greatly appreciated! I'm completely lost here. App is compiled in XCode 3.2.1 with SDK 10.5 and targetted at 10.5 He send me these crashes: Crash 1 Process: NZBVortex [43622] Path: /Users/cero/Downloads/NZBVortex.app/Contents/MacOS/NZBVortex Identifier: com.NZBVortex.NZBVortex Version: 0.5.5 (0.5.5) Code Type: X86-64 (Native) Parent Process: launchd [97] Interval Since Last Report: 1951 sec Crashes Since Last Report: 1 Per-App Interval Since Last Report: 1858 sec Per-App Crashes Since Last Report: 1 Date/Time: 2010-03-23 23:43:49.671 +0100 OS Version: Mac OS X 10.5.8 (9L31a) Report Version: 6 Anonymous UUID: 98AB0386-590B-4E0D-B7AC-3F7AA4E7238E Exception Type: EXC_BAD_INSTRUCTION (SIGILL) Exception Codes: 0x0000000000000001, 0x0000000000000000 Crashed Thread: 0 Application Specific Information: objc[43622]: alt handlers in objc runtime are buggy! - Hide quoted text - Thread 0 Crashed: 0 libobjc.A.dylib 0x00007fff82baef6e _objc_fatal + 238 1 libobjc.A.dylib 0x00007fff82bb2ea4 objc_addExceptionHandler + 302 2 com.apple.CoreFoundation 0x00007fff842b1090 _CFDoExceptionOperation + 528 3 com.apple.AppKit 0x00007fff81f75e26 _NSAppKitLock + 81 4 com.apple.AppKit 0x00007fff81f80f8f -[NSView nextKeyView] + 56 5 com.apple.AppKit 0x00007fff81f81018 -[NSView _primitiveSetNextKeyView:] + 72 6 com.apple.AppKit 0x00007fff820732b1 -[NSView _recursiveSetDefaultKeyViewLoop] + 242 7 com.apple.AppKit 0x00007fff82073300 -[NSView _recursiveSetDefaultKeyViewLoop] + 321 8 com.apple.AppKit 0x00007fff82073300 -[NSView _recursiveSetDefaultKeyViewLoop] + 321 9 com.apple.AppKit 0x00007fff82073300 -[NSView _recursiveSetDefaultKeyViewLoop] + 321 10 com.apple.AppKit 0x00007fff82073300 -[NSView _recursiveSetDefaultKeyViewLoop] + 321 11 com.apple.AppKit 0x00007fff82072fc3 -[NSView _setDefaultKeyViewLoop] + 279 12 com.apple.AppKit 0x00007fff82072e70 -[NSWindow recalculateKeyViewLoop] + 36 13 com.apple.AppKit 0x00007fff821dd149 -[NSSavePanel(NSSavePanelRuntime) _loadPreviousModeAndLayout] + 39 14 com.apple.AppKit 0x00007fff821dcf9e -[NSSavePanel(NSSavePanelRuntime) runModalForDirectory:file:types:] + 71 15 com.NZBVortex.NZBVortex 0x000000010000b7ee -[MainWindowViewController openNZBFileButtonClick:] + 62 16 com.apple.AppKit 0x00007fff821c96bf -[NSToolbarButton sendAction:to:] + 77 17 com.apple.AppKit 0x00007fff821c8bb7 -[NSToolbarItemViewer mouseDown:] + 5362 18 com.apple.AppKit 0x00007fff82082783 -[NSWindow sendEvent:] + 5068 19 com.apple.AppKit 0x00007fff8204fd46 -[NSApplication sendEvent:] + 5089 20 com.apple.AppKit 0x00007fff81faa562 -[NSApplication run] + 497 21 com.apple.AppKit 0x00007fff81f772f0 NSApplicationMain + 373 22 com.NZBVortex.NZBVortex 0x0000000100012a69 main + 9 23 com.NZBVortex.NZBVortex 0x0000000100001a84 start + 52 Crash 2 Process: NZBVortex [43600] Path: /Users/cero/Downloads/NZBVortex.app/Contents/MacOS/NZBVortex Identifier: com.NZBVortex.NZBVortex Version: 0.5.5 (0.5.5) Code Type: X86-64 (Native) Parent Process: launchd [97] Interval Since Last Report: 727 sec Crashes Since Last Report: 1 Per-App Interval Since Last Report: 616 sec Per-App Crashes Since Last Report: 1 Date/Time: 2010-03-23 23:11:20.000 +0100 OS Version: Mac OS X 10.5.8 (9L31a) Report Version: 6 Anonymous UUID: 98AB0386-590B-4E0D-B7AC-3F7AA4E7238E Exception Type: EXC_BAD_INSTRUCTION (SIGILL) Exception Codes: 0x0000000000000001, 0x0000000000000000 Crashed Thread: 0 Application Specific Information: objc[43600]: alt handlers in objc runtime are buggy! Thread 0 Crashed: 0 libobjc.A.dylib 0x00007fff82baef6e _objc_fatal + 238 1 libobjc.A.dylib 0x00007fff82bb2ea4 objc_addExceptionHandler + 302 2 com.apple.CoreFoundation 0x00007fff842b1090 _CFDoExceptionOperation + 528 3 com.apple.AppKit 0x00007fff81f75e26 _NSAppKitLock + 81 4 com.apple.AppKit 0x00007fff81f80f8f -[NSView nextKeyView] + 56 5 com.apple.AppKit 0x00007fff81f81018 -[NSView _primitiveSetNextKeyView:] + 72 6 com.apple.AppKit 0x00007fff820732b1 -[NSView _recursiveSetDefaultKeyViewLoop] + 242 7 com.apple.AppKit 0x00007fff82156700 -[NSTabView _recursiveSetDefaultKeyViewLoop] + 119 8 com.apple.AppKit 0x00007fff82073300 -[NSView _recursiveSetDefaultKeyViewLoop] + 321 9 com.apple.AppKit 0x00007fff82073300 -[NSView _recursiveSetDefaultKeyViewLoop] + 321 10 com.apple.AppKit 0x00007fff82072fc3 -[NSView _setDefaultKeyViewLoop] + 279 11 com.apple.AppKit 0x00007fff82072e70 -[NSWindow recalculateKeyViewLoop] + 36 12 com.NZBVortex.NZBVortex 0x000000010000b527 -[MainWindowViewController showView:sender:] + 1639 13 com.NZBVortex.NZBVortex 0x000000010000ae6b -[MainWindowViewController preferencesSaveAlertDidEnd:returnCode:contextInfo:] + 91 14 com.apple.AppKit 0x00007fff82224291 -[NSAlert didEndAlert:returnCode:contextInfo:] + 107 15 com.apple.AppKit 0x00007fff82224197 -[NSAlert buttonPressed:] + 279 16 com.apple.AppKit 0x00007fff82085d46 -[NSApplication sendAction:to:from:] + 97 17 com.apple.AppKit 0x00007fff82085c7f -[NSControl sendAction:to:] + 97 18 com.apple.AppKit 0x00007fff820851b0 -[NSCell trackMouse:inRect:ofView:untilMouseUp:] + 1841 19 com.apple.AppKit 0x00007fff820849d6 -[NSButtonCell trackMouse:inRect:ofView:untilMouseUp:] + 611 20 com.apple.AppKit 0x00007fff8208422f -[NSControl mouseDown:] + 735 21 com.apple.AppKit 0x00007fff82082783 -[NSWindow sendEvent:] + 5068 22 com.apple.AppKit 0x00007fff8204fd46 -[NSApplication sendEvent:] + 5089 23 com.apple.AppKit 0x00007fff81faa562 -[NSApplication run] + 497 24 com.apple.AppKit 0x00007fff81f772f0 NSApplicationMain + 373 25 com.NZBVortex.NZBVortex 0x0000000100012a69 main + 9 26 com.NZBVortex.NZBVortex 0x0000000100001a84 start + 52 Crash 3 Process: NZBVortex [43520] Path: /Users/cero/Downloads/NZBVortex.app/Contents/MacOS/NZBVortex Identifier: com.NZBVortex.NZBVortex Version: 0.5.5 (0.5.5) Code Type: X86-64 (Native) Parent Process: launchd [97] Interval Since Last Report: 23487 sec Crashes Since Last Report: 2 Per-App Interval Since Last Report: 2025 sec Per-App Crashes Since Last Report: 1 Date/Time: 2010-03-23 22:59:05.484 +0100 OS Version: Mac OS X 10.5.8 (9L31a) Report Version: 6 Anonymous UUID: 98AB0386-590B-4E0D-B7AC-3F7AA4E7238E Exception Type: EXC_BAD_INSTRUCTION (SIGILL) Exception Codes: 0x0000000000000001, 0x0000000000000000 Crashed Thread: 0 Application Specific Information: objc[43520]: alt handlers in objc runtime are buggy! Thread 0 Crashed: 0 libobjc.A.dylib 0x00007fff82baef6e _objc_fatal + 238 1 libobjc.A.dylib 0x00007fff82bb2ea4 objc_addExceptionHandler + 302 2 com.apple.CoreFoundation 0x00007fff842b1090 _CFDoExceptionOperation + 528 3 com.apple.AppKit 0x00007fff81f75e26 _NSAppKitLock + 81 4 com.apple.AppKit 0x00007fff81f80f8f -[NSView nextKeyView] + 56 5 com.apple.AppKit 0x00007fff81f81018 -[NSView _primitiveSetNextKeyView:] + 72 6 com.apple.AppKit 0x00007fff820732b1 -[NSView _recursiveSetDefaultKeyViewLoop] + 242 7 com.apple.AppKit 0x00007fff82073300 -[NSView _recursiveSetDefaultKeyViewLoop] + 321 8 com.apple.AppKit 0x00007fff82073300 -[NSView _recursiveSetDefaultKeyViewLoop] + 321 9 com.apple.AppKit 0x00007fff82073300 -[NSView _recursiveSetDefaultKeyViewLoop] + 321 10 com.apple.AppKit 0x00007fff82073300 -[NSView _recursiveSetDefaultKeyViewLoop] + 321 11 com.apple.AppKit 0x00007fff82072fc3 -[NSView _setDefaultKeyViewLoop] + 279 12 com.apple.AppKit 0x00007fff82072e70 -[NSWindow recalculateKeyViewLoop] + 36 13 com.apple.AppKit 0x00007fff821dd149 -[NSSavePanel(NSSavePanelRuntime) _loadPreviousModeAndLayout] + 39 14 com.apple.AppKit 0x00007fff821dcf9e -[NSSavePanel(NSSavePanelRuntime) runModalForDirectory:file:types:] + 71 15 com.NZBVortex.NZBVortex 0x000000010000b7ee -[MainWindowViewController openNZBFileButtonClick:] + 62 16 com.apple.AppKit 0x00007fff821c96bf -[NSToolbarButton sendAction:to:] + 77 17 com.apple.AppKit 0x00007fff821c8bb7 -[NSToolbarItemViewer mouseDown:] + 5362 18 com.apple.AppKit 0x00007fff82082783 -[NSWindow sendEvent:] + 5068 19 com.apple.AppKit 0x00007fff8204fd46 -[NSApplication sendEvent:] + 5089 20 com.apple.AppKit 0x00007fff81faa562 -[NSApplication run] + 497 21 com.apple.AppKit 0x00007fff81f772f0 NSApplicationMain + 373 22 com.NZBVortex.NZBVortex 0x0000000100012a69 main + 9 23 com.NZBVortex.NZBVortex 0x0000000100001a84 start + 52

    Read the article

  • ASM programming, how to use loop?

    - by chris
    Hello. Im first time here.I am a college student. I've created a simple program by using assembly language. And im wondering if i can use loop method to run it almost samething as what it does below the program i posted. and im also eager to find someome who i can talk through MSN messanger so i can ask you questions right away.(if possible) ok thank you .MODEL small .STACK 400h .data prompt db 10,13,'Please enter a 3 digit number, example 100:',10,13,'$' ;10,13 cause to go to next line first_digit db 0d second_digit db 0d third_digit db 0d Not_prime db 10,13,'This number is not prime!',10,13,'$' prime db 10,13,'This number is prime!',10,13,'$' question db 10,13,'Do you want to contine Y/N $' counter dw 0d number dw 0d half dw ? .code Start: mov ax, @data ;establish access to the data segment mov ds, ax mov number, 0d LetsRoll: mov dx, offset prompt ; print the string (please enter a 3 digit...) mov ah, 9h int 21h ;execute ;read FIRST DIGIT mov ah, 1d ;bios code for read a keystroke int 21h ;call bios, it is understood that the ascii code will be returned in al mov first_digit, al ;may as well save a copy sub al, 30h ;Convert code to an actual integer cbw ;CONVERT BYTE TO WORD. This takes whatever number is in al and ;extends it to ax, doubling its size from 8 bits to 16 bits ;The first digit now occupies all of ax as an integer mov cx, 100d ;This is so we can calculate 100*1st digit +10*2nd digit + 3rd digit mul cx ;start to accumulate the 3 digit number in the variable imul cx ;it is understood that the other operand is ax ;AND that the result will use both dx::ax ;but we understand that dx will contain only leading zeros add number, ax ;save ;variable <number> now contains 1st digit * 10 ;---------------------------------------------------------------------- ;read SECOND DIGIT, multiply by 10 and add in mov ah, 1d ;bios code for read a keystroke int 21h ;call bios, it is understood that the ascii code will be returned in al mov second_digit, al ;may as well save a copy sub al, 30h ;Convert code to an actual integer cbw ;CONVERT BYTE TO WORD. This takes whatever number is in al and ;extends it to ax, boubling its size from 8 bits to 16 bits ;The first digit now occupies all of ax as an integer mov cx, 10d ;continue to accumulate the 3 digit number in the variable mul cx ;it is understood that the other operand is ax, containing first digit ;AND that the result will use both dx::ax ;but we understand that dx will contain only leading zeros. Ignore them add number, ax ;save -- nearly finished ;variable <number> now contains 1st digit * 100 + second digit * 10 ;---------------------------------------------------------------------- ;read THIRD DIGIT, add it in (no multiplication this time) mov ah, 1d ;bios code for read a keystroke int 21h ;call bios, it is understood that the ascii code will be returned in al mov third_digit, al ;may as well save a copy sub al, 30h ;Convert code to an actual integer cbw ;CONVERT BYTE TO WORD. This takes whatever number is in al and ;extends it to ax, boubling its size from 8 bits to 16 bits ;The first digit now occupies all of ax as an integer add number, ax ;Both my variable number and ax are 16 bits, so equal size mov ax, number ;copy contents of number to ax mov cx, 2h div cx ;Divide by cx mov half, ax ;copy the contents of ax to half mov cx, 2h; mov ax, number; ;copy numbers to ax xor dx, dx ;flush dx jmp prime_check ;jump to prime check print_question: mov dx, offset question ;print string (do you want to continue Y/N?) mov ah, 9h int 21h ;execute mov ah, 1h int 21h ;execute cmp al, 4eh ;compare je Exit ;jump to exit cmp al, 6eh ;compare je Exit ;jump to exit cmp al, 59h ;compare je Start ;jump to start cmp al, 79h ;compare je Start ;jump to start prime_check: div cx; ;Divide by cx cmp dx, 0h ;reset the value of dx je print_not_prime ;jump to not prime xor dx, dx; ;flush dx mov ax, number ;copy the contents of number to ax cmp cx, half ;compare half with cx je print_prime ;jump to print prime section inc cx; ;increment cx by one jmp prime_check ;repeat the prime check print_prime: mov dx, offset prime ;print string (this number is prime!) mov ah, 9h int 21h ;execute jmp print_question ;jumps to question (do you want to continue Y/N?) this is for repeat print_not_prime: mov dx, offset Not_prime ;print string (this number is not prime!) mov ah, 9h int 21h ;execute jmp print_question ;jumps to question (do you want to continue Y/N?) this is for repeat Exit: mov ah, 4ch int 21h ;execute exit END Start

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • XNA Notes 006

    - by George Clingerman
    If you used to think the XNA community was small and inactive, hopefully these XNA Notes are opening your eyes. And I honestly feel like I’m still only catching the tail end of everything that’s going on. It’s a large and active community and you can be so mired down in one part of it you miss all sorts of cool stuff another part is doing. XNA is many things to a lot of people and that makes for a lot of really awesome things going on. So here’s what I saw going on this last week! Time Critical XNA New: XNA Team - Peer Review now closes for XNA 3.1 games http://blogs.msdn.com/b/xna/archive/2011/02/08/peer-review-pipeline-closed-for-new-xna-gs-3-1-games-or-updates-on-app-hub.aspx http://twitter.com/XNACommunity/statuses/34649816529256448 The XNA Team posts about a meet up with Microsoft for Creator’s going to be at GDC, March 3rd at the Lobby Bar http://on.fb.me/fZungJ XNA Team: @mklucher is busying playing the the bubblegum on WP7 made by a member of the XNA team (although reportedly made in Silverlight? Crazy! ;) ) http://twitter.com/mklucher/statuses/34645662737895426 http://bubblegum.me Shawn Hargreaves posts multiple posts (is this a sign that something new is coming from the XNA team? Usually when Shawn has time to post, something has just wrapped up…) Random Shuffle http://blogs.msdn.com/b/shawnhar/archive/2011/02/09/random-shuffle.aspx Doing the right thing: resume, rewind or skip ahead http://blogs.msdn.com/b/shawnhar/archive/2011/02/10/doing-the-right-thing-resume-rewind-or-skip-ahead.aspx XNA Developers: Andrew Russel was on .NET Rocks recently talking with Carl and Richard about developing games for Xbox, iPhone and Android http://www.dotnetrocks.com/default.aspx?ShowNum=635 Eric W. releases the Fishing Girl source code into the wild http://ericw.ca/blog/posts/fishing-girl-now-open-source/ http://forums.create.msdn.com/forums/p/74642/454512.aspx#454512 BinaryTweedDeej reminds that XNA community that Indie City wants you involved http://twitter.com/BinaryTweedDeej/statuses/34596114028044288 http://www.indiecity.com Mike McLaughlin (@mikebmcl) releases his first two XNA articles on the TechNet wiki http://social.technet.microsoft.com/wiki/contents/articles/xna-framework-overview.aspx http://social.technet.microsoft.com/wiki/contents/articles/content-pipeline-overview.aspx John Watte plays around with the Content Pipeline and Music Visualization exploring just what can be done. http://www.enchantedage.com/xna-content-pipeline-fft-song-analysis http://www.enchantedage.com/fft-in-xna-content-pipeline-for-beat-detection-for-the-win Simon Stevens writes up his talk on Vector Collision Physics http://www.simonpstevens.com/News/VectorCollisionPhysics @domipheus puts together an XNA Task Manager http://www.flickr.com/photos/domipheus/5405603197/ MadNinjaSkillz releases his fork of Nick's Easy Storage component on CodePlex http://twitter.com/MadNinjaSkillz/statuses/34739039068229634 http://ezstorage.codeplex.com @ActiveNick was interviewed by Rob Cameron and discusses Windows Phone 7, Bing Maps and XNA http://twitter.com/ActiveNick/statuses/35348548526546944 http://msdn.microsoft.com/en-us/cc537546 Radiangames (Luke Schneider) posts about converting his games from XNA to Unity http://radiangames.com/?p=592 UberMonkey (@ElementCy) posts about a new project in the works, CubeTest a Minecraft style terrain http://www.ubergamermonkey.com/personal-projects/new-project-in-the-works/?utm_source=feedburner&utm_medium=feed&utm_campaign=Feed%3A+Ubergamermonkey+%28UberGamerMonkey%29 Xbox LIVE Indie Games (XBLIG): VideoGamer Rob review Bonded Realities http://videogamerrob.wordpress.com/2011/02/05/xblig-review-bonded-realities/ XBLIG Round Up on Gamergeddon http://www.gamergeddon.com/2011/02/06/xbox-indie-game-round-up-february-6th/ Are gamers still rating Indie Games after the Xbox Dashboard update? http://www.gamemarx.com/news/2011/02/06/are-gamers-still-rating-indie-games-after-the-xbox-dashboard-update.aspx Joystiq - Xbox Live Indie Gems: Corrupted http://www.joystiq.com/2011/02/04/xbox-live-indie-gems-corrupted/ Raymond Matthews of DarkStarMatryx reviews (Almost) Total Mayhem and Aban Hawkins & the 1000 Spikes http://www.darkstarmatryx.com/?p=225 http://www.darkstarmatryx.com/?p=229 8 Bit Horse reviews Aban Hawkins & the 1000 spikes http://8bithorse.blogspot.com/2011/01/aban-hawkins-1000-spikes-xbl-indie.html 2010 wrap-up for FunInfused Games http://www.krissteele.net/blogdetails.aspx?id=245 NeoGaf roundup of January's XBLIGs http://www.neogaf.com/forum/showthread.php?t=420528 Armless Ocotopus interviews Michael Ventnor creator of Bonded Realities http://www.armlessoctopus.com/2011/02/07/interview-michael-ventnor-of-red-crest-studios/ @recharge_media posts about the new city music for Woodvale in Sin Rising http://rechargemedia.com/2011/02/08/new-city-theme-woodvale/ @DrMisty posts some footage of YoYoYo in action http://www.mstargames.co.uk/mistryblogmain/54-yoyoyoblogs/184-video-update.html Xona Games - Decimation X3 on Reviews on the Run http://video.citytv.com/video/detail/782443063001.000000/reviews-on-the-run--february-8-2011/g4/ @benkane gives an early peek at his action RPG coming to XBLIG http://www.youtube.com/watch?v=bDF_PrvtwU8 Rock, Paper Shotgun talks to Zeboyd games about bringing Cthulhu Saves the World to PC http://www.rockpapershotgun.com/2011/02/11/summoning-cthulhu-natter-with-zeboyd/ Xbox LIVE Indieverse interviews the creator of Bonded Realities http://xbl-indieverse.blogspot.com/2011/02/xbl-indieverse-interview-red-crest.html XNA Game Development: Dream-In-Code posts about an upcoming XNA Challenge/Coding contest http://www.dreamincode.net/forums/blog/1385/entry-3192-xna-challengecontest/ Sgt.Conker covers Fishing Girl and IndieFreaks Game Framework release http://www.sgtconker.com/2011/02/fishing-girl-did-not-sell-a-single-copy/ http://www.sgtconker.com/2011/02/indiefreaks-game-framework-v0-2-0-0/ @slyprid releases Transmute v0.40a with lots of new features and fixes http://twitter.com/slyprid/statuses/34125423067533312 http://twitter.com/slyprid/statuses/35326876243337216 http://forgottenstarstudios.com/ Jeff Brown writes an XNA 4.0 tutorial on Saving/Loading on the Xbox 360 http://www.robotfootgames.com/xna-tutorials/92-xna-tutorial-savingloading-on-xbox-360-40 XNA for Silverlight Developers: Part 3- Animation http://www.silverlightshow.net/items/XNA-for-Silverlight-developers-Part-3-Animation-transforms.aspx?utm_source=feedburner&utm_medium=feed&utm_campaign=Feed%3A+xna-connection-twitter-specific-stream+%28XNA+Connection%27s+Twitter+specific+stream%29 The news from Nokia is definitely something XNA developers will want to keep their eye on http://blogs.forum.nokia.com/blog/nokia-developer-news/2011/02/11/letter-to-developers?sf1066337=1

    Read the article

  • JMS Step 4 - How to Create an 11g BPEL Process Which Writes a Message Based on an XML Schema to a JMS Queue

    - by John-Brown.Evans
    JMS Step 4 - How to Create an 11g BPEL Process Which Writes a Message Based on an XML Schema to a JMS Queue ol{margin:0;padding:0} .c11_4{vertical-align:top;width:129.8pt;border-style:solid;background-color:#f3f3f3;border-color:#000000;border-width:1pt;padding:5pt 5pt 5pt 5pt} .c9_4{vertical-align:top;width:207pt;border-style:solid;background-color:#f3f3f3;border-color:#000000;border-width:1pt;padding:5pt 5pt 5pt 5pt}.c14{vertical-align:top;width:207pt;border-style:solid;border-color:#000000;border-width:1pt;padding:5pt 5pt 5pt 5pt} .c17_4{vertical-align:top;width:129.8pt;border-style:solid;border-color:#000000;border-width:1pt;padding:5pt 5pt 5pt 5pt} .c7_4{vertical-align:top;width:130pt;border-style:solid;border-color:#000000;border-width:1pt;padding:0pt 5pt 0pt 5pt} .c19_4{vertical-align:top;width:468pt;border-style:solid;border-color:#000000;border-width:1pt;padding:5pt 5pt 5pt 5pt} .c22_4{background-color:#ffffff} .c20_4{list-style-type:disc;margin:0;padding:0} .c6_4{font-size:8pt;font-family:"Courier New"} .c24_4{color:inherit;text-decoration:inherit} .c23_4{color:#1155cc;text-decoration:underline} .c0_4{height:11pt;direction:ltr} .c10_4{font-size:10pt;font-family:"Courier New"} .c3_4{padding-left:0pt;margin-left:36pt} .c18_4{font-size:8pt} .c8_4{text-align:center} .c12_4{background-color:#ffff00} .c2_4{font-weight:bold} .c21_4{background-color:#00ff00} .c4_4{line-height:1.0} .c1_4{direction:ltr} .c15_4{background-color:#f3f3f3} .c13_4{font-family:"Courier New"} .c5_4{font-style:italic} .c16_4{border-collapse:collapse} .title{padding-top:24pt;line-height:1.15;text-align:left;color:#000000;font-size:36pt;font-family:"Arial";font-weight:bold;padding-bottom:6pt} .subtitle{padding-top:18pt;line-height:1.15;text-align:left;color:#666666;font-style:italic;font-size:24pt;font-family:"Georgia";padding-bottom:4pt} li{color:#000000;font-size:10pt;font-family:"Arial"} p{color:#000000;font-size:10pt;margin:0;font-family:"Arial"} h1{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:18pt;font-family:"Arial";font-weight:normal;padding-bottom:0pt} h2{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:18pt;font-family:"Arial";font-weight:bold;padding-bottom:0pt} h3{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:14pt;font-family:"Arial";font-weight:normal;padding-bottom:0pt} h4{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-style:italic;font-size:11pt;font-family:"Arial";padding-bottom:0pt} h5{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:10pt;font-family:"Arial";font-weight:normal;padding-bottom:0pt} h6{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-style:italic;font-size:10pt;font-family:"Arial";padding-bottom:0pt} This post continues the series of JMS articles which demonstrate how to use JMS queues in a SOA context. The previous posts were: JMS Step 1 - How to Create a Simple JMS Queue in Weblogic Server 11g JMS Step 2 - Using the QueueSend.java Sample Program to Send a Message to a JMS Queue JMS Step 3 - Using the QueueReceive.java Sample Program to Read a Message from a JMS Queue In this example we will create a BPEL process which will write (enqueue) a message to a JMS queue using a JMS adapter. The JMS adapter will enqueue the full XML payload to the queue. This sample will use the following WebLogic Server objects. The first two, the Connection Factory and JMS Queue, were created as part of the first blog post in this series, JMS Step 1 - How to Create a Simple JMS Queue in Weblogic Server 11g. If you haven't created those objects yet, please see that post for details on how to do so. The Connection Pool will be created as part of this example. Object Name Type JNDI Name TestConnectionFactory Connection Factory jms/TestConnectionFactory TestJMSQueue JMS Queue jms/TestJMSQueue eis/wls/TestQueue Connection Pool eis/wls/TestQueue 1. Verify Connection Factory and JMS Queue As mentioned above, this example uses a WLS Connection Factory called TestConnectionFactory and a JMS queue TestJMSQueue. As these are prerequisites for this example, let us verify they exist. Log in to the WebLogic Server Administration Console. Select Services > JMS Modules > TestJMSModule You should see the following objects: If not, or if the TestJMSModule is missing, please see the abovementioned article and create these objects before continuing. 2. Create a JMS Adapter Connection Pool in WebLogic Server The BPEL process we are about to create uses a JMS adapter to write to the JMS queue. The JMS adapter is deployed to the WebLogic server and needs to be configured to include a connection pool which references the connection factory associated with the JMS queue. In the WebLogic Server Console Go to Deployments > Next and select (click on) the JmsAdapter Select Configuration > Outbound Connection Pools and expand oracle.tip.adapter.jms.IJmsConnectionFactory. This will display the list of connections configured for this adapter. For example, eis/aqjms/Queue, eis/aqjms/Topic etc. These JNDI names are actually quite confusing. We are expecting to configure a connection pool here, but the names refer to queues and topics. One would expect these to be called *ConnectionPool or *_CF or similar, but to conform to this nomenclature, we will call our entry eis/wls/TestQueue . This JNDI name is also the name we will use later, when creating a BPEL process to access this JMS queue! Select New, check the oracle.tip.adapter.jms.IJmsConnectionFactory check box and Next. Enter JNDI Name: eis/wls/TestQueue for the connection instance, then press Finish. Expand oracle.tip.adapter.jms.IJmsConnectionFactory again and select (click on) eis/wls/TestQueue The ConnectionFactoryLocation must point to the JNDI name of the connection factory associated with the JMS queue you will be writing to. In our example, this is the connection factory called TestConnectionFactory, with the JNDI name jms/TestConnectionFactory.( As a reminder, this connection factory is contained in the JMS Module called TestJMSModule, under Services > Messaging > JMS Modules > TestJMSModule which we verified at the beginning of this document. )Enter jms/TestConnectionFactory  into the Property Value field for Connection Factory Location. After entering it, you must press Return/Enter then Save for the value to be accepted. If your WebLogic server is running in Development mode, you should see the message that the changes have been activated and the deployment plan successfully updated. If not, then you will manually need to activate the changes in the WebLogic server console. Although the changes have been activated, the JmsAdapter needs to be redeployed in order for the changes to become effective. This should be confirmed by the message Remember to update your deployment to reflect the new plan when you are finished with your changes as can be seen in the following screen shot: The next step is to redeploy the JmsAdapter.Navigate back to the Deployments screen, either by selecting it in the left-hand navigation tree or by selecting the “Summary of Deployments” link in the breadcrumbs list at the top of the screen. Then select the checkbox next to JmsAdapter and press the Update button On the Update Application Assistant page, select “Redeploy this application using the following deployment files” and press Finish. After a few seconds you should get the message that the selected deployments were updated. The JMS adapter configuration is complete and it can now be used to access the JMS queue. To summarize: we have created a JMS adapter connection pool connector with the JNDI name jms/TestConnectionFactory. This is the JNDI name to be accessed by a process such as a BPEL process, when using the JMS adapter to access the previously created JMS queue with the JNDI name jms/TestJMSQueue. In the following step, we will set up a BPEL process to use this JMS adapter to write to the JMS queue. 3. Create a BPEL Composite with a JMS Adapter Partner Link This step requires that you have a valid Application Server Connection defined in JDeveloper, pointing to the application server on which you created the JMS Queue and Connection Factory. You can create this connection in JDeveloper under the Application Server Navigator. Give it any name and be sure to test the connection before completing it. This sample will use the connection name jbevans-lx-PS5, as that is the name of the connection pointing to my SOA PS5 installation. When using a JMS adapter from within a BPEL process, there are various configuration options, such as the operation type (consume message, produce message etc.), delivery mode and message type. One of these options is the choice of the format of the JMS message payload. This can be structured around an existing XSD, in which case the full XML element and tags are passed, or it can be opaque, meaning that the payload is sent as-is to the JMS adapter. In the case of an XSD-based message, the payload can simply be copied to the input variable of the JMS adapter. In the case of an opaque message, the JMS adapter’s input variable is of type base64binary. So the payload needs to be converted to base64 binary first. I will go into this in more detail in a later blog entry. This sample will pass a simple message to the adapter, based on the following simple XSD file, which consists of a single string element: stringPayload.xsd <?xml version="1.0" encoding="windows-1252" ?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns="http://www.example.org" targetNamespace="http://www.example.org" elementFormDefault="qualified" <xsd:element name="exampleElement" type="xsd:string"> </xsd:element> </xsd:schema> The following steps are all executed in JDeveloper. The SOA project will be created inside a JDeveloper Application. If you do not already have an application to contain the project, you can create a new one via File > New > General > Generic Application. Give the application any name, for example JMSTests and, when prompted for a project name and type, call the project JmsAdapterWriteWithXsd and select SOA as the project technology type. If you already have an application, continue below. Create a SOA Project Create a new project and choose SOA Tier > SOA Project as its type. Name it JmsAdapterWriteSchema. When prompted for the composite type, choose Composite With BPEL Process. When prompted for the BPEL Process, name it JmsAdapterWriteSchema too and choose Synchronous BPEL Process as the template. This will create a composite with a BPEL process and an exposed SOAP service. Double-click the BPEL process to open and begin editing it. You should see a simple BPEL process with a Receive and Reply activity. As we created a default process without an XML schema, the input and output variables are simple strings. Create an XSD File An XSD file is required later to define the message format to be passed to the JMS adapter. In this step, we create a simple XSD file, containing a string variable and add it to the project. First select the xsd item in the left-hand navigation tree to ensure that the XSD file is created under that item. Select File > New > General > XML and choose XML Schema. Call it stringPayload.xsd and when the editor opens, select the Source view. then replace the contents with the contents of the stringPayload.xsd example above and save the file. You should see it under the xsd item in the navigation tree. Create a JMS Adapter Partner Link We will create the JMS adapter as a service at the composite level. If it is not already open, double-click the composite.xml file in the navigator to open it. From the Component Palette, drag a JMS adapter over onto the right-hand swim lane, under External References. This will start the JMS Adapter Configuration Wizard. Use the following entries: Service Name: JmsAdapterWrite Oracle Enterprise Messaging Service (OEMS): Oracle Weblogic JMS AppServer Connection: Use an existing application server connection pointing to the WebLogic server on which the above JMS queue and connection factory were created. You can use the “+” button to create a connection directly from the wizard, if you do not already have one. This example uses a connection called jbevans-lx-PS5. Adapter Interface > Interface: Define from operation and schema (specified later) Operation Type: Produce Message Operation Name: Produce_message Destination Name: Press the Browse button, select Destination Type: Queues, then press Search. Wait for the list to populate, then select the entry for TestJMSQueue , which is the queue created earlier. JNDI Name: The JNDI name to use for the JMS connection. This is probably the most important step in this exercise and the most common source of error. This is the JNDI name of the JMS adapter’s connection pool created in the WebLogic Server and which points to the connection factory. JDeveloper does not verify the value entered here. If you enter a wrong value, the JMS adapter won’t find the queue and you will get an error message at runtime, which is very difficult to trace. In our example, this is the value eis/wls/TestQueue . (See the earlier step on how to create a JMS Adapter Connection Pool in WebLogic Server for details.) MessagesURL: We will use the XSD file we created earlier, stringPayload.xsd to define the message format for the JMS adapter. Press the magnifying glass icon to search for schema files. Expand Project Schema Files > stringPayload.xsd and select exampleElement: string. Press Next and Finish, which will complete the JMS Adapter configuration. Wire the BPEL Component to the JMS Adapter In this step, we link the BPEL process/component to the JMS adapter. From the composite.xml editor, drag the right-arrow icon from the BPEL process to the JMS adapter’s in-arrow. This completes the steps at the composite level. 4. Complete the BPEL Process Design Invoke the JMS Adapter Open the BPEL component by double-clicking it in the design view of the composite.xml, or open it from the project navigator by selecting the JmsAdapterWriteSchema.bpel file. This will display the BPEL process in the design view. You should see the JmsAdapterWrite partner link under one of the two swim lanes. We want it in the right-hand swim lane. If JDeveloper displays it in the left-hand lane, right-click it and choose Display > Move To Opposite Swim Lane. An Invoke activity is required in order to invoke the JMS adapter. Drag an Invoke activity between the Receive and Reply activities. Drag the right-hand arrow from the Invoke activity to the JMS adapter partner link. This will open the Invoke editor. The correct default values are entered automatically and are fine for our purposes. We only need to define the input variable to use for the JMS adapter. By pressing the green “+” symbol, a variable of the correct type can be auto-generated, for example with the name Invoke1_Produce_Message_InputVariable. Press OK after creating the variable. ( For some reason, while I was testing this, the JMS Adapter moved back to the left-hand swim lane again after this step. There is no harm in leaving it there, but I find it easier to follow if it is in the right-hand lane, because I kind-of think of the message coming in on the left and being routed through the right. But you can follow your personal preference here.) Assign Variables Drag an Assign activity between the Receive and Invoke activities. We will simply copy the input variable to the JMS adapter and, for completion, so the process has an output to print, again to the process’s output variable. Double-click the Assign activity and create two Copy rules: for the first, drag Variables > inputVariable > payload > client:process > client:input_string to Invoke1_Produce_Message_InputVariable > body > ns2:exampleElement for the second, drag the same input variable to outputVariable > payload > client:processResponse > client:result This will create two copy rules, similar to the following: Press OK. This completes the BPEL and Composite design. 5. Compile and Deploy the Composite We won’t go into too much detail on how to compile and deploy. In JDeveloper, compile the process by pressing the Make or Rebuild icons or by right-clicking the project name in the navigator and selecting Make... or Rebuild... If the compilation is successful, deploy it to the SOA server connection defined earlier. (Right-click the project name in the navigator, select Deploy to Application Server, choose the application server connection, choose the partition on the server (usually default) and press Finish. You should see the message ---- Deployment finished. ---- in the Deployment frame, if the deployment was successful. 6. Test the Composite This is the exciting part. Open two tabs in your browser and log in to the WebLogic Administration Console in one tab and the Enterprise Manager 11g Fusion Middleware Control (EM) for your SOA installation in the other. We will use the Console to monitor the messages being written to the queue and the EM to execute the composite. In the Console, go to Services > Messaging > JMS Modules > TestJMSModule > TestJMSQueue > Monitoring. Note the number of messages under Messages Current. In the EM, go to SOA > soa-infra (soa_server1) > default (or wherever you deployed your composite to) and click on JmsAdapterWriteSchema [1.0], then press the Test button. Under Input Arguments, enter any string into the text input field for the payload, for example Test Message then press Test Web Service. If the instance is successful you should see the same text in the Response message, “Test Message”. In the Console, refresh the Monitoring screen to confirm a new message has been written to the queue. Check the checkbox and press Show Messages. Click on the newest message and view its contents. They should include the full XML of the entered payload. 7. Troubleshooting If you get an exception similar to the following at runtime ... BINDING.JCA-12510 JCA Resource Adapter location error. Unable to locate the JCA Resource Adapter via .jca binding file element The JCA Binding Component is unable to startup the Resource Adapter specified in the element: location='eis/wls/QueueTest'. The reason for this is most likely that either 1) the Resource Adapters RAR file has not been deployed successfully to the WebLogic Application server or 2) the '' element in weblogic-ra.xml has not been set to eis/wls/QueueTest. In the last case you will have to add a new WebLogic JCA connection factory (deploy a RAR). Please correct this and then restart the Application Server at oracle.integration.platform.blocks.adapter.fw.AdapterBindingException. createJndiLookupException(AdapterBindingException.java:130) at oracle.integration.platform.blocks.adapter.fw.jca.cci. JCAConnectionManager$JCAConnectionPool.createJCAConnectionFactory (JCAConnectionManager.java:1387) at oracle.integration.platform.blocks.adapter.fw.jca.cci. JCAConnectionManager$JCAConnectionPool.newPoolObject (JCAConnectionManager.java:1285) ... then this is very likely due to an incorrect JNDI name entered for the JMS Connection in the JMS Adapter Wizard. Recheck those steps. The error message prints the name of the JNDI name used. In this example, it was incorrectly entered as eis/wls/QueueTest instead of eis/wls/TestQueue. This concludes this example. Best regards John-Brown Evans Oracle Technology Proactive Support Delivery

    Read the article

  • Ubuntu not detecting second monitor

    - by Julian Le Saux
    I'm running Ubuntu 12.04 on a Lenovo x61s Thinkpad. As the screen's rather small and I want to do some video editing, I thought I'd plug in a monitor and use that. The monitor is Relisys JM777 (quite old). When I plug it into my other computer, which is running Windows 7, it immediately mirrors the display; but when plugged into the Lenovo the monitor screen remains blank. The graphics card on the Lenovo is a "VGA compatible controller" according to SysInfo. Anybody got any suggestions? I'm quite new to Linux, so simple explanations would be greatly appreciated. The contents of my Xorg.0.log file can be seen at http://paste.ubuntu.com/1009855/ .

    Read the article

  • ASP.NET MVC 3: Razor’s @: and <text> syntax

    - by ScottGu
    This is another in a series of posts I’m doing that cover some of the new ASP.NET MVC 3 features: New @model keyword in Razor (Oct 19th) Layouts with Razor (Oct 22nd) Server-Side Comments with Razor (Nov 12th) Razor’s @: and <text> syntax (today) In today’s post I’m going to discuss two useful syntactical features of the new Razor view-engine – the @: and <text> syntax support. Fluid Coding with Razor ASP.NET MVC 3 ships with a new view-engine option called “Razor” (in addition to the existing .aspx view engine).  You can learn more about Razor, why we are introducing it, and the syntax it supports from my Introducing Razor blog post.  Razor minimizes the number of characters and keystrokes required when writing a view template, and enables a fast, fluid coding workflow. Unlike most template syntaxes, you do not need to interrupt your coding to explicitly denote the start and end of server blocks within your HTML. The Razor parser is smart enough to infer this from your code. This enables a compact and expressive syntax which is clean, fast and fun to type. For example, the Razor snippet below can be used to iterate a list of products: When run, it generates output like:   One of the techniques that Razor uses to implicitly identify when a code block ends is to look for tag/element content to denote the beginning of a content region.  For example, in the code snippet above Razor automatically treated the inner <li></li> block within our foreach loop as an HTML content block because it saw the opening <li> tag sequence and knew that it couldn’t be valid C#.  This particular technique – using tags to identify content blocks within code – is one of the key ingredients that makes Razor so clean and productive with scenarios involving HTML creation. Using @: to explicitly indicate the start of content Not all content container blocks start with a tag element tag, though, and there are scenarios where the Razor parser can’t implicitly detect a content block. Razor addresses this by enabling you to explicitly indicate the beginning of a line of content by using the @: character sequence within a code block.  The @: sequence indicates that the line of content that follows should be treated as a content block: As a more practical example, the below snippet demonstrates how we could output a “(Out of Stock!)” message next to our product name if the product is out of stock: Because I am not wrapping the (Out of Stock!) message in an HTML tag element, Razor can’t implicitly determine that the content within the @if block is the start of a content block.  We are using the @: character sequence to explicitly indicate that this line within our code block should be treated as content. Using Code Nuggets within @: content blocks In addition to outputting static content, you can also have code nuggets embedded within a content block that is initiated using a @: character sequence.  For example, we have two @: sequences in the code snippet below: Notice how within the second @: sequence we are emitting the number of units left within the content block (e.g. - “(Only 3 left!”). We are doing this by embedding a @p.UnitsInStock code nugget within the line of content. Multiple Lines of Content Razor makes it easy to have multiple lines of content wrapped in an HTML element.  For example, below the inner content of our @if container is wrapped in an HTML <p> element – which will cause Razor to treat it as content: For scenarios where the multiple lines of content are not wrapped by an outer HTML element, you can use multiple @: sequences: Alternatively, Razor also allows you to use a <text> element to explicitly identify content: The <text> tag is an element that is treated specially by Razor. It causes Razor to interpret the inner contents of the <text> block as content, and to not render the containing <text> tag element (meaning only the inner contents of the <text> element will be rendered – the tag itself will not).  This makes it convenient when you want to render multi-line content blocks that are not wrapped by an HTML element.  The <text> element can also optionally be used to denote single-lines of content, if you prefer it to the more concise @: sequence: The above code will render the same output as the @: version we looked at earlier.  Razor will automatically omit the <text> wrapping element from the output and just render the content within it.  Summary Razor enables a clean and concise templating syntax that enables a very fluid coding workflow.  Razor’s smart detection of <tag> elements to identify the beginning of content regions is one of the reasons that the Razor approach works so well with HTML generation scenarios, and it enables you to avoid having to explicitly mark the beginning/ending of content regions in about 95% of if/else and foreach scenarios. Razor’s @: and <text> syntax can then be used for scenarios where you want to avoid using an HTML element within a code container block, and need to more explicitly denote a content region. Hope this helps, Scott P.S. In addition to blogging, I am also now using Twitter for quick updates and to share links. Follow me at: twitter.com/scottgu

    Read the article

  • Resolving TFS_SCHEMA_VERSION Errors In Team Foundation Server 2010 Collection Databases

    - by Jeff Ferguson
    I recently backed up a Team Foundation Server 2010 project collection database and restored it onto another server. All of that went well, until I tried to use the restored database on the new server. As it turns out, the old server was running the Release Candidate of TFS 2010 and the new server is running the RTM version of TFS 2010. I ended up with an error message shown on the new server's Team Web Access site about the project collection's TFS_SCHEMA_VERSION property not containing the appropriate value. As it turns out, TFS_SCHEMA_VERSION is an extended property on the project collection database. I ran the following SQL script against the project collection database restored onto the new server: EXEC [Tfs_DefaultCollection].sys.sp_dropextendedproperty @name=N'TFS_PRODUCT_VERSION' GO EXEC [Tfs_DefaultCollection].sys.sp_addextendedproperty @name=N'TFS_PRODUCT_VERSION', @value=N'10.0.30319.1' GO EXEC [Tfs_DefaultCollection].sys.sp_dropextendedproperty @name=N'TFS_SCHEMA_VERSION' GO EXEC [Tfs_DefaultCollection].sys.sp_addextendedproperty @name=N'TFS_SCHEMA_VERSION', @value=N'Microsoft Team Foundation Server 2010 (RTM)' GO Now, all is well. I can now navigate to http://newserver:8080/tfs/ and see the restored project collection and its contents.

    Read the article

  • Visual Basic 2010 Language Enhancements

    Earlier this month Microsoft released Visual Studio 2010, the .NET Framework 4.0 (which includes ASP.NET 4.0), and new versions of their core programming languages: C# 4.0 and Visual Basic 10 (also referred to as Visual Basic 2010). Previously, the C# and Visual Basic programming languages were managed by two separate teams within Microsoft, which helps explain why features found in one language was not necessarily found in the other. For example, C# 3.0 introduced <a href="http://weblogs.asp.net/scottgu/archive/2007/03/08/new-c-orcas-language-features-automatic-properties-object-initializers-and-collection-initializers.aspx"><i>collection initializers</i></a>, which enable developers to define the contents of a collection when declaring it; however,

    Read the article

  • ifup eth0 failed in Ubuntu 11.10 and Ubuntu 10.04.3

    - by Ajay
    ifup eth0 failed to bring up eth0 First, I have set static ip using the below commands: Commands: ifdown eth0 ifconfig eth0 X.X.X.X netmask 255.255.252.0 up route add default gw X.X.X.X I was successful in setting up static ip X.X.X.X and I could see the same in the output of command "ifconfig". Now I am trying to revert network back to dhcp using the below commands: Commands: ifdown eth0 ifup eth0 Output : RTNETLINK answers: File exists ssh stop/waiting ssh start/running, process 1524 ifup eth0, failed to bring back dhcp. Contents of /etc/network/interfaces root@bdhcp396:~# cat /etc/network/interfaces # The loopback network interface auto lo iface lo inet loopback # The primary network interface auto eth0 iface eth0 inet dhcp Is this a bug in Ubuntu 11.10/10.04.3? I see a similar bug raised - https://bugs.launchpad.net/ubuntu/+source/ifupdown/+bug/876829

    Read the article

  • Ancillary Objects: Separate Debug ELF Files For Solaris

    - by Ali Bahrami
    We introduced a new object ELF object type in Solaris 11 Update 1 called the Ancillary Object. This posting describes them, using material originally written during their development, the PSARC arc case, and the Solaris Linker and Libraries Manual. ELF objects contain allocable sections, which are mapped into memory at runtime, and non-allocable sections, which are present in the file for use by debuggers and observability tools, but which are not mapped or used at runtime. Typically, all of these sections exist within a single object file. Ancillary objects allow them to instead go into a separate file. There are different reasons given for wanting such a feature. One can debate whether the added complexity is worth the benefit, and in most cases it is not. However, one important case stands out — customers with very large 32-bit objects who are not ready or able to make the transition to 64-bits. We have customers who build extremely large 32-bit objects. Historically, the debug sections in these objects have used the stabs format, which is limited, but relatively compact. In recent years, the industry has transitioned to the powerful but verbose DWARF standard. In some cases, the size of these debug sections is large enough to push the total object file size past the fundamental 4GB limit for 32-bit ELF object files. The best, and ultimately only, solution to overly large objects is to transition to 64-bits. However, consider environments where: Hundreds of users may be executing the code on large shared systems. (32-bits use less memory and bus bandwidth, and on sparc runs just as fast as 64-bit code otherwise). Complex finely tuned code, where the original authors may no longer be available. Critical production code, that was expensive to qualify and bring online, and which is otherwise serving its intended purpose without issue. Users in these risk adverse and/or high scale categories have good reasons to push 32-bits objects to the limit before moving on. Ancillary objects offer these users a longer runway. Design The design of ancillary objects is intended to be simple, both to help human understanding when examining elfdump output, and to lower the bar for debuggers such as dbx to support them. The primary and ancillary objects have the same set of section headers, with the same names, in the same order (i.e. each section has the same index in both files). A single added section of type SHT_SUNW_ANCILLARY is added to both objects, containing information that allows a debugger to identify and validate both files relative to each other. Given one of these files, the ancillary section allows you to identify the other. Allocable sections go in the primary object, and non-allocable ones go into the ancillary object. A small set of non-allocable objects, notably the symbol table, are copied into both objects. As noted above, most sections are only written to one of the two objects, but both objects have the same section header array. The section header in the file that does not contain the section data is tagged with the SHF_SUNW_ABSENT section header flag to indicate its placeholder status. Compiler writers and others who produce objects can set the SUNW_SHF_PRIMARY section header flag to mark non-allocable sections that should go to the primary object rather than the ancillary. If you don't request an ancillary object, the Solaris ELF format is unchanged. Users who don't use ancillary objects do not pay for the feature. This is important, because they exist to serve a small subset of our users, and must not complicate the common case. If you do request an ancillary object, the runtime behavior of the primary object will be the same as that of a normal object. There is no added runtime cost. The primary and ancillary object together represent a logical single object. This is facilitated by the use of a single set of section headers. One can easily imagine a tool that can merge a primary and ancillary object into a single file, or the reverse. (Note that although this is an interesting intellectual exercise, we don't actually supply such a tool because there's little practical benefit above and beyond using ld to create the files). Among the benefits of this approach are: There is no need for per-file symbol tables to reflect the contents of each file. The same symbol table that would be produced for a standard object can be used. The section contents are identical in either case — there is no need to alter data to accommodate multiple files. It is very easy for a debugger to adapt to these new files, and the processing involved can be encapsulated in input/output routines. Most of the existing debugger implementation applies without modification. The limit of a 4GB 32-bit output object is now raised to 4GB of code, and 4GB of debug data. There is also the future possibility (not currently supported) to support multiple ancillary objects, each of which could contain up to 4GB of additional debug data. It must be noted however that the 32-bit DWARF debug format is itself inherently 32-bit limited, as it uses 32-bit offsets between debug sections, so the ability to employ multiple ancillary object files may not turn out to be useful. Using Ancillary Objects (From the Solaris Linker and Libraries Guide) By default, objects contain both allocable and non-allocable sections. Allocable sections are the sections that contain executable code and the data needed by that code at runtime. Non-allocable sections contain supplemental information that is not required to execute an object at runtime. These sections support the operation of debuggers and other observability tools. The non-allocable sections in an object are not loaded into memory at runtime by the operating system, and so, they have no impact on memory use or other aspects of runtime performance no matter their size. For convenience, both allocable and non-allocable sections are normally maintained in the same file. However, there are situations in which it can be useful to separate these sections. To reduce the size of objects in order to improve the speed at which they can be copied across wide area networks. To support fine grained debugging of highly optimized code requires considerable debug data. In modern systems, the debugging data can easily be larger than the code it describes. The size of a 32-bit object is limited to 4 Gbytes. In very large 32-bit objects, the debug data can cause this limit to be exceeded and prevent the creation of the object. To limit the exposure of internal implementation details. Traditionally, objects have been stripped of non-allocable sections in order to address these issues. Stripping is effective, but destroys data that might be needed later. The Solaris link-editor can instead write non-allocable sections to an ancillary object. This feature is enabled with the -z ancillary command line option. $ ld ... -z ancillary[=outfile] ...By default, the ancillary file is given the same name as the primary output object, with a .anc file extension. However, a different name can be provided by providing an outfile value to the -z ancillary option. When -z ancillary is specified, the link-editor performs the following actions. All allocable sections are written to the primary object. In addition, all non-allocable sections containing one or more input sections that have the SHF_SUNW_PRIMARY section header flag set are written to the primary object. All remaining non-allocable sections are written to the ancillary object. The following non-allocable sections are written to both the primary object and ancillary object. .shstrtab The section name string table. .symtab The full non-dynamic symbol table. .symtab_shndx The symbol table extended index section associated with .symtab. .strtab The non-dynamic string table associated with .symtab. .SUNW_ancillary Contains the information required to identify the primary and ancillary objects, and to identify the object being examined. The primary object and all ancillary objects contain the same array of sections headers. Each section has the same section index in every file. Although the primary and ancillary objects all define the same section headers, the data for most sections will be written to a single file as described above. If the data for a section is not present in a given file, the SHF_SUNW_ABSENT section header flag is set, and the sh_size field is 0. This organization makes it possible to acquire a full list of section headers, a complete symbol table, and a complete list of the primary and ancillary objects from either of the primary or ancillary objects. The following example illustrates the underlying implementation of ancillary objects. An ancillary object is created by adding the -z ancillary command line option to an otherwise normal compilation. The file utility shows that the result is an executable named a.out, and an associated ancillary object named a.out.anc. $ cat hello.c #include <stdio.h> int main(int argc, char **argv) { (void) printf("hello, world\n"); return (0); } $ cc -g -zancillary hello.c $ file a.out a.out.anc a.out: ELF 32-bit LSB executable 80386 Version 1 [FPU], dynamically linked, not stripped, ancillary object a.out.anc a.out.anc: ELF 32-bit LSB ancillary 80386 Version 1, primary object a.out $ ./a.out hello worldThe resulting primary object is an ordinary executable that can be executed in the usual manner. It is no different at runtime than an executable built without the use of ancillary objects, and then stripped of non-allocable content using the strip or mcs commands. As previously described, the primary object and ancillary objects contain the same section headers. To see how this works, it is helpful to use the elfdump utility to display these section headers and compare them. The following table shows the section header information for a selection of headers from the previous link-edit example. Index Section Name Type Primary Flags Ancillary Flags Primary Size Ancillary Size 13 .text PROGBITS ALLOC EXECINSTR ALLOC EXECINSTR SUNW_ABSENT 0x131 0 20 .data PROGBITS WRITE ALLOC WRITE ALLOC SUNW_ABSENT 0x4c 0 21 .symtab SYMTAB 0 0 0x450 0x450 22 .strtab STRTAB STRINGS STRINGS 0x1ad 0x1ad 24 .debug_info PROGBITS SUNW_ABSENT 0 0 0x1a7 28 .shstrtab STRTAB STRINGS STRINGS 0x118 0x118 29 .SUNW_ancillary SUNW_ancillary 0 0 0x30 0x30 The data for most sections is only present in one of the two files, and absent from the other file. The SHF_SUNW_ABSENT section header flag is set when the data is absent. The data for allocable sections needed at runtime are found in the primary object. The data for non-allocable sections used for debugging but not needed at runtime are placed in the ancillary file. A small set of non-allocable sections are fully present in both files. These are the .SUNW_ancillary section used to relate the primary and ancillary objects together, the section name string table .shstrtab, as well as the symbol table.symtab, and its associated string table .strtab. It is possible to strip the symbol table from the primary object. A debugger that encounters an object without a symbol table can use the .SUNW_ancillary section to locate the ancillary object, and access the symbol contained within. The primary object, and all associated ancillary objects, contain a .SUNW_ancillary section that allows all the objects to be identified and related together. $ elfdump -T SUNW_ancillary a.out a.out.anc a.out: Ancillary Section: .SUNW_ancillary index tag value [0] ANC_SUNW_CHECKSUM 0x8724 [1] ANC_SUNW_MEMBER 0x1 a.out [2] ANC_SUNW_CHECKSUM 0x8724 [3] ANC_SUNW_MEMBER 0x1a3 a.out.anc [4] ANC_SUNW_CHECKSUM 0xfbe2 [5] ANC_SUNW_NULL 0 a.out.anc: Ancillary Section: .SUNW_ancillary index tag value [0] ANC_SUNW_CHECKSUM 0xfbe2 [1] ANC_SUNW_MEMBER 0x1 a.out [2] ANC_SUNW_CHECKSUM 0x8724 [3] ANC_SUNW_MEMBER 0x1a3 a.out.anc [4] ANC_SUNW_CHECKSUM 0xfbe2 [5] ANC_SUNW_NULL 0 The ancillary sections for both objects contain the same number of elements, and are identical except for the first element. Each object, starting with the primary object, is introduced with a MEMBER element that gives the file name, followed by a CHECKSUM that identifies the object. In this example, the primary object is a.out, and has a checksum of 0x8724. The ancillary object is a.out.anc, and has a checksum of 0xfbe2. The first element in a .SUNW_ancillary section, preceding the MEMBER element for the primary object, is always a CHECKSUM element, containing the checksum for the file being examined. The presence of a .SUNW_ancillary section in an object indicates that the object has associated ancillary objects. The names of the primary and all associated ancillary objects can be obtained from the ancillary section from any one of the files. It is possible to determine which file is being examined from the larger set of files by comparing the first checksum value to the checksum of each member that follows. Debugger Access and Use of Ancillary Objects Debuggers and other observability tools must merge the information found in the primary and ancillary object files in order to build a complete view of the object. This is equivalent to processing the information from a single file. This merging is simplified by the primary object and ancillary objects containing the same section headers, and a single symbol table. The following steps can be used by a debugger to assemble the information contained in these files. Starting with the primary object, or any of the ancillary objects, locate the .SUNW_ancillary section. The presence of this section identifies the object as part of an ancillary group, contains information that can be used to obtain a complete list of the files and determine which of those files is the one currently being examined. Create a section header array in memory, using the section header array from the object being examined as an initial template. Open and read each file identified by the .SUNW_ancillary section in turn. For each file, fill in the in-memory section header array with the information for each section that does not have the SHF_SUNW_ABSENT flag set. The result will be a complete in-memory copy of the section headers with pointers to the data for all sections. Once this information has been acquired, the debugger can proceed as it would in the single file case, to access and control the running program. Note - The ELF definition of ancillary objects provides for a single primary object, and an arbitrary number of ancillary objects. At this time, the Oracle Solaris link-editor only produces a single ancillary object containing all non-allocable sections. This may change in the future. Debuggers and other observability tools should be written to handle the general case of multiple ancillary objects. ELF Implementation Details (From the Solaris Linker and Libraries Guide) To implement ancillary objects, it was necessary to extend the ELF format to add a new object type (ET_SUNW_ANCILLARY), a new section type (SHT_SUNW_ANCILLARY), and 2 new section header flags (SHF_SUNW_ABSENT, SHF_SUNW_PRIMARY). In this section, I will detail these changes, in the form of diffs to the Solaris Linker and Libraries manual. Part IV ELF Application Binary Interface Chapter 13: Object File Format Object File Format Edit Note: This existing section at the beginning of the chapter describes the ELF header. There's a table of object file types, which now includes the new ET_SUNW_ANCILLARY type. e_type Identifies the object file type, as listed in the following table. NameValueMeaning ET_NONE0No file type ET_REL1Relocatable file ET_EXEC2Executable file ET_DYN3Shared object file ET_CORE4Core file ET_LOSUNW0xfefeStart operating system specific range ET_SUNW_ANCILLARY0xfefeAncillary object file ET_HISUNW0xfefdEnd operating system specific range ET_LOPROC0xff00Start processor-specific range ET_HIPROC0xffffEnd processor-specific range Sections Edit Note: This overview section defines the section header structure, and provides a high level description of known sections. It was updated to define the new SHF_SUNW_ABSENT and SHF_SUNW_PRIMARY flags and the new SHT_SUNW_ANCILLARY section. ... sh_type Categorizes the section's contents and semantics. Section types and their descriptions are listed in Table 13-5. sh_flags Sections support 1-bit flags that describe miscellaneous attributes. Flag definitions are listed in Table 13-8. ... Table 13-5 ELF Section Types, sh_type NameValue . . . SHT_LOSUNW0x6fffffee SHT_SUNW_ancillary0x6fffffee . . . ... SHT_LOSUNW - SHT_HISUNW Values in this inclusive range are reserved for Oracle Solaris OS semantics. SHT_SUNW_ANCILLARY Present when a given object is part of a group of ancillary objects. Contains information required to identify all the files that make up the group. See Ancillary Section. ... Table 13-8 ELF Section Attribute Flags NameValue . . . SHF_MASKOS0x0ff00000 SHF_SUNW_NODISCARD0x00100000 SHF_SUNW_ABSENT0x00200000 SHF_SUNW_PRIMARY0x00400000 SHF_MASKPROC0xf0000000 . . . ... SHF_SUNW_ABSENT Indicates that the data for this section is not present in this file. When ancillary objects are created, the primary object and any ancillary objects, will all have the same section header array, to facilitate merging them to form a complete view of the object, and to allow them to use the same symbol tables. Each file contains a subset of the section data. The data for allocable sections is written to the primary object while the data for non-allocable sections is written to an ancillary file. The SHF_SUNW_ABSENT flag is used to indicate that the data for the section is not present in the object being examined. When the SHF_SUNW_ABSENT flag is set, the sh_size field of the section header must be 0. An application encountering an SHF_SUNW_ABSENT section can choose to ignore the section, or to search for the section data within one of the related ancillary files. SHF_SUNW_PRIMARY The default behavior when ancillary objects are created is to write all allocable sections to the primary object and all non-allocable sections to the ancillary objects. The SHF_SUNW_PRIMARY flag overrides this behavior. Any output section containing one more input section with the SHF_SUNW_PRIMARY flag set is written to the primary object without regard for its allocable status. ... Two members in the section header, sh_link, and sh_info, hold special information, depending on section type. Table 13-9 ELF sh_link and sh_info Interpretation sh_typesh_linksh_info . . . SHT_SUNW_ANCILLARY The section header index of the associated string table. 0 . . . Special Sections Edit Note: This section describes the sections used in Solaris ELF objects, using the types defined in the previous description of section types. It was updated to define the new .SUNW_ancillary (SHT_SUNW_ANCILLARY) section. Various sections hold program and control information. Sections in the following table are used by the system and have the indicated types and attributes. Table 13-10 ELF Special Sections NameTypeAttribute . . . .SUNW_ancillarySHT_SUNW_ancillaryNone . . . ... .SUNW_ancillary Present when a given object is part of a group of ancillary objects. Contains information required to identify all the files that make up the group. See Ancillary Section for details. ... Ancillary Section Edit Note: This new section provides the format reference describing the layout of a .SUNW_ancillary section and the meaning of the various tags. Note that these sections use the same tag/value concept used for dynamic and capabilities sections, and will be familiar to anyone used to working with ELF. In addition to the primary output object, the Solaris link-editor can produce one or more ancillary objects. Ancillary objects contain non-allocable sections that would normally be written to the primary object. When ancillary objects are produced, the primary object and all of the associated ancillary objects contain a SHT_SUNW_ancillary section, containing information that identifies these related objects. Given any one object from such a group, the ancillary section provides the information needed to identify and interpret the others. This section contains an array of the following structures. See sys/elf.h. typedef struct { Elf32_Word a_tag; union { Elf32_Word a_val; Elf32_Addr a_ptr; } a_un; } Elf32_Ancillary; typedef struct { Elf64_Xword a_tag; union { Elf64_Xword a_val; Elf64_Addr a_ptr; } a_un; } Elf64_Ancillary; For each object with this type, a_tag controls the interpretation of a_un. a_val These objects represent integer values with various interpretations. a_ptr These objects represent file offsets or addresses. The following ancillary tags exist. Table 13-NEW1 ELF Ancillary Array Tags NameValuea_un ANC_SUNW_NULL0Ignored ANC_SUNW_CHECKSUM1a_val ANC_SUNW_MEMBER2a_ptr ANC_SUNW_NULL Marks the end of the ancillary section. ANC_SUNW_CHECKSUM Provides the checksum for a file in the c_val element. When ANC_SUNW_CHECKSUM precedes the first instance of ANC_SUNW_MEMBER, it provides the checksum for the object from which the ancillary section is being read. When it follows an ANC_SUNW_MEMBER tag, it provides the checksum for that member. ANC_SUNW_MEMBER Specifies an object name. The a_ptr element contains the string table offset of a null-terminated string, that provides the file name. An ancillary section must always contain an ANC_SUNW_CHECKSUM before the first instance of ANC_SUNW_MEMBER, identifying the current object. Following that, there should be an ANC_SUNW_MEMBER for each object that makes up the complete set of objects. Each ANC_SUNW_MEMBER should be followed by an ANC_SUNW_CHECKSUM for that object. A typical ancillary section will therefore be structured as: TagMeaning ANC_SUNW_CHECKSUMChecksum of this object ANC_SUNW_MEMBERName of object #1 ANC_SUNW_CHECKSUMChecksum for object #1 . . . ANC_SUNW_MEMBERName of object N ANC_SUNW_CHECKSUMChecksum for object N ANC_SUNW_NULL An object can therefore identify itself by comparing the initial ANC_SUNW_CHECKSUM to each of the ones that follow, until it finds a match. Related Other Work The GNU developers have also encountered the need/desire to support separate debug information files, and use the solution detailed at http://sourceware.org/gdb/onlinedocs/gdb/Separate-Debug-Files.html. At the current time, the separate debug file is constructed by building the standard object first, and then copying the debug data out of it in a separate post processing step, Hence, it is limited to a total of 4GB of code and debug data, just as a single object file would be. They are aware of this, and I have seen online comments indicating that they may add direct support for generating these separate files to their link-editor. It is worth noting that the GNU objcopy utility is available on Solaris, and that the Studio dbx debugger is able to use these GNU style separate debug files even on Solaris. Although this is interesting in terms giving Linux users a familiar environment on Solaris, the 4GB limit means it is not an answer to the problem of very large 32-bit objects. We have also encountered issues with objcopy not understanding Solaris-specific ELF sections, when using this approach. The GNU community also has a current effort to adapt their DWARF debug sections in order to move them to separate files before passing the relocatable objects to the linker. The details of Project Fission can be found at http://gcc.gnu.org/wiki/DebugFission. The goal of this project appears to be to reduce the amount of data seen by the link-editor. The primary effort revolves around moving DWARF data to separate .dwo files so that the link-editor never encounters them. The details of modifying the DWARF data to be usable in this form are involved — please see the above URL for details.

    Read the article

  • Metro: Using Templates

    - by Stephen.Walther
    The goal of this blog post is to describe how templates work in the WinJS library. In particular, you learn how to use a template to display both a single item and an array of items. You also learn how to load a template from an external file. Why use Templates? Imagine that you want to display a list of products in a page. The following code is bad: var products = [ { name: "Tesla", price: 80000 }, { name: "VW Rabbit", price: 200 }, { name: "BMW", price: 60000 } ]; var productsHTML = ""; for (var i = 0; i < products.length; i++) { productsHTML += "<h1>Product Details</h1>" + "<div>Product Name: " + products[i].name + "</div>" + "<div>Product Price: " + products[i].price + "</div>"; } document.getElementById("productContainer").innerHTML = productsHTML; In the code above, an array of products is displayed by creating a for..next loop which loops through each element in the array. A string which represents a list of products is built through concatenation. The code above is a designer’s nightmare. You cannot modify the appearance of the list of products without modifying the JavaScript code. A much better approach is to use a template like this: <div id="productTemplate"> <h1>Product Details</h1> <div> Product Name: <span data-win-bind="innerText:name"></span> </div> <div> Product Price: <span data-win-bind="innerText:price"></span> </div> </div> A template is simply a fragment of HTML that contains placeholders. Instead of displaying a list of products by concatenating together a string, you can render a template for each product. Creating a Simple Template Let’s start by using a template to render a single product. The following HTML page contains a template and a placeholder for rendering the template: <!DOCTYPE html> <html> <head> <meta charset="utf-8"> <title>Application1</title> <!-- WinJS references --> <link href="//Microsoft.WinJS.0.6/css/ui-dark.css" rel="stylesheet"> <script src="//Microsoft.WinJS.0.6/js/base.js"></script> <script src="//Microsoft.WinJS.0.6/js/ui.js"></script> <!-- Application1 references --> <link href="/css/default.css" rel="stylesheet"> <script src="/js/default.js"></script> </head> <body> <!-- Product Template --> <div id="productTemplate"> <h1>Product Details</h1> <div> Product Name: <span data-win-bind="innerText:name"></span> </div> <div> Product Price: <span data-win-bind="innerText:price"></span> </div> </div> <!-- Place where Product Template is Rendered --> <div id="productContainer"></div> </body> </html> In the page above, the template is defined in a DIV element with the id productTemplate. The contents of the productTemplate are not displayed when the page is opened in the browser. The contents of a template are automatically hidden when you convert the productTemplate into a template in your JavaScript code. Notice that the template uses data-win-bind attributes to display the product name and price properties. You can use both data-win-bind and data-win-bindsource attributes within a template. To learn more about these attributes, see my earlier blog post on WinJS data binding: http://stephenwalther.com/blog/archive/2012/02/26/windows-web-applications-declarative-data-binding.aspx The page above also includes a DIV element named productContainer. The rendered template is added to this element. Here’s the code for the default.js script which creates and renders the template: (function () { "use strict"; var app = WinJS.Application; app.onactivated = function (eventObject) { if (eventObject.detail.kind === Windows.ApplicationModel.Activation.ActivationKind.launch) { var product = { name: "Tesla", price: 80000 }; var productTemplate = new WinJS.Binding.Template(document.getElementById("productTemplate")); productTemplate.render(product, document.getElementById("productContainer")); } }; app.start(); })(); In the code above, a single product object is created with the following line of code: var product = { name: "Tesla", price: 80000 }; Next, the productTemplate element from the page is converted into an actual WinJS template with the following line of code: var productTemplate = new WinJS.Binding.Template(document.getElementById("productTemplate")); The template is rendered to the templateContainer element with the following line of code: productTemplate.render(product, document.getElementById("productContainer")); The result of this work is that the product details are displayed: Notice that you do not need to call WinJS.Binding.processAll(). The Template render() method takes care of the binding for you. Displaying an Array in a Template If you want to display an array of products using a template then you simply need to create a for..next loop and iterate through the array calling the Template render() method for each element. (function () { "use strict"; var app = WinJS.Application; app.onactivated = function (eventObject) { if (eventObject.detail.kind === Windows.ApplicationModel.Activation.ActivationKind.launch) { var products = [ { name: "Tesla", price: 80000 }, { name: "VW Rabbit", price: 200 }, { name: "BMW", price: 60000 } ]; var productTemplate = new WinJS.Binding.Template(document.getElementById("productTemplate")); var productContainer = document.getElementById("productContainer"); var i, product; for (i = 0; i < products.length; i++) { product = products[i]; productTemplate.render(product, productContainer); } } }; app.start(); })(); After each product in the array is rendered with the template, the result is appended to the productContainer element. No changes need to be made to the HTML page discussed in the previous section to display an array of products instead of a single product. The same product template can be used in both scenarios. Rendering an HTML TABLE with a Template When using the WinJS library, you create a template by creating an HTML element in your page. One drawback to this approach of creating templates is that your templates are part of your HTML page. In order for your HTML page to validate, the HTML within your templates must also validate. This means, for example, that you cannot enclose a single HTML table row within a template. The following HTML is invalid because you cannot place a TR element directly within the body of an HTML document:   <!-- Product Template --> <tr> <td data-win-bind="innerText:name"></td> <td data-win-bind="innerText:price"></td> </tr> This template won’t validate because, in a valid HTML5 document, a TR element must appear within a THEAD or TBODY element. Instead, you must create the entire TABLE element in the template. The following HTML page illustrates how you can create a template which contains a TR element: <!DOCTYPE html> <html> <head> <meta charset="utf-8"> <title>Application1</title> <!-- WinJS references --> <link href="//Microsoft.WinJS.0.6/css/ui-dark.css" rel="stylesheet"> <script src="//Microsoft.WinJS.0.6/js/base.js"></script> <script src="//Microsoft.WinJS.0.6/js/ui.js"></script> <!-- Application1 references --> <link href="/css/default.css" rel="stylesheet"> <script src="/js/default.js"></script> </head> <body> <!-- Product Template --> <div id="productTemplate"> <table> <tbody> <tr> <td data-win-bind="innerText:name"></td> <td data-win-bind="innerText:price"></td> </tr> </tbody> </table> </div> <!-- Place where Product Template is Rendered --> <table> <thead> <tr> <th>Name</th><th>Price</th> </tr> </thead> <tbody id="productContainer"> </tbody> </table> </body> </html>   In the HTML page above, the product template includes TABLE and TBODY elements: <!-- Product Template --> <div id="productTemplate"> <table> <tbody> <tr> <td data-win-bind="innerText:name"></td> <td data-win-bind="innerText:price"></td> </tr> </tbody> </table> </div> We discard these elements when we render the template. The only reason that we include the TABLE and THEAD elements in the template is to make the HTML page validate as valid HTML5 markup. Notice that the productContainer (the target of the template) in the page above is a TBODY element. We want to add the rows rendered by the template to the TBODY element in the page. The productTemplate is rendered in the default.js file: (function () { "use strict"; var app = WinJS.Application; app.onactivated = function (eventObject) { if (eventObject.detail.kind === Windows.ApplicationModel.Activation.ActivationKind.launch) { var products = [ { name: "Tesla", price: 80000 }, { name: "VW Rabbit", price: 200 }, { name: "BMW", price: 60000 } ]; var productTemplate = new WinJS.Binding.Template(document.getElementById("productTemplate")); var productContainer = document.getElementById("productContainer"); var i, product, row; for (i = 0; i < products.length; i++) { product = products[i]; productTemplate.render(product).then(function (result) { row = WinJS.Utilities.query("tr", result).get(0); productContainer.appendChild(row); }); } } }; app.start(); })(); When the product template is rendered, the TR element is extracted from the rendered template by using the WinJS.Utilities.query() method. Next, only the TR element is added to the productContainer: productTemplate.render(product).then(function (result) { row = WinJS.Utilities.query("tr", result).get(0); productContainer.appendChild(row); }); I discuss the WinJS.Utilities.query() method in depth in a previous blog entry: http://stephenwalther.com/blog/archive/2012/02/23/windows-web-applications-query-selectors.aspx When everything gets rendered, the products are displayed in an HTML table: You can see the actual HTML rendered by looking at the Visual Studio DOM Explorer window:   Loading an External Template Instead of embedding a template in an HTML page, you can place your template in an external HTML file. It makes sense to create a template in an external file when you need to use the same template in multiple pages. For example, you might need to use the same product template in multiple pages in your application. The following HTML page does not contain a template. It only contains a container that will act as a target for the rendered template: <!DOCTYPE html> <html> <head> <meta charset="utf-8"> <title>Application1</title> <!-- WinJS references --> <link href="//Microsoft.WinJS.0.6/css/ui-dark.css" rel="stylesheet"> <script src="//Microsoft.WinJS.0.6/js/base.js"></script> <script src="//Microsoft.WinJS.0.6/js/ui.js"></script> <!-- Application1 references --> <link href="/css/default.css" rel="stylesheet"> <script src="/js/default.js"></script> </head> <body> <!-- Place where Product Template is Rendered --> <div id="productContainer"></div> </body> </html> The template is contained in a separate file located at the path /templates/productTemplate.html:   Here’s the contents of the productTemplate.html file: <!-- Product Template --> <div id="productTemplate"> <h1>Product Details</h1> <div> Product Name: <span data-win-bind="innerText:name"></span> </div> <div> Product Price: <span data-win-bind="innerText:price"></span> </div> </div> Notice that the template file only contains the template and not the standard opening and closing HTML elements. It is an HTML fragment. If you prefer, you can include all of the standard opening and closing HTML elements in your external template – these elements get stripped away automatically: <html> <head><title>product template</title></head> <body> <!-- Product Template --> <div id="productTemplate"> <h1>Product Details</h1> <div> Product Name: <span data-win-bind="innerText:name"></span> </div> <div> Product Price: <span data-win-bind="innerText:price"></span> </div> </div> </body> </html> Either approach – using a fragment or using a full HTML document  — works fine. Finally, the following default.js file loads the external template, renders the template for each product, and appends the result to the product container: (function () { "use strict"; var app = WinJS.Application; app.onactivated = function (eventObject) { if (eventObject.detail.kind === Windows.ApplicationModel.Activation.ActivationKind.launch) { var products = [ { name: "Tesla", price: 80000 }, { name: "VW Rabbit", price: 200 }, { name: "BMW", price: 60000 } ]; var productTemplate = new WinJS.Binding.Template(null, { href: "/templates/productTemplate.html" }); var productContainer = document.getElementById("productContainer"); var i, product, row; for (i = 0; i < products.length; i++) { product = products[i]; productTemplate.render(product, productContainer); } } }; app.start(); })(); The path to the external template is passed to the constructor for the Template class as one of the options: var productTemplate = new WinJS.Binding.Template(null, {href:"/templates/productTemplate.html"}); When a template is contained in a page then you use the first parameter of the WinJS.Binding.Template constructor to represent the template – instead of null, you pass the element which contains the template. When a template is located in an external file, you pass the href for the file as part of the second parameter for the WinJS.Binding.Template constructor. Summary The goal of this blog entry was to describe how you can use WinJS templates to render either a single item or an array of items to a page. We also explored two advanced topics. You learned how to render an HTML table by extracting the TR element from a template. You also learned how to place a template in an external file.

    Read the article

  • RSS feeds in Orchard

    When we added RSS to Orchard, we wanted to make it easy for any module to expose any contents as a feed. We also wanted the rendering of the feed to be handled by Orchard in order to minimize the amount of work from the module developer. A typical example of such feed exposition is of course blog feeds. We have an IFeedManager interface for which you can get the built-in implementation through dependency injection. Look at the BlogController constructor for an example: public BlogController(...Did you know that DotNetSlackers also publishes .net articles written by top known .net Authors? We already have over 80 articles in several categories including Silverlight. Take a look: here.

    Read the article

  • Edit ePub eBooks with Your Favorite HTML Editor

    - by Matthew Guay
    ePub eBooks are increasingly popular today, but often they’ve been made by converting other file formats. Here’s how you can edit ePub books to remove irregularities and make them better for reading on your devices. ePub’s are actually a zip file containing images, XHTML files with your text, and more with the .epub extension. You can make them better by editing the XHTML files directly.  Code gurus can edit the code directly, but even if you’ve never edited HTML, you can still quickly make changes with a WYSIWYG editor. Extract the Files from your ePub eBook As mentioned before, ePub files are actually renamed zip files.  So first let’s get all of the files in your ePub eBook accessible.  Find an eBook you want to edit and then change the file extension to .zip. If you don’t see the file extensions, click Organize in the menu bar and select Folder and search options. Select the View tab, and then uncheck the box beside Hide extensions for known file types.  Click Ok, and then change the file type as above. Windows will warn you about changing the file type; click Yes to proceed. Now you can browse the files of the ePub file.  Notice that it contains mostly HTML or XHTML files and images.  Click Extract all files to save them all in a folder so you can easily edit them. Alternately, you can open the ePub file directly in your favorite file archival program such as 7-zip.  Browse to the location of your ePub file, double-click it, and it’ll automatically open even if you don’t change the file extension to zip.  Now you can extract the folder, or extract individual files as before.   Edit Your eBook in KompoZer The actual ebook contents are stored in HTML or XHTML files.  These may be stored on the top folder of you ePub file’s directory, or they may be stored in \OEBPS\text in the file. To change the contents of your eBook, you’ll want to edit these files.  Often there may be separate files for each chapter, so you may have to use trial and error to find the one you need to edit.  You could edit them by hand in Windows using Notepad if you don’t have an HTML editor installed. A better option would be to use an HTML editor.  Here we’ll use the free KompoZer program to edit the files just like we’d edit a document in Word. Download KompoZer (link below), and unzip the files.  Then open the new folder and launch kompozer.exe; you don’t even need to install it.  In fact, you could even store KompoZer on a flash drive so you could edit HTML files from any computer. In KompoZer, open the HTML or XHTML file from your eBook that you want to edit. Now you can edit the file just like you would edit a document in Word.  Remove extra and unneeded text, make titles stand out, correct misspellings … anything you want!  This is especially helpful if your ePub file was created by converting a PDF as these often have many small errors. Or, if you’d rather edit the code itself, select the Source tab and edit as you wish. When you’re done making the changes, make sure to save the file in the same location with the same file name. Recreate Your Edited ePub eBook Once you’ve made all the changes you wanted, it’s time to turn this folder of files back into ePub.  Make sure you change the name of the folder if it still has the same name as the original ePub or zip file so you don’t mix them up or have trouble with overwriting the old files. Zip the folder using Windows Explorer or your favorite archival utility.  If you are using another archival program, make sure to compress it as a zip folder; other compression methods will render the ePub unreadable by your eReader app. Now change the file extension again, this time back to .epub. Now you can read your eBook with your changes in your favorite reader program or app on your mobile device. Conclusion Whether you need to remove an odd, misplaced character or need to do fine editing, using an HTML editor is a great way to make your ePub eBooks look just like you want.  Also, with an editor like KompoZer it’s not even difficult. Download KompoZer Similar Articles Productive Geek Tips Change the Default Editor From Nano on Ubuntu LinuxConvert a PDF eBook to ePub Format for Your iPad, iPhone, or eReaderRead Mobi eBooks on Kindle for PCEdit Your Firefox Bookmarks Easier with Flat Bookmark EditorChange the Default Editor for Batch Files in Vista TouchFreeze Alternative in AutoHotkey The Icy Undertow Desktop Windows Home Server – Backup to LAN The Clear & Clean Desktop Use This Bookmarklet to Easily Get Albums Use AutoHotkey to Assign a Hotkey to a Specific Window Latest Software Reviews Tinyhacker Random Tips HippoRemote Pro 2.2 Xobni Plus for Outlook All My Movies 5.9 CloudBerry Online Backup 1.5 for Windows Home Server XPS file format & XPS Viewer Explained Microsoft Office Web Apps Guide Know if Someone Accessed Your Facebook Account Shop for Music with Windows Media Player 12 Access Free Documentaries at BBC Documentaries Rent Cameras In Bulk At CameraRenter

    Read the article

  • Algorithmia Source Code released on CodePlex

    - by FransBouma
    Following the release of our BCL Extensions Library on CodePlex, we have now released the source-code of Algorithmia on CodePlex! Algorithmia is an algorithm and data-structures library for .NET 3.5 or higher and is one of the pillars LLBLGen Pro v3's designer is built on. The library contains many data-structures and algorithms, and the source-code is well documented and commented, often with links to official descriptions and papers of the algorithms and data-structures implemented. The source-code is shared using Mercurial on CodePlex and is licensed under the friendly BSD2 license. User documentation is not available at the moment but will be added soon. One of the main design goals of Algorithmia was to create a library which contains implementations of well-known algorithms which weren't already implemented in .NET itself. This way, more developers out there can enjoy the results of many years of what the field of Computer Science research has delivered. Some algorithms and datastructures are known in .NET but are re-implemented because the implementation in .NET isn't efficient for many situations or lacks features. An example is the linked list in .NET: it doesn't have an O(1) concat operation, as every node refers to the containing LinkedList object it's stored in. This is bad for algorithms which rely on O(1) concat operations, like the Fibonacci heap implementation in Algorithmia. Algorithmia therefore contains a linked list with an O(1) concat feature. The following functionality is available in Algorithmia: Command, Command management. This system is usable to build a fully undo/redo aware system by building your object graph using command-aware classes. The Command pattern is implemented using a system which allows transparent undo-redo and command grouping so you can use it to make a class undo/redo aware and set properties, use its contents without using commands at all. The Commands namespace is the namespace to start. Classes you'd want to look at are CommandifiedMember, CommandifiedList and KeyedCommandifiedList. See the CommandQueueTests in the test project for examples. Graphs, Graph algorithms. Algorithmia contains a sophisticated graph class hierarchy and algorithms implemented onto them: non-directed and directed graphs, as well as a subgraph view class, which can be used to create a view onto an existing graph class which can be self-maintaining. Algorithms include transitive closure, topological sorting and others. A feature rich depth-first search (DFS) crawler is available so DFS based algorithms can be implemented quickly. All graph classes are undo/redo aware, as they can be set to be 'commandified'. When a graph is 'commandified' it will do its housekeeping through commands, which makes it fully undo-redo aware, so you can remove, add and manipulate the graph and undo/redo the activity automatically without any extra code. If you define the properties of the class you set as the vertex type using CommandifiedMember, you can manipulate the properties of vertices and the graph contents with full undo/redo functionality without any extra code. Heaps. Heaps are data-structures which have the largest or smallest item stored in them always as the 'root'. Extracting the root from the heap makes the heap determine the next in line to be the 'maximum' or 'minimum' (max-heap vs. min-heap, all heaps in Algorithmia can do both). Algorithmia contains various heaps, among them an implementation of the Fibonacci heap, one of the most efficient heap datastructures known today, especially when you want to merge different instances into one. Priority queues. Priority queues are specializations of heaps. Algorithmia contains a couple of them. Sorting. What's an algorithm library without sort algorithms? Algorithmia implements a couple of sort algorithms which sort the data in-place. This aspect is important in situations where you want to sort the elements in a buffer/list/ICollection in-place, so all data stays in the data-structure it already is stored in. PropertyBag. It re-implements Tony Allowatt's original idea in .NET 3.5 specific syntax, which is to have a generic property bag and to be able to build an object in code at runtime which can be bound to a property grid for editing. This is handy for when you have data / settings stored in XML or other format, and want to create an editable form of it without creating many editors. IEditableObject/IDataErrorInfo implementations. It contains default implementations for IEditableObject and IDataErrorInfo (EditableObjectDataContainer for IEditableObject and ErrorContainer for IDataErrorInfo), which make it very easy to implement these interfaces (just a few lines of code) without having to worry about bookkeeping during databinding. They work seamlessly with CommandifiedMember as well, so your undo/redo aware code can use them out of the box. EventThrottler. It contains an event throttler, which can be used to filter out duplicate events in an event stream coming into an observer from an event. This can greatly enhance performance in your UI without needing to do anything other than hooking it up so it's placed between the event source and your real handler. If your UI is flooded with events from data-structures observed by your UI or a middle tier, you can use this class to filter out duplicates to avoid redundant updates to UI elements or to avoid having observers choke on many redundant events. Small, handy stuff. A MultiValueDictionary, which can store multiple unique values per key, instead of one with the default Dictionary, and is also merge-aware so you can merge two into one. A Pair class, to quickly group two elements together. Multiple interfaces for helping with building a de-coupled, observer based system, and some utility extension methods for the defined data-structures. We regularly update the library with new code. If you have ideas for new algorithms or want to share your contribution, feel free to discuss it on the project's Discussions page or send us a pull request. Enjoy!

    Read the article

  • Part 14: Execute a PowerShell script

    In the series the following parts have been published Part 1: Introduction Part 2: Add arguments and variables Part 3: Use more complex arguments Part 4: Create your own activity Part 5: Increase AssemblyVersion Part 6: Use custom type for an argument Part 7: How is the custom assembly found Part 8: Send information to the build log Part 9: Impersonate activities (run under other credentials) Part 10: Include Version Number in the Build Number Part 11: Speed up opening my build process template Part 12: How to debug my custom activities Part 13: Get control over the Build Output Part 14: Execute a PowerShell script Part 15: Fail a build based on the exit code of a console application With PowerShell you can add powerful scripting to your build to for example execute a deployment. If you want more information on PowerShell, please refer to http://technet.microsoft.com/en-us/library/aa973757.aspx For this example we will create a simple PowerShell script that prints “Hello world!”. To create the script, create a new text file and name it “HelloWorld.ps1”. Add to the contents of the script: Write-Host “Hello World!” To test the script do the following: Open the command prompt To run the script you must change the execution policy. To do this execute in the command prompt: powershell set-executionpolicy remotesigned Now go to the directory where you have saved the PowerShell script Execute the following command powershell .\HelloWorld.ps1 In this example I use a relative path, but when the path to the PowerShell script contains spaces, you need to change the syntax to powershell "& '<full path to script>' " for example: powershell "& ‘C:\sources\Build Customization\SolutionToBuild\PowerShell Scripts\HellloWorld.ps1’ " In this blog post, I create a new solution and that solution includes also this PowerShell script. I want to create an argument on the Build Process Template that holds the path to the PowerShell script. In the Build Process Template I will add an InvokeProcess activity to execute the PowerShell command. This InvokeProcess activity needs the location of the script as an argument for the PowerShell command. Since you don’t know the full path at the build server of this script, you can either specify in the argument the relative path of the script, but it is hard to find out what the relative path is. I prefer to specify the location of the script in source control and then convert that server path to a local path. To do this conversion you can use the ConvertWorkspaceItem activity. So to complete the task, open the Build Process Template CustomTemplate.xaml that we created in earlier parts, follow the following steps Add a new argument called “DeploymentScript” and set the appropriate settings in the metadata. See Part 2: Add arguments and variables  for more information. Scroll down beneath the TryCatch activity called “Try Compile, Test, and Associate Changesets and Work Items” Add a new If activity and set the condition to "Not String.IsNullOrEmpty(DeploymentScript)" to ensure it will only run when the argument is passed. Add in the Then branch of the If activity a new Sequence activity and rename it to “Start deployment” Click on the activity and add a new variable called DeploymentScriptFilename (scoped to the “Start deployment” Sequence Add a ConvertWorkspaceItem activity on the “Start deployment” Sequence Add a InvokeProcess activity beneath the ConvertWorkspaceItem activity in the “Start deployment” Sequence Click on the ConvertWorkspaceItem activity and change the properties DisplayName = Convert deployment script filename Input = DeploymentScript Result = DeploymentScriptFilename Workspace = Workspace Click on the InvokeProcess activity and change the properties Arguments = String.Format(" ""& '{0}' "" ", DeploymentScriptFilename) DisplayName = Execute deployment script FileName = "PowerShell" To see results from the powershell command drop a WriteBuildMessage activity on the "Handle Standard Output" and pass the stdOutput variable to the Message property. Do the same for a WriteBuildError activity on the "Handle Error Output" To publish it, check in the Build Process Template This leads to the following result We now go to the build definition that depends on the template and set the path of the deployment script to the server path to the HelloWorld.ps1. (If you want to see the result of the PowerShell script, change the Logging verbosity to Detailed or Diagnostic). Save and run the build. A lot of the deployment scripts you have will have some kind of arguments (like username / password or environment variables) that you want to define in the Build Definition. To make the PowerShell configurable, you can follow the following steps. Create a new script and give it the name "HelloWho.ps1". In the contents of the file add the following lines: param (         $person     ) $message = [System.String]::Format(“Hello {0}!", $person) Write-Host $message When you now run the script on the command prompt, you will see the following So lets change the Build Process Template to accept one parameter for the deployment script. You can of course make it configurable to add a for-loop that reads through a collection of parameters but that is out of scope of this blog post. Add a new Argument called DeploymentScriptParameter In the InvokeProcess activity where the PowerShell command is executed, modify the Arguments property to String.Format(" ""& '{0}' '{1}' "" ", DeploymentScriptFilename, DeploymentScriptParameter) Check in the Build Process Template Now modify the build definition and set the Parameter of the deployment to any value and run the build. You can download the full solution at BuildProcess.zip. It will include the sources of every part and will continue to evolve.

    Read the article

  • Running a Silverlight application in the Google App Engine platform

    - by rajbk
    This post shows you how to host a Silverlight application in the Google App Engine (GAE) platform. You deploy and host your Silverlight application on Google’s infrastructure by creating a configuration file and uploading it along with your application files. I tested this by uploading an old demo of mine - the four stroke engine silverlight demo. It is currently being served by the GAE over here: http://fourstrokeengine.appspot.com/ The steps to run your Silverlight application in GAE are as follows: Account Creation Create an account at http://appengine.google.com/. You are allocated a free quota at signup. Select “Create an Application”   Verify your account by SMS   Create your application by clicking on “Create an Application”   Pick an application identifier on the next screen. The identifier has to be unique. You will use this identifier when uploading your application. The application you create will by default be accessible at [applicationidentifier].appspot.com. You can also use custom domains if needed (refer to the docs).   Save your application. Download SDK  We will use the  Windows Launcher for Google App Engine tool to upload our apps (it is possible to do the same through command line). This is a GUI for creating, running and deploying applications. The launcher lets you test the app locally before deploying it to the GAE. This tool is available in the Google App Engine SDK. The GUI is written in Python and therefore needs an installation of Python to run. Download and install the Python Binaries from here: http://www.python.org/download/ Download and install the Google App Engine SDK from here: http://code.google.com/appengine/downloads.html Run the GAE Launcher. Select Create New Application.   On the next dialog, give your application a name (this must match the identifier we created earlier) For Parent Directory, point to the directory containing your Silverlight files. Change the port if you want to. The port is used by the GAE local web server. The server is started if you choose to run the application locally for testing purposes. Hit Save. Configure, Test and Upload As shown below, the files I am interested in uploading for my Silverlight demo app are The html page used to host the Silverlight control The xap file containing the compiled Silverlight application A favicon.ico file.   We now create a configuration file for our application called app.yaml. The app.yaml file specifies how URL paths correspond to request handlers and static files.  We edit the file by selecting our app in the GUI and clicking “Edit” The contents of file after editing is shown below (note that the contents of the file should be in plain text): application: fourstrokeengine version: 1 runtime: python api_version: 1 handlers: - url: /   static_files: Default.html   upload: Default.html - url: /favicon.ico   static_files: favicon.ico   upload: favicon.ico - url: /FourStrokeEngine.xap   static_files: FourStrokeEngine.xap   upload: FourStrokeEngine.xap   mime_type: application/x-silverlight-app - url: /.*   static_files: Default.html   upload: Default.html We have listed URL patterns for our files, specified them as static files and specified a mime type for our xap file. The wild card URL at the end will match all URLs that are not found to our default page (you would normally include a html file that displays a 404 message).  To understand more about app.yaml, refer to this page. Save the file. Run the application locally by selecting “Browse” in the GUI. A web server listening on the port you specified is started (8080 in my case). The app is loaded in your default web browser pointing to http://localhost:8080/. Make sure the application works as expected. We are now ready to deploy. Click the “Deploy” icon. You will be prompted for your username and password. Hit OK. The files will get uploaded and you should get a dialog telling you to “close the window”. We are done uploading our Silverlight application. Go to http://appengine.google.com/ and launch the application by clicking on the link in the “Current Version” column.   You should be taken to a URL which points to your application running in Google’s infrastructure : http://fourstrokeengine.appspot.com/. We are done deploying our application! Clicking on the link in the Application column will take you to the Admin console where you can see stats related to system usage.  To learn more about the Google Application Engine, go here: http://code.google.com/appengine/docs/whatisgoogleappengine.html

    Read the article

  • Integrate Microsoft Translator into your ASP.Net application

    - by sreejukg
    In this article I am going to explain how easily you can integrate the Microsoft translator API to your ASP.Net application. Why we need a translation API? Once you published a website, you are opening a channel to the global audience. So making the web content available only in one language doesn’t cover all your audience. Especially when you are offering products/services it is important to provide contents in multiple languages. Users will be more comfortable when they see the content in their native language. How to achieve this, hiring translators and translate the content to all your user’s languages will cost you lot of money, and it is not a one time job, you need to translate the contents on the go. What is the alternative, we need to look for machine translation. Thankfully there are some translator engines available that gives you API level access, so that automatically you can translate the content and display to the user. Microsoft Translator API is an excellent set of web service APIs that allows developers to use the machine translation technology in their own applications. The Microsoft Translator API is offered through Windows Azure market place. In order to access the data services published in Windows Azure market place, you need to have an account. The registration process is simple, and it is common for all the services offered through the market place. Last year I had written an article about Bing Search API, where I covered the registration process. You can refer the article here. http://weblogs.asp.net/sreejukg/archive/2012/07/04/integrate-bing-search-api-to-asp-net-application.aspx Once you registered with Windows market place, you will get your APP ID. Now you can visit the Microsoft Translator page and click on the sign up button. http://datamarket.azure.com/dataset/bing/microsofttranslator As you can see, there are several options available for you to subscribe. There is a free version available, great. Click on the sign up button under the package that suits you. Clicking on the sign up button will bring the sign up form, where you need to agree on the terms and conditions and go ahead. You need to have a windows live account in order to sign up for any service available in Windows Azure market place. Once you signed up successfully, you will receive the thank you page. You can download the C# class library from here so that the integration can be made without writing much code. The C# file name is TranslatorContainer.cs. At any point of time, you can visit https://datamarket.azure.com/account/datasets to see the applications you are subscribed to. Click on the Use link next to each service will give you the details of the application. You need to not the primary account key and URL of the service to use in your application. Now let us start our ASP.Net project. I have created an empty ASP.Net web application using Visual Studio 2010 and named it Translator Sample, any name could work. By default, the web application in solution explorer looks as follows. Now right click the project and select Add -> Existing Item and then browse to the TranslatorContainer.cs. Now let us create a page where user enter some data and perform the translation. I have added a new web form to the project with name Translate.aspx. I have placed one textbox control for user to type the text to translate, the dropdown list to select the target language, a label to display the translated text and a button to perform the translation. For the dropdown list I have selected some languages supported by Microsoft translator. You can get all the supported languages with their codes from the below link. http://msdn.microsoft.com/en-us/library/hh456380.aspx The form looks as below in the design surface of Visual Studio. All the class libraries in the windows market place requires reference to System.Data.Services.Client, let us add the reference. You can find the documentation of how to use the downloaded class library from the below link. http://msdn.microsoft.com/en-us/library/gg312154.aspx Let us evaluate the translatorContainer.cs file. You can refer the code and it is self-explanatory. Note the namespace name used (Microsoft), you need to add the namespace reference to your page. I have added the following event for the translate button. The code is self-explanatory. You are creating an object of TranslatorContainer class by passing the translation service URL. Now you need to set credentials for your Translator container object, which will be your account key. The TranslatorContainer support a method that accept a text input, source language and destination language and returns DataServiceQuery<Translation>. Let us see this working, I just ran the application and entered Good Morning in the Textbox. Selected target language and see the output as follows. It is easy to build great translator applications using Microsoft translator API, and there is a reasonable amount of translation you can perform in your application for free. For enterprises, you can subscribe to the appropriate package and make your application multi-lingual.

    Read the article

  • Generate HTML pages from some template

    - by Appu
    I have an open-source project for which I have to generate HTML pages to put on the web. I wanted to keep everything as simple HTML pages. The problem with this approach is if I need to change the design, I have to goto all the pages and change it. This will be tough as I have lot of pages. Is there some kind of HTML generators which can process simple annotated text files? This way, I can maintain the documentation and website contents as plain text files and run it through this program to generate static HTML pages. This also helps in keeping the design consistent. Any help would be great!

    Read the article

  • ODI 11g - Oracle Data Integrator 11g – A Hands-On Tutorial

    - by David Allan
    I've have been asked by Packt publishing to review a brand new book on Oracle Data Integrator: Getting Started with Oracle Data Integrator 11g – A Hands-On Tutorial. Waiting on this book to arrive and see what goodies are inside, I'll blog a review later. The book can be found at Oracle Data Integrator 11g – A Hands-On Tutorial Looking at the table of contents, it looks like it gives a good broad introduction (including various data formats) to the product; Chapter 1: Product Overview Chapter 2: Product Installation Chapter 3: Using Variables Chapter 4: ODI Sources, Targets, and Knowledge Modules Chapter 5: Working with Databases Chapter 6: Working with MySQL Chapter 7: Working with Microsoft SQL Server Chapter 8: Integrating File Data Chapter 9: Working with XML Files Chapter 10: Creating Workflows—Packages and Load Plans Chapter 11: Error Management Chapter 12: Managing and Monitoring ODI Components Chapter 13: Concluding Remarks Looking forward to it.

    Read the article

  • What is the quickest way to indent a block of text with spaces for use within a web browser?

    - by ændrük
    I occasionally have the need to indent a block of text with spaces for use within a web browser, for example, when formatting a code block on this site or in a post on Launchpad. So far I've just done it by hand by copying four spaces to the clipboard and then mashing keys really fast: ?, Home, Ctrl+V (repeat) What is the quickest way to accomplish this? Copying and pasting to another program? (Which?) A Firefox or Chrome browser extension? A command to directly modify the clipboard contents? An auto-typing program?

    Read the article

  • Migrating SQL Server Databases – The DBA’s Checklist (Part 2)

    - by Sadequl Hussain
    Continuing from Part 1  , our Migration Checklist continues: Step 5: Update statistics It is always a good idea to update the statistics of the database that you have just installed or migrated. To do this, run the following command against the target database: sp_updatestats The sp_updatestats system stored procedure runs the UPDATE STATISTICS command against every user and system table in the database.  However, a word of caution: running the sp_updatestats against a database with a compatibility level below 90 (SQL Server 2005) will reset the automatic UPDATE STATISTICS settings for every index and statistics of every table in the database. You may therefore want to change the compatibility mode before you run the command. Another thing you should remember to do is to ensure the new database has its AUTO_CREATE_STATISTICS and AUTO_UPDATE_STATISTICS properties set to ON. You can do so using the ALTER DATABASE command or from the SSMS. Step 6: Set database options You may have to change the state of a database after it has been restored. If the database was changed to single-user or read-only mode before backup, the restored copy will also retain these settings. This may not be an issue when you are manually restoring from Enterprise Manager or the Management Studio since you can change the properties. However, this is something to be mindful of if the restore process is invoked by an automated job or script and the database needs to be written to immediately after restore. You may want to check the database’s status programmatically in such cases. Another important option you may want to set for the newly restored / attached database is PAGE_VERIFY. This option specifies how you want SQL Server to ensure the physical integrity of the data. It is a new option from SQL Server 2005 and can have three values: CHECKSUM (default for SQL Server 2005 and latter databases), TORN_PAGE_DETECTION (default when restoring a pre-SQL Server 2005 database) or NONE. Torn page detection was itself an option for SQL Server 2000 databases. From SQL Server 2005, when PAGE_VERIFY is set to CHECKSUM, the database engine calculates the checksum for a page’s contents and writes it to the page header before storing it in disk. When the page is read from the disk, the checksum is computed again and compared with the checksum stored in the header.  Torn page detection works much like the same way in that it stores a bit in the page header for every 512 byte sector. When data is read from the page, the torn page bits stored in the header is compared with the respective sector contents. When PAGE_VERIFY is set to NONE, SQL Server does not perform any checking, even if torn page data or checksums are present in the page header.  This may not be something you would want to set unless there is a very specific reason.  Microsoft suggests using the CHECKSUM page verify option as this offers more protection. Step 7: Map database users to logins A common database migration issue is related to user access. Windows and SQL Server native logins that existed in the source instance and had access to the database may not be present in the destination. Even if the logins exist in the destination, the mapping between the user accounts and the logins will not be automatic. You can use a special system stored procedure called sp_change_users_login to address these situations. The procedure needs to be run against the newly attached or restored database and can accept four parameters. Depending on what you want to do, you may be using less than four though. The first parameter, @Action, can take three values. When you specify @Action = ‘Report’, the system will provide you with a list of database users which are not mapped to any login. If you want to map a database user to an existing SQL Server login, the value for @Action will be ‘Update_One’. In this case, you will only need to provide the database user name and the login it will map to. So if your newly restored database has a user account called “bob” and there is already a SQL Server login with the same name and you want to map the user to the login, you will execute a query like the following: sp_change_users_login         @Action = ‘Update_One’,         @UserNamePattern = ‘bob’,         @LoginName = ‘bob’ If the login does not exist, you can instruct SQL Server to create the login with the same name. In this case you will need to provide a password for the login and the value of the @Action parameter will be ‘Auto_Fix’. If the login already exists, it will be automatically mapped to the user account. Unfortunately sp_change_users_login system stored procedure cannot be used to map database users to trusted logins (Windows accounts) in SQL Server. You will need to follow a manual process to re-map the database user accounts.  Continues…

    Read the article

  • SEO techniques for a complete Flex Website

    - by Bobby Francis Joseph
    I am planning to build a website completely in Flex. All the contents will be static. No DB will be used. Unfortunately I am not building the website for PUMA or NIKE and so SEO is important. There is an overwhelming and confusing information out there about Flex and SEO. The following is a piece of information I found on the web " FLEX( Flash ) uses XML as a primary source of content, and XHTML is just a custom XML. The idea is to to use the HTML pages as XML content for the FLEX( Flash ) application. The XML can be read and indexed by the search engines, and it’s also the ideal content source for your FLEX( Flash ) application.' It goes on to explain how this can be done. Is this really that simple. " Could someone give some credible links. SEO is important for me since I am planning to build the site for a resort.

    Read the article

< Previous Page | 65 66 67 68 69 70 71 72 73 74 75 76  | Next Page >