Search Results

Search found 70172 results on 2807 pages for 'archive file'.

Page 699/2807 | < Previous Page | 695 696 697 698 699 700 701 702 703 704 705 706  | Next Page >

  • Backing up my data causes my server to crash using Symantec Backup Exec 12, or How I Came to Loathe Irony

    - by Kyle Noland
    I have a Dell PowerEdge 2850 running Windows Server 2003. It is the primary file server for one of my clients. I have another server also running Windows Server 2003 that acts as the core media server for Symantec Backup Exec 12. I recently upgraded from Backup Exec 11d to 12. This upgrade was necessary because we also just upgraded from Exchange 2003 to Exchange 2007. After the upgrade I had to push-install the new version 12 Backup Exec Remote Agents to each of the servers I am backing up (about 6 total). 5 of my servers are doing just fine, faithfully completing backups every night. My file server routinely crashes. Observations: When the server crashes, it does not blue screen, it just locks up completely. Even the mouse is unresponsive. If you leave the server locked up long enough, it will eventually reboot itself and hang on the Windows splash screen. There is absolutely zero useful Event Viewer evidence of a problem. The logs go from routine logging to an Unexplained Shutdown Event the next morning when I have to hard reset the server to get it to boot. 90% of the time the server does not boot cleanly, it hangs on the Windows splash screen. I don't have any light to shed here. When the server hangs all I can do is hard reset it and try again. Even after a successful boot and chkdsk /r operation, if you reboot the machine, you have a 90% chance it won't back up again cleanly. The back story: This server started crashing during nightly backups about a month ago. I tried everything I could think of to troubleshoot the problem and eventually had to give up because I could not keep coming to the office at 4 AM to try to get the server back online. One Friday I got lucky and the server stayed up for its entire full backup. I took this opportunity to restore the full backup to a temporary server I set up and switched all my users to the temporary. Then I reloaded the ailing file server. I kept all my users on the temporary file server for about 3 weeks. I installed the same Backup Exec Remote Agent and Trend Micro A/V client on the temporary server that I was using on the regular file server. During this time, I had absolutely no problems backing up the temporary server. I tested the reloaded file server extensively. I rebooted the server once an hour every day for 3 weeks trying to make it fail. It never did. I felt confident that the reload was the answer to my problems. I moved all of the data from the temporary server back to the regular server. I got 3 nightly backups out of it before it locked up again and started the familiar failure to boot cleanly behavior. This weekend I decided to monitor the file server through the entire backup job. I RDPd into the file server and also into the server running Backup Exec. On the file server I opened the Task Manager so I could view the processes and watch CPU and memory usage. Everything was running smoothly for about 60GB worth of backup. Then I noticed that the byte count of the backup job in Backup Exec had stopped progressing. I looked back over at my RDP session into the file server, and I was getting real time updates about CPU and memory usage still - both nearly 0%, which is unusual. Backups usually hover around 40% usage for the duration of the backup job. Let me reiterate this point: The screen was refreshing and I was getting real time Task Manager updates - until I clicked on the Start menu. The screen went black and the server locked up. In truth, I think the server had already locked up, the video card just hadn't figured it out yet. I went back into my bag of trick: driving to the office and hard reseting the server over and over again when it hangs up at the Windows splash screen. I did this for 2 hours without getting a successful boot. I started panicking because I did not have a decent backup to use to get everything back onto the working temporary file server. Once I exhausted everything I knew to do, I took a deep breath, booted to the Windows Server 2003 CD and performed a repair installation of Windows. The server came back up fine, with all of my data intact. I can now reboot the server at will and it will come back up cleanly. The problem is that I'm afraid as soon as I try to back that data up again I will back at square one. So let me sum things up: Here is what I've done so far to troubleshoot this server: Deleted and recreated the RAID 5 sets. Initialized the drives. Reloaded the server with a fresh Server 2003 install. Confirmed with Dell that I have installed the latest, Dell approved BIOS and NIC drivers. Uninstalled / reinstalled the Backup Exec Remote Agent. Uninstalled the Trend Micro A/V client. Configured the server not to reboot itself after a blue screen so I can see any stop error. I used to think the server was blue screening, but since I enabled this setting I now know that the server just completely locks up. Run chkdsk /r from the Windows Recovery Console. Several errors were found and corrected, but did not help my problem. Help confirm or deny the following assumptions: There are two problems at work here. Why the server is locking up in the first place, and why the server won't boot cleanly after a lockup. This is ultimately a software problem. The server works fine and can be rebooted cleanly all day long - until the first lockup - following a fresh OS load or even a Repair installation. This is not a problem with Backup Exec in general. All of my other servers back up just fine. For the record, all of the other servers run Server 2003, and some of them house more data than the file server in question here. Any help is appreciated. The irony is almost too much to bear. Backing up my data is what is jeopardizing it.

    Read the article

  • puppet variables

    - by Joey Bagodonuts
    I am trying to use variables in my modules manifest.pp with little luck class mysoftware($version="dev-2011.02.04b") { File { links => follow } file { "/opt/mysoftware": ensure => directory } file { "/opt/mysoftware/share": source => "puppet://puppet/mysoftware/air/$version", recurse => "true", } } This does not seem to be working when I assign this to a node via the nodes.pp file. I am running puppetmaster 2.6.4 puppetd clients are 0.25

    Read the article

  • DNS and name server in centos 6.3 64 bit is not pinged out side

    - by user135855
    I got a problem with centOS 6.3 64-bit. I want to setup my nameserver with bind here. I am listing all my configuration [root@izyon92 ~]# cat/etc/hosts -------------- 127.0.0.1 localhost localhost.localdomain localhost4 localhost4.localdomain4 ::1 localhost localhost.localdomain localhost6 localhost6.localdomain6 182.19.26.92 izyon92.zyonize1.com izyon92 [root@izyon92 ~]# cat /etc/sysconfig/network --------------------------------------------- NETWORKING=yes HOSTNAME=izyon92.zyonize1.com GATEWAY=182.19.26.89 [root@izyon92 ~]# cat /etc/resolv.conf -------------------------------------------- # Generated by NetworkManager search zyonize1.com nameserver 182.19.26.92 [root@izyon92 ~]# cat /etc/named.conf -------------------------------------------- // // named.conf // // Provided by Red Hat bind package to configure the ISC BIND named(8) DNS // server as a caching only nameserver (as a localhost DNS resolver only). // // See /usr/share/doc/bind*/sample/ for example named configuration files. // options { #listen-on port 53 { 127.0.0.1; }; listen-on-v6 port 53 { none; }; directory "/var/named"; dump-file "/var/named/data/cache_dump.db"; statistics-file "/var/named/data/named_stats.txt"; memstatistics-file "/var/named/data/named_mem_stats.txt"; allow-query { 182.19.26.92; }; recursion yes; dnssec-enable yes; dnssec-validation yes; dnssec-lookaside auto; /* Path to ISC DLV key */ bindkeys-file "/etc/named.iscdlv.key"; managed-keys-directory "/var/named/dynamic"; }; logging { channel default_debug { file "data/named.run"; severity dynamic; }; }; zone "." IN { type hint; file "named.ca"; }; include "/etc/named.rfc1912.zones"; include "/etc/named.root.key"; [root@izyon92 ~]# cat /etc/named.rfc1912.zones -------------------------------------------------- // named.rfc1912.zones: // // Provided by Red Hat caching-nameserver package // // ISC BIND named zone configuration for zones recommended by // RFC 1912 section 4.1 : localhost TLDs and address zones // and http://www.ietf.org/internet-drafts/draft-ietf-dnsop-default-local-zones-02.txt // (c)2007 R W Franks // // See /usr/share/doc/bind*/sample/ for example named configuration files. // zone "localhost.localdomain" IN { type master; file "named.localhost"; allow-update { none; }; }; zone "localhost" IN { type master; file "named.localhost"; allow-update { none; }; }; zone "1.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.0.ip6.arpa" IN { type master; file "named.loopback"; allow-update { none; }; }; zone "1.0.0.127.in-addr.arpa" IN { type master; file "named.loopback"; allow-update { none; }; }; zone "0.in-addr.arpa" IN { type master; file "named.empty"; allow-update { none; }; }; zone "zyonize1.com" { type master; file "/var/named/zyonize.com.hosts"; }; [root@izyon92 ~]# cat /var/named/zyonize.com.hosts --------------------------------------------------------- $ttl 38400 zyonize1.com. IN SOA 182.19.26.92. dev\.izyon.gmail.com. ( 1347436958 10800 3600 604800 38400 ) zyonize1.com. IN NS 182.19.26.92. zyonize1.com. IN A 182.19.26.92 www.zyonize1.com. IN A 182.19.26.92 izyon92.zyonize1.com. IN A 182.19.26.92 I have disabled selinux and stopped iptables. dig and nslookup is working fine in the same machine [root@izyon92 ~]# dig zyonize1.com ---------------------------------------- ; <<>> DiG 9.8.2rc1-RedHat-9.8.2-0.10.rc1.el6_3.2 <<>> zyonize1.com ;; global options: +cmd ;; Got answer: ;; ->>HEADER<<- opcode: QUERY, status: NOERROR, id: 55751 ;; flags: qr aa rd ra; QUERY: 1, ANSWER: 1, AUTHORITY: 1, ADDITIONAL: 0 ;; QUESTION SECTION: ;zyonize1.com. IN A ;; ANSWER SECTION: zyonize1.com. 38400 IN A 182.19.26.92 ;; AUTHORITY SECTION: zyonize1.com. 38400 IN NS 182.19.26.92. ;; Query time: 0 msec ;; SERVER: 182.19.26.92#53(182.19.26.92) ;; WHEN: Fri Sep 14 00:09:19 2012 ;; MSG SIZE rcvd: 72 [root@izyon92 ~]# nslookup zyonize1.com ---------------------------------------------- Server: 182.19.26.92 Address: 182.19.26.92#53 Name: zyonize1.com Address: 182.19.26.92 But here is the problem I am facing, I have windows machine, to test this dns and nameserver I set the first IPv4 DNS server to 182.19.26.92. Here is the details Connection-specific DNS Suffix: Description: Realtek PCIe GBE Family Controller Physical Address: ?14-FE-B5-9F-3A-A8 DHCP Enabled: No IPv4 Address: 192.168.2.50 IPv4 Subnet Mask: 255.255.255.0 IPv4 Default Gateway: 192.168.2.1 IPv4 DNS Servers: 182.19.26.92, 182.19.95.66 IPv4 WINS Server: NetBIOS over Tcpip Enabled: Yes Link-local IPv6 Address: fe80::45cc:2ada:c13:ca42%16 IPv6 Default Gateway: IPv6 DNS Server: when I am pining from this machine it is not finding the server. Where as in another server with another live IP with Fedora ping is working fine.

    Read the article

  • Preventing Thunderbird to add .txt to attachments on open.

    - by Horcrux7
    How can I prevent Thunderbird to add the extension .txt to a file when open the attachment. I have the problem with .patch files which I want look with notepad++. The problem is that notepad++ does not detect the right formating for the file because the extension is .txt. If I drag the file on the desktop an double click all is working. Why change Thunderbird the file name on opening? I am working on Windows 7.

    Read the article

  • Notepad Merge 2 lines into 1 line

    - by Kalman Mettler
    Sorry for my rough English, I try to visualize my question. I have two lists of words, one per line, each list in a separate file: File 1: white fehér green zöld red piros File 2: white blanco green verde red roja I need to combine these lists, removing any duplicates and create a new file containing the following: fehér blanco zöld verde piros roja I am a newbie with Notepad++ and can't work out this problem.

    Read the article

  • Why Photoshop CS5's photomerge's result immediately disappear?

    - by koiyu
    I have a bunch of JPG-files which I want to stitch together with Photoshop's Photomerge function. I choose File → Automate → Photomerge... and browse for the files. Photoshop opens the files and starts analyzing. I see the process bar filling and different phases are mentioned on the process bar. Nothing weird there. When the merging is done (and if I don't blink my eyes), I can see layers-palette is populated with the chosen files and, by quickly judging from the layer thumbnails, they're properly aligned. Sometimes the image window itself can be seen, but not always. Problem is that the layers and the image disappear in a flash. There is no error message. Everything is like prior starting the photomerge. No file has been changed. I could continue to use Photoshop normally. This is what I've tried so far: Loaded folder which has 38 JPG images, 4272 x 2848 and ˜ 5 megabytes per file Loaded the same files, but chose Use Files instead of Use Folder in the photomerge's window Loaded 19 JPG images, 4272 x 2848 and ˜ 5 megabytes per file Loaded 10 JPG images, ⇑ see above Loaded 5 JPG images, see above Loaded 3 JPG images, see above Scaled the images to 2256 x 1504 and ˜< 1 megabytes per file Loaded in a set of 38, 19, 10, 5, 3 Following steps are tested with these smaller files and with a set of 5 images Read Adobe's forums and reduced the amount of RAM Photoshop uses gradually from ˜ 80 % to 50 % (though I didn't understand the logic behind this) Would've reduced cache tile size to 128K, but it was set so already Disabled OpenGL Scaled the images to 800 x 533 and ˜ 100 kilobytes per file, loaded a set of 5 Read more unanswered threads around the internet In between each test I closed and reopened Photoshop. This is the first time I've even tried using photomerge. Am I doing something wrong? How can I locate what is the problem? How do I fix this? Photoshop is 64 bit Extended CS5 version. I'm on a mid-2010 quad-core (i5) iMac with up-to-date Mac OS X 10.6.6. Edit: Weird. First loading the images into one file via File → Scripts → Load Files into Stack… and then using Edit → Auto-Align Layers…, which, effectively, is the same as photomerge (even the dialog looks kind of the same), works! Even with the original JPGs without any issues. This doesn't fix photomerge, though.

    Read the article

  • putting folders above public_html in a shared hosting environment

    - by redconservatory
    On my local environment, the following settings work in my index.php file: $system_path = '../../ci/system/'; $application_folder = '../../ci/application'; My folder structure looks like this: -ci ---system ---application -public_html ---site ----index.php This works on my local environment, but when I upload my files, I get an error message: Your system folder path does not appear to be set correctly. Please open the following file and correct this: index.php I tried the following: $system_path = dirname(__FILE__).'../../ci/system/'; $application_folder = dirname(__FILE__).'../../ci/application';

    Read the article

  • Is there a way to refresh Notepad?

    - by chama
    I'm not sure if this is the correct place to ask this, but I checked on google and wasn't able to find out for sure. Say, for example, that there's one process that's writing to a file. While the process is running, I opened the file in notepad. The process keeps writing to the file. Other than closing and reopening the file, is there any way for me to "refresh" the data that notepad is showing? TIA!

    Read the article

  • Preventing Thunderbird to add .txt to attachments on open

    - by Horcrux7
    How can I prevent Thunderbird to add the extension .txt to a file when open the attachment. I have the problem with .patch files which I want look with notepad++. The problem is that notepad++ does not detect the right formating for the file because the extension is .txt. If I drag the file on the desktop an double click all is working. Why change Thunderbird the file name on opening? I am working on Windows 7.

    Read the article

  • How does data I/O takes place on USB Flash Memory ?

    - by user35704
    I want to know how is data I/O takes place on flash drives which are typically EEPROM's . I thought so as I was writing a C Program that involves file handling . For a normal HDD , that would involve returning the file pointer and reading or writing data to the disk which would be done by read/write HEAD . While in EEPROM's there is no read/write head , as it's works on mnemonic commands , So how come does the C file handling program works when I apply it to a file on flash drive ?

    Read the article

  • power point show

    - by doug
    I've edited a pps file which was made with the 2003 version and saved also as compatible with Power Point 97-2003 but a friend a mine can't see the last version of the file. The original file can be seen by my computer friend. What can I do to make the new version of the pps file to be viewable on the computer of my friend? Any tips? Where/what else do I have to check/do ?

    Read the article

  • Linux missing disk space

    - by cpt.Buggy
    I have KVM vps with strange disk usage: # df -h Filesystem Size Used Avail Use% Mounted on /dev/sdb 493G 1.2G 466G 1% / tmpfs 4.0G 0 4.0G 0% /dev/shm /dev/sda1 96M 41M 51M 45% /boot # du -sh / du: cannot access `/proc/1633/task/1633/fd/4': No such file or directory du: cannot access `/proc/1633/task/1633/fdinfo/4': No such file or directory du: cannot access `/proc/1633/fd/4': No such file or directory du: cannot access `/proc/1633/fdinfo/4': No such file or directory 1021M / How could it be? Where are ~20G of free space?

    Read the article

  • Why does my Windows Explorer no longer refresh itself?

    - by Markus
    Normally when you do a file operation in Windows Explorer then Explorer refreshes itself. So I delete a file, and it's gone. But since yesterday when I for example delete a file, the file entry doesn't disappear. It only disappears when closing and reopening the folder, or when pressing F5. What could that be?

    Read the article

  • How can I retrieve statistics from my ghost cast server?

    - by Foxtrot
    I have a GhostCast server running for deploying images. I would like to have each ghost cast session to write to a file ( can be multiple text files or append to one file already there ) statistics. I know this is possible based on the options GhostCast software provides for writing to a log file, but I would like this automated for every image being backed up and restored. I don't want to have my employees click write to a new file every time. Is this possible?

    Read the article

  • Why Photoshop CS5's photomerge's result immediately disappear?

    - by koiyu
    I have a bunch of JPG-files which I want to stitch together with Photoshop's Photomerge function. I choose File → Automate → Photomerge... and browse for the files. Photoshop opens the files and starts analyzing. I see the process bar filling and different phases are mentioned on the process bar. Nothing weird there. When the merging is done (and if I don't blink my eyes), I can see layers-palette is populated with the chosen files and, by quickly judging from the layer thumbnails, they're properly aligned. Sometimes the image window itself can be seen, but not always. Problem is that the layers and the image disappear in a flash. There is no error message. Everything is like prior starting the photomerge. No file has been changed. I could continue to use Photoshop normally. This is what I've tried so far: Loaded folder which has 38 JPG images, 4272 x 2848 and ˜ 5 megabytes per file Loaded the same files, but chose Use Files instead of Use Folder in the photomerge's window Loaded 19 JPG images, 4272 x 2848 and ˜ 5 megabytes per file Loaded 10 JPG images, ⇑ see above Loaded 5 JPG images, see above Loaded 3 JPG images, see above Scaled the images to 2256 x 1504 and ˜< 1 megabytes per file Loaded in a set of 38, 19, 10, 5, 3 Following steps are tested with these smaller files and with a set of 5 images Read Adobe's forums and reduced the amount of RAM Photoshop uses gradually from ˜ 80 % to 50 % (though I didn't understand the logic behind this) Would've reduced cache tile size to 128K, but it was set so already Disabled OpenGL Scaled the images to 800 x 533 and ˜ 100 kilobytes per file, loaded a set of 5 Read more unanswered threads around the internet In between each test I closed and reopened Photoshop. This is the first time I've even tried using photomerge. Am I doing something wrong? How can I locate what is the problem? How do I fix this? Photoshop is 64 bit Extended CS5 version. I'm on a mid-2010 quad-core (i5) iMac with up-to-date Mac OS X 10.6.6. Edit: Weird. First loading the images into one file via File → Scripts → Load Files into Stack… and then using Edit → Auto-Align Layers…, which, effectively, is the same as photomerge (even the dialog looks kind of the same), works! Even with the original JPGs without any issues. This doesn't fix photomerge, though.

    Read the article

  • Convert Chinese character .wav song into .mp3 or .wma on English OS

    - by Jack
    I have bunch of Chinese .wav files on my hard disk that I'm trying to convert into .mp3 with Audacity but it appear that Audacity can not read Chinese character songs but the .wav file display correctly on my 32 bits Win7 Ultimate(English) pc. I have to rename these Chinese character songs into English file name in order to convert them. Does anyone know if there is any software (prefer open source) that will take Chinese character file name(.wav) and convert it into .mp3 without renaming the file?

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • Automatic picture size adjustment

    - by CChriss
    Does anyone know of a free utility that allows you to paste into it a graphics file (any type would work for me, jpg, bmp, png, etc) and it will size the file to within a preset size boundary? For instance, if I preset it to resize files to be a maximum of 400 wide by 300 tall, and I paste in a file 500x500, it would shrink the file to fit within the 300 tall limit. Thanks.

    Read the article

  • How can I unzip a .tar.gz in one step (using 7-Zip)?

    - by quickcel
    I am using 7-Zip on Windows XP and whenever I download a .tar.gz file it takes me two steps to completely extract the file(s). I right-click on the example.tar.gz file and choose 7-Zip -- Extract Here from the context menu. I then take the resulting example.tar file and the right-click again and choose 7-Zip -- Extract Here from the context menu. Is there a way through the context menu to do this in one step?

    Read the article

  • 256 Windows Azure Worker Roles, Windows Kinect and a 90's Text-Based Ray-Tracer

    - by Alan Smith
    For a couple of years I have been demoing a simple render farm hosted in Windows Azure using worker roles and the Azure Storage service. At the start of the presentation I deploy an Azure application that uses 16 worker roles to render a 1,500 frame 3D ray-traced animation. At the end of the presentation, when the animation was complete, I would play the animation delete the Azure deployment. The standing joke with the audience was that it was that it was a “$2 demo”, as the compute charges for running the 16 instances for an hour was $1.92, factor in the bandwidth charges and it’s a couple of dollars. The point of the demo is that it highlights one of the great benefits of cloud computing, you pay for what you use, and if you need massive compute power for a short period of time using Windows Azure can work out very cost effective. The “$2 demo” was great for presenting at user groups and conferences in that it could be deployed to Azure, used to render an animation, and then removed in a one hour session. I have always had the idea of doing something a bit more impressive with the demo, and scaling it from a “$2 demo” to a “$30 demo”. The challenge was to create a visually appealing animation in high definition format and keep the demo time down to one hour.  This article will take a run through how I achieved this. Ray Tracing Ray tracing, a technique for generating high quality photorealistic images, gained popularity in the 90’s with companies like Pixar creating feature length computer animations, and also the emergence of shareware text-based ray tracers that could run on a home PC. In order to render a ray traced image, the ray of light that would pass from the view point must be tracked until it intersects with an object. At the intersection, the color, reflectiveness, transparency, and refractive index of the object are used to calculate if the ray will be reflected or refracted. Each pixel may require thousands of calculations to determine what color it will be in the rendered image. Pin-Board Toys Having very little artistic talent and a basic understanding of maths I decided to focus on an animation that could be modeled fairly easily and would look visually impressive. I’ve always liked the pin-board desktop toys that become popular in the 80’s and when I was working as a 3D animator back in the 90’s I always had the idea of creating a 3D ray-traced animation of a pin-board, but never found the energy to do it. Even if I had a go at it, the render time to produce an animation that would look respectable on a 486 would have been measured in months. PolyRay Back in 1995 I landed my first real job, after spending three years being a beach-ski-climbing-paragliding-bum, and was employed to create 3D ray-traced animations for a CD-ROM that school kids would use to learn physics. I had got into the strange and wonderful world of text-based ray tracing, and was using a shareware ray-tracer called PolyRay. PolyRay takes a text file describing a scene as input and, after a few hours processing on a 486, produced a high quality ray-traced image. The following is an example of a basic PolyRay scene file. background Midnight_Blue   static define matte surface { ambient 0.1 diffuse 0.7 } define matte_white texture { matte { color white } } define matte_black texture { matte { color dark_slate_gray } } define position_cylindrical 3 define lookup_sawtooth 1 define light_wood <0.6, 0.24, 0.1> define median_wood <0.3, 0.12, 0.03> define dark_wood <0.05, 0.01, 0.005>     define wooden texture { noise surface { ambient 0.2  diffuse 0.7  specular white, 0.5 microfacet Reitz 10 position_fn position_cylindrical position_scale 1  lookup_fn lookup_sawtooth octaves 1 turbulence 1 color_map( [0.0, 0.2, light_wood, light_wood] [0.2, 0.3, light_wood, median_wood] [0.3, 0.4, median_wood, light_wood] [0.4, 0.7, light_wood, light_wood] [0.7, 0.8, light_wood, median_wood] [0.8, 0.9, median_wood, light_wood] [0.9, 1.0, light_wood, dark_wood]) } } define glass texture { surface { ambient 0 diffuse 0 specular 0.2 reflection white, 0.1 transmission white, 1, 1.5 }} define shiny surface { ambient 0.1 diffuse 0.6 specular white, 0.6 microfacet Phong 7  } define steely_blue texture { shiny { color black } } define chrome texture { surface { color white ambient 0.0 diffuse 0.2 specular 0.4 microfacet Phong 10 reflection 0.8 } }   viewpoint {     from <4.000, -1.000, 1.000> at <0.000, 0.000, 0.000> up <0, 1, 0> angle 60     resolution 640, 480 aspect 1.6 image_format 0 }       light <-10, 30, 20> light <-10, 30, -20>   object { disc <0, -2, 0>, <0, 1, 0>, 30 wooden }   object { sphere <0.000, 0.000, 0.000>, 1.00 chrome } object { cylinder <0.000, 0.000, 0.000>, <0.000, 0.000, -4.000>, 0.50 chrome }   After setting up the background and defining colors and textures, the viewpoint is specified. The “camera” is located at a point in 3D space, and it looks towards another point. The angle, image resolution, and aspect ratio are specified. Two lights are present in the image at defined coordinates. The three objects in the image are a wooden disc to represent a table top, and a sphere and cylinder that intersect to form a pin that will be used for the pin board toy in the final animation. When the image is rendered, the following image is produced. The pins are modeled with a chrome surface, so they reflect the environment around them. Note that the scale of the pin shaft is not correct, this will be fixed later. Modeling the Pin Board The frame of the pin-board is made up of three boxes, and six cylinders, the front box is modeled using a clear, slightly reflective solid, with the same refractive index of glass. The other shapes are modeled as metal. object { box <-5.5, -1.5, 1>, <5.5, 5.5, 1.2> glass } object { box <-5.5, -1.5, -0.04>, <5.5, 5.5, -0.09> steely_blue } object { box <-5.5, -1.5, -0.52>, <5.5, 5.5, -0.59> steely_blue } object { cylinder <-5.2, -1.2, 1.4>, <-5.2, -1.2, -0.74>, 0.2 steely_blue } object { cylinder <5.2, -1.2, 1.4>, <5.2, -1.2, -0.74>, 0.2 steely_blue } object { cylinder <-5.2, 5.2, 1.4>, <-5.2, 5.2, -0.74>, 0.2 steely_blue } object { cylinder <5.2, 5.2, 1.4>, <5.2, 5.2, -0.74>, 0.2 steely_blue } object { cylinder <0, -1.2, 1.4>, <0, -1.2, -0.74>, 0.2 steely_blue } object { cylinder <0, 5.2, 1.4>, <0, 5.2, -0.74>, 0.2 steely_blue }   In order to create the matrix of pins that make up the pin board I used a basic console application with a few nested loops to create two intersecting matrixes of pins, which models the layout used in the pin boards. The resulting image is shown below. The pin board contains 11,481 pins, with the scene file containing 23,709 lines of code. For the complete animation 2,000 scene files will be created, which is over 47 million lines of code. Each pin in the pin-board will slide out a specific distance when an object is pressed into the back of the board. This is easily modeled by setting the Z coordinate of the pin to a specific value. In order to set all of the pins in the pin-board to the correct position, a bitmap image can be used. The position of the pin can be set based on the color of the pixel at the appropriate position in the image. When the Windows Azure logo is used to set the Z coordinate of the pins, the following image is generated. The challenge now was to make a cool animation. The Azure Logo is fine, but it is static. Using a normal video to animate the pins would not work; the colors in the video would not be the same as the depth of the objects from the camera. In order to simulate the pin board accurately a series of frames from a depth camera could be used. Windows Kinect The Kenect controllers for the X-Box 360 and Windows feature a depth camera. The Kinect SDK for Windows provides a programming interface for Kenect, providing easy access for .NET developers to the Kinect sensors. The Kinect Explorer provided with the Kinect SDK is a great starting point for exploring Kinect from a developers perspective. Both the X-Box 360 Kinect and the Windows Kinect will work with the Kinect SDK, the Windows Kinect is required for commercial applications, but the X-Box Kinect can be used for hobby projects. The Windows Kinect has the advantage of providing a mode to allow depth capture with objects closer to the camera, which makes for a more accurate depth image for setting the pin positions. Creating a Depth Field Animation The depth field animation used to set the positions of the pin in the pin board was created using a modified version of the Kinect Explorer sample application. In order to simulate the pin board accurately, a small section of the depth range from the depth sensor will be used. Any part of the object in front of the depth range will result in a white pixel; anything behind the depth range will be black. Within the depth range the pixels in the image will be set to RGB values from 0,0,0 to 255,255,255. A screen shot of the modified Kinect Explorer application is shown below. The Kinect Explorer sample application was modified to include slider controls that are used to set the depth range that forms the image from the depth stream. This allows the fine tuning of the depth image that is required for simulating the position of the pins in the pin board. The Kinect Explorer was also modified to record a series of images from the depth camera and save them as a sequence JPEG files that will be used to animate the pins in the animation the Start and Stop buttons are used to start and stop the image recording. En example of one of the depth images is shown below. Once a series of 2,000 depth images has been captured, the task of creating the animation can begin. Rendering a Test Frame In order to test the creation of frames and get an approximation of the time required to render each frame a test frame was rendered on-premise using PolyRay. The output of the rendering process is shown below. The test frame contained 23,629 primitive shapes, most of which are the spheres and cylinders that are used for the 11,800 or so pins in the pin board. The 1280x720 image contains 921,600 pixels, but as anti-aliasing was used the number of rays that were calculated was 4,235,777, with 3,478,754,073 object boundaries checked. The test frame of the pin board with the depth field image applied is shown below. The tracing time for the test frame was 4 minutes 27 seconds, which means rendering the2,000 frames in the animation would take over 148 hours, or a little over 6 days. Although this is much faster that an old 486, waiting almost a week to see the results of an animation would make it challenging for animators to create, view, and refine their animations. It would be much better if the animation could be rendered in less than one hour. Windows Azure Worker Roles The cost of creating an on-premise render farm to render animations increases in proportion to the number of servers. The table below shows the cost of servers for creating a render farm, assuming a cost of $500 per server. Number of Servers Cost 1 $500 16 $8,000 256 $128,000   As well as the cost of the servers, there would be additional costs for networking, racks etc. Hosting an environment of 256 servers on-premise would require a server room with cooling, and some pretty hefty power cabling. The Windows Azure compute services provide worker roles, which are ideal for performing processor intensive compute tasks. With the scalability available in Windows Azure a job that takes 256 hours to complete could be perfumed using different numbers of worker roles. The time and cost of using 1, 16 or 256 worker roles is shown below. Number of Worker Roles Render Time Cost 1 256 hours $30.72 16 16 hours $30.72 256 1 hour $30.72   Using worker roles in Windows Azure provides the same cost for the 256 hour job, irrespective of the number of worker roles used. Provided the compute task can be broken down into many small units, and the worker role compute power can be used effectively, it makes sense to scale the application so that the task is completed quickly, making the results available in a timely fashion. The task of rendering 2,000 frames in an animation is one that can easily be broken down into 2,000 individual pieces, which can be performed by a number of worker roles. Creating a Render Farm in Windows Azure The architecture of the render farm is shown in the following diagram. The render farm is a hybrid application with the following components: ·         On-Premise o   Windows Kinect – Used combined with the Kinect Explorer to create a stream of depth images. o   Animation Creator – This application uses the depth images from the Kinect sensor to create scene description files for PolyRay. These files are then uploaded to the jobs blob container, and job messages added to the jobs queue. o   Process Monitor – This application queries the role instance lifecycle table and displays statistics about the render farm environment and render process. o   Image Downloader – This application polls the image queue and downloads the rendered animation files once they are complete. ·         Windows Azure o   Azure Storage – Queues and blobs are used for the scene description files and completed frames. A table is used to store the statistics about the rendering environment.   The architecture of each worker role is shown below.   The worker role is configured to use local storage, which provides file storage on the worker role instance that can be use by the applications to render the image and transform the format of the image. The service definition for the worker role with the local storage configuration highlighted is shown below. <?xml version="1.0" encoding="utf-8"?> <ServiceDefinition name="CloudRay" >   <WorkerRole name="CloudRayWorkerRole" vmsize="Small">     <Imports>     </Imports>     <ConfigurationSettings>       <Setting name="DataConnectionString" />     </ConfigurationSettings>     <LocalResources>       <LocalStorage name="RayFolder" cleanOnRoleRecycle="true" />     </LocalResources>   </WorkerRole> </ServiceDefinition>     The two executable programs, PolyRay.exe and DTA.exe are included in the Azure project, with Copy Always set as the property. PolyRay will take the scene description file and render it to a Truevision TGA file. As the TGA format has not seen much use since the mid 90’s it is converted to a JPG image using Dave's Targa Animator, another shareware application from the 90’s. Each worker roll will use the following process to render the animation frames. 1.       The worker process polls the job queue, if a job is available the scene description file is downloaded from blob storage to local storage. 2.       PolyRay.exe is started in a process with the appropriate command line arguments to render the image as a TGA file. 3.       DTA.exe is started in a process with the appropriate command line arguments convert the TGA file to a JPG file. 4.       The JPG file is uploaded from local storage to the images blob container. 5.       A message is placed on the images queue to indicate a new image is available for download. 6.       The job message is deleted from the job queue. 7.       The role instance lifecycle table is updated with statistics on the number of frames rendered by the worker role instance, and the CPU time used. The code for this is shown below. public override void Run() {     // Set environment variables     string polyRayPath = Path.Combine(Environment.GetEnvironmentVariable("RoleRoot"), PolyRayLocation);     string dtaPath = Path.Combine(Environment.GetEnvironmentVariable("RoleRoot"), DTALocation);       LocalResource rayStorage = RoleEnvironment.GetLocalResource("RayFolder");     string localStorageRootPath = rayStorage.RootPath;       JobQueue jobQueue = new JobQueue("renderjobs");     JobQueue downloadQueue = new JobQueue("renderimagedownloadjobs");     CloudRayBlob sceneBlob = new CloudRayBlob("scenes");     CloudRayBlob imageBlob = new CloudRayBlob("images");     RoleLifecycleDataSource roleLifecycleDataSource = new RoleLifecycleDataSource();       Frames = 0;       while (true)     {         // Get the render job from the queue         CloudQueueMessage jobMsg = jobQueue.Get();           if (jobMsg != null)         {             // Get the file details             string sceneFile = jobMsg.AsString;             string tgaFile = sceneFile.Replace(".pi", ".tga");             string jpgFile = sceneFile.Replace(".pi", ".jpg");               string sceneFilePath = Path.Combine(localStorageRootPath, sceneFile);             string tgaFilePath = Path.Combine(localStorageRootPath, tgaFile);             string jpgFilePath = Path.Combine(localStorageRootPath, jpgFile);               // Copy the scene file to local storage             sceneBlob.DownloadFile(sceneFilePath);               // Run the ray tracer.             string polyrayArguments =                 string.Format("\"{0}\" -o \"{1}\" -a 2", sceneFilePath, tgaFilePath);             Process polyRayProcess = new Process();             polyRayProcess.StartInfo.FileName =                 Path.Combine(Environment.GetEnvironmentVariable("RoleRoot"), polyRayPath);             polyRayProcess.StartInfo.Arguments = polyrayArguments;             polyRayProcess.Start();             polyRayProcess.WaitForExit();               // Convert the image             string dtaArguments =                 string.Format(" {0} /FJ /P{1}", tgaFilePath, Path.GetDirectoryName (jpgFilePath));             Process dtaProcess = new Process();             dtaProcess.StartInfo.FileName =                 Path.Combine(Environment.GetEnvironmentVariable("RoleRoot"), dtaPath);             dtaProcess.StartInfo.Arguments = dtaArguments;             dtaProcess.Start();             dtaProcess.WaitForExit();               // Upload the image to blob storage             imageBlob.UploadFile(jpgFilePath);               // Add a download job.             downloadQueue.Add(jpgFile);               // Delete the render job message             jobQueue.Delete(jobMsg);               Frames++;         }         else         {             Thread.Sleep(1000);         }           // Log the worker role activity.         roleLifecycleDataSource.Alive             ("CloudRayWorker", RoleLifecycleDataSource.RoleLifecycleId, Frames);     } }     Monitoring Worker Role Instance Lifecycle In order to get more accurate statistics about the lifecycle of the worker role instances used to render the animation data was tracked in an Azure storage table. The following class was used to track the worker role lifecycles in Azure storage.   public class RoleLifecycle : TableServiceEntity {     public string ServerName { get; set; }     public string Status { get; set; }     public DateTime StartTime { get; set; }     public DateTime EndTime { get; set; }     public long SecondsRunning { get; set; }     public DateTime LastActiveTime { get; set; }     public int Frames { get; set; }     public string Comment { get; set; }       public RoleLifecycle()     {     }       public RoleLifecycle(string roleName)     {         PartitionKey = roleName;         RowKey = Utils.GetAscendingRowKey();         Status = "Started";         StartTime = DateTime.UtcNow;         LastActiveTime = StartTime;         EndTime = StartTime;         SecondsRunning = 0;         Frames = 0;     } }     A new instance of this class is created and added to the storage table when the role starts. It is then updated each time the worker renders a frame to record the total number of frames rendered and the total processing time. These statistics are used be the monitoring application to determine the effectiveness of use of resources in the render farm. Rendering the Animation The Azure solution was deployed to Windows Azure with the service configuration set to 16 worker role instances. This allows for the application to be tested in the cloud environment, and the performance of the application determined. When I demo the application at conferences and user groups I often start with 16 instances, and then scale up the application to the full 256 instances. The configuration to run 16 instances is shown below. <?xml version="1.0" encoding="utf-8"?> <ServiceConfiguration serviceName="CloudRay" xmlns="http://schemas.microsoft.com/ServiceHosting/2008/10/ServiceConfiguration" osFamily="1" osVersion="*">   <Role name="CloudRayWorkerRole">     <Instances count="16" />     <ConfigurationSettings>       <Setting name="DataConnectionString"         value="DefaultEndpointsProtocol=https;AccountName=cloudraydata;AccountKey=..." />     </ConfigurationSettings>   </Role> </ServiceConfiguration>     About six minutes after deploying the application the first worker roles become active and start to render the first frames of the animation. The CloudRay Monitor application displays an icon for each worker role instance, with a number indicating the number of frames that the worker role has rendered. The statistics on the left show the number of active worker roles and statistics about the render process. The render time is the time since the first worker role became active; the CPU time is the total amount of processing time used by all worker role instances to render the frames.   Five minutes after the first worker role became active the last of the 16 worker roles activated. By this time the first seven worker roles had each rendered one frame of the animation.   With 16 worker roles u and running it can be seen that one hour and 45 minutes CPU time has been used to render 32 frames with a render time of just under 10 minutes.     At this rate it would take over 10 hours to render the 2,000 frames of the full animation. In order to complete the animation in under an hour more processing power will be required. Scaling the render farm from 16 instances to 256 instances is easy using the new management portal. The slider is set to 256 instances, and the configuration saved. We do not need to re-deploy the application, and the 16 instances that are up and running will not be affected. Alternatively, the configuration file for the Azure service could be modified to specify 256 instances.   <?xml version="1.0" encoding="utf-8"?> <ServiceConfiguration serviceName="CloudRay" xmlns="http://schemas.microsoft.com/ServiceHosting/2008/10/ServiceConfiguration" osFamily="1" osVersion="*">   <Role name="CloudRayWorkerRole">     <Instances count="256" />     <ConfigurationSettings>       <Setting name="DataConnectionString"         value="DefaultEndpointsProtocol=https;AccountName=cloudraydata;AccountKey=..." />     </ConfigurationSettings>   </Role> </ServiceConfiguration>     Six minutes after the new configuration has been applied 75 new worker roles have activated and are processing their first frames.   Five minutes later the full configuration of 256 worker roles is up and running. We can see that the average rate of frame rendering has increased from 3 to 12 frames per minute, and that over 17 hours of CPU time has been utilized in 23 minutes. In this test the time to provision 140 worker roles was about 11 minutes, which works out at about one every five seconds.   We are now half way through the rendering, with 1,000 frames complete. This has utilized just under three days of CPU time in a little over 35 minutes.   The animation is now complete, with 2,000 frames rendered in a little over 52 minutes. The CPU time used by the 256 worker roles is 6 days, 7 hours and 22 minutes with an average frame rate of 38 frames per minute. The rendering of the last 1,000 frames took 16 minutes 27 seconds, which works out at a rendering rate of 60 frames per minute. The frame counts in the server instances indicate that the use of a queue to distribute the workload has been very effective in distributing the load across the 256 worker role instances. The first 16 instances that were deployed first have rendered between 11 and 13 frames each, whilst the 240 instances that were added when the application was scaled have rendered between 6 and 9 frames each.   Completed Animation I’ve uploaded the completed animation to YouTube, a low resolution preview is shown below. Pin Board Animation Created using Windows Kinect and 256 Windows Azure Worker Roles   The animation can be viewed in 1280x720 resolution at the following link: http://www.youtube.com/watch?v=n5jy6bvSxWc Effective Use of Resources According to the CloudRay monitor statistics the animation took 6 days, 7 hours and 22 minutes CPU to render, this works out at 152 hours of compute time, rounded up to the nearest hour. As the usage for the worker role instances are billed for the full hour, it may have been possible to render the animation using fewer than 256 worker roles. When deciding the optimal usage of resources, the time required to provision and start the worker roles must also be considered. In the demo I started with 16 worker roles, and then scaled the application to 256 worker roles. It would have been more optimal to start the application with maybe 200 worker roles, and utilized the full hour that I was being billed for. This would, however, have prevented showing the ease of scalability of the application. The new management portal displays the CPU usage across the worker roles in the deployment. The average CPU usage across all instances is 93.27%, with over 99% used when all the instances are up and running. This shows that the worker role resources are being used very effectively. Grid Computing Scenarios Although I am using this scenario for a hobby project, there are many scenarios where a large amount of compute power is required for a short period of time. Windows Azure provides a great platform for developing these types of grid computing applications, and can work out very cost effective. ·         Windows Azure can provide massive compute power, on demand, in a matter of minutes. ·         The use of queues to manage the load balancing of jobs between role instances is a simple and effective solution. ·         Using a cloud-computing platform like Windows Azure allows proof-of-concept scenarios to be tested and evaluated on a very low budget. ·         No charges for inbound data transfer makes the uploading of large data sets to Windows Azure Storage services cost effective. (Transaction charges still apply.) Tips for using Windows Azure for Grid Computing Scenarios I found the implementation of a render farm using Windows Azure a fairly simple scenario to implement. I was impressed by ease of scalability that Azure provides, and by the short time that the application took to scale from 16 to 256 worker role instances. In this case it was around 13 minutes, in other tests it took between 10 and 20 minutes. The following tips may be useful when implementing a grid computing project in Windows Azure. ·         Using an Azure Storage queue to load-balance the units of work across multiple worker roles is simple and very effective. The design I have used in this scenario could easily scale to many thousands of worker role instances. ·         Windows Azure accounts are typically limited to 20 cores. If you need to use more than this, a call to support and a credit card check will be required. ·         Be aware of how the billing model works. You will be charged for worker role instances for the full clock our in which the instance is deployed. Schedule the workload to start just after the clock hour has started. ·         Monitor the utilization of the resources you are provisioning, ensure that you are not paying for worker roles that are idle. ·         If you are deploying third party applications to worker roles, you may well run into licensing issues. Purchasing software licenses on a per-processor basis when using hundreds of processors for a short time period would not be cost effective. ·         Third party software may also require installation onto the worker roles, which can be accomplished using start-up tasks. Bear in mind that adding a startup task and possible re-boot will add to the time required for the worker role instance to start and activate. An alternative may be to use a prepared VM and use VM roles. ·         Consider using the Windows Azure Autoscaling Application Block (WASABi) to autoscale the worker roles in your application. When using a large number of worker roles, the utilization must be carefully monitored, if the scaling algorithms are not optimal it could get very expensive!

    Read the article

  • pre-commit hook in svn: could not be translated from the native locale to UTF-8

    - by Alexandre Moraes
    Hi everybody, I have a problem with my pre-commit hook. This hook test if a file is locked when the user commits. When a bad condition happens, it should output that the another user is locking this file or if nobody is locking, it should show "you are not locking this file message (file´s name)". The error happens when the file´s name has some latin character like "ç" and tortoise show me this in the output. Commit failed (details follow): Commit blocked by pre-commit hook (exit code 1) with output: [Erro output could not be translated from the native locale to UTF-8.] Do you know how can I solve this? Thanks, Alexandre My shell script is here: #!/bin/sh REPOS="$1" TXN="$2" export LANG="en_US.UTF-8" /app/svn/hooks/ensure-has-need-lock.pl "$REPOS" "$TXN" if [ $? -ne 0 ]; then exit 1; fi exit 0 And my perl is here: !/usr/bin/env perl #Turn on warnings the best way depending on the Perl version. BEGIN { if ( $] >= 5.006_000) { require warnings; import warnings; } else { $^W = 1; } } use strict; use Carp; &usage unless @ARGV == 2; my $repos = shift; my $txn = shift; my $svnlook = "/usr/local/bin/svnlook"; my $user; my $ok = 1; foreach my $program ($svnlook) { if (-e $program) { unless (-x $program) { warn "$0: required program $program' is not executable, ", "edit $0.\n"; $ok = 0; } } else { warn "$0: required program $program' does not exist, edit $0.\n"; $ok = 0; } } exit 1 unless $ok; unless (-e $repos){ &usage("$0: repository directory $repos' does not exist."); } unless (-d $repos){ &usage("$0: repository directory $repos' is not a directory."); } foreach my $user_tmp (&read_from_process($svnlook, 'author', $repos, '-t', $txn)) { $user = $user_tmp; } my @errors; foreach my $transaction (&read_from_process($svnlook, 'changed', $repos, '-t', $txn)){ if ($transaction =~ /^U. (.*[^\/])$/){ my $file = $1; my $err = 0; foreach my $locks (&read_from_process($svnlook, 'lock', $repos, $file)){ $err = 1; if($locks=~ /Owner: (.*)/){ if($1 != $user){ push @errors, "$file : You are not locking this file!"; } } } if($err==0){ push @errors, "$file : You are not locking this file!"; } } elsif($transaction =~ /^D. (.*[^\/])$/){ my $file = $1; my $tchan = &read_from_process($svnlook, 'lock', $repos, $file); foreach my $locks (&read_from_process($svnlook, 'lock', $repos, $file)){ push @errors, "$1 : cannot delete locked Files"; } } elsif($transaction =~ /^A. (.*[^\/])$/){ my $needs_lock; my $path = $1; foreach my $prop (&read_from_process($svnlook, 'proplist', $repos, '-t', $txn, '--verbose', $path)){ if ($prop =~ /^\s*svn:needs-lock : (\S+)/){ $needs_lock = $1; } } if (not $needs_lock){ push @errors, "$path : svn:needs-lock is not set. Pleas ask TCC for support."; } } } if (@errors) { warn "$0:\n\n", join("\n", @errors), "\n\n"; exit 1; } else { exit 0; } sub usage { warn "@_\n" if @_; die "usage: $0 REPOS TXN-NAME\n"; } sub safe_read_from_pipe { unless (@_) { croak "$0: safe_read_from_pipe passed no arguments.\n"; } print "Running @_\n"; my $pid = open(SAFE_READ, '-|'); unless (defined $pid) { die "$0: cannot fork: $!\n"; } unless ($pid) { open(STDERR, ">&STDOUT") or die "$0: cannot dup STDOUT: $!\n"; exec(@_) or die "$0: cannot exec @_': $!\n"; } my @output; while (<SAFE_READ>) { chomp; push(@output, $_); } close(SAFE_READ); my $result = $?; my $exit = $result >> 8; my $signal = $result & 127; my $cd = $result & 128 ? "with core dump" : ""; if ($signal or $cd) { warn "$0: pipe from @_' failed $cd: exit=$exit signal=$signal\n"; } if (wantarray) { return ($result, @output); } else { return $result; } } sub read_from_process { unless (@_) { croak "$0: read_from_process passed no arguments.\n"; } my ($status, @output) = &safe_read_from_pipe(@_); if ($status) { if (@output) { die "$0: @_' failed with this output:\n", join("\n", @output), "\n"; } else { die "$0: @_' failed with no output.\n"; } } else { return @output; } }

    Read the article

  • Unable to resolve class in build.gradle using Android Studio 0.60/Gradle 0.11

    - by saywhatnow
    Established app working fine using Android Studio 0.5.9/ Gradle 0.9 but upgrading to Android Studio 0.6.0/ Gradle 0.11 causes the error below. Somehow Studio seems to have lost the ability to resolve the android tools import at the top of the build.gradle file. Anyone got any ideas on how to solve this? build file 'Users/[me]/Repositories/[project]/[module]/build.gradle': 1: unable to resolve class com.android.builder.DefaultManifestParser @ line 1, column 1. import com.android.builder.DefaultManifestParser 1 error at org.codehaus.groovy.control.ErrorCollector.failIfErrors(ErrorCollector.java:302) at org.codehaus.groovy.control.CompilationUnit.applyToSourceUnits(CompilationUnit.java:858) at org.codehaus.groovy.control.CompilationUnit.doPhaseOperation(CompilationUnit.java:548) at org.codehaus.groovy.control.CompilationUnit.compile(CompilationUnit.java:497) at groovy.lang.GroovyClassLoader.doParseClass(GroovyClassLoader.java:306) at groovy.lang.GroovyClassLoader.parseClass(GroovyClassLoader.java:287) at org.gradle.groovy.scripts.internal.DefaultScriptCompilationHandler.compileScript(DefaultScriptCompilationHandler.java:115) ... 77 more 2014-06-09 10:15:28,537 [ 92905] INFO - .BaseProjectImportErrorHandler - Failed to import Gradle project at '/Users/[me]/Repositories/[project]' org.gradle.tooling.BuildException: Could not run build action using Gradle distribution 'http://services.gradle.org/distributions/gradle-1.12-all.zip'. at org.gradle.tooling.internal.consumer.ResultHandlerAdapter.onFailure(ResultHandlerAdapter.java:53) at org.gradle.tooling.internal.consumer.async.DefaultAsyncConsumerActionExecutor$1$1.run(DefaultAsyncConsumerActionExecutor.java:57) at org.gradle.internal.concurrent.DefaultExecutorFactory$StoppableExecutorImpl$1.run(DefaultExecutorFactory.java:64) [project]/[module]/build.gradle import com.android.builder.DefaultManifestParser apply plugin: 'android-sdk-manager' apply plugin: 'android' android { sourceSets { main { manifest.srcFile 'src/main/AndroidManifest.xml' res.srcDirs = ['src/main/res'] } debug { res.srcDirs = ['src/debug/res'] } release { res.srcDirs = ['src/release/res'] } } compileSdkVersion 19 buildToolsVersion '19.0.0' defaultConfig { minSdkVersion 14 targetSdkVersion 19 } signingConfigs { release } buildTypes { release { runProguard false proguardFiles getDefaultProguardFile('proguard-android.txt'), 'proguard-rules.txt' signingConfig signingConfigs.release applicationVariants.all { variant -> def file = variant.outputFile def manifestParser = new DefaultManifestParser() def wmgVersionCode = manifestParser.getVersionCode(android.sourceSets.main.manifest.srcFile) println wmgVersionCode variant.outputFile = new File(file.parent, file.name.replace("-release.apk", "_" + wmgVersionCode + ".apk")) } } } packagingOptions { exclude 'META-INF/LICENSE.txt' exclude 'META-INF/NOTICE.txt' } } def Properties props = new Properties() def propFile = file('signing.properties') if (propFile.canRead()){ props.load(new FileInputStream(propFile)) if (props!=null && props.containsKey('STORE_FILE') && props.containsKey('STORE_PASSWORD') && props.containsKey('KEY_ALIAS') && props.containsKey('KEY_PASSWORD')) { println 'RELEASE BUILD SIGNING' android.signingConfigs.release.storeFile = file(props['STORE_FILE']) android.signingConfigs.release.storePassword = props['STORE_PASSWORD'] android.signingConfigs.release.keyAlias = props['KEY_ALIAS'] android.signingConfigs.release.keyPassword = props['KEY_PASSWORD'] } else { println 'RELEASE BUILD NOT FOUND SIGNING PROPERTIES' android.buildTypes.release.signingConfig = null } }else { println 'RELEASE BUILD NOT FOUND SIGNING FILE' android.buildTypes.release.signingConfig = null } repositories { maven { url 'https://repo.commonsware.com.s3.amazonaws.com' } maven { url 'https://oss.sonatype.org/content/repositories/snapshots/' } } dependencies { compile 'com.github.gabrielemariotti.changeloglib:library:1.4.+' compile 'com.google.code.gson:gson:2.2.4' compile 'com.google.android.gms:play-services:+' compile 'com.android.support:appcompat-v7:+' compile 'com.squareup.okhttp:okhttp:1.5.+' compile 'com.octo.android.robospice:robospice:1.4.11' compile 'com.octo.android.robospice:robospice-cache:1.4.11' compile 'com.octo.android.robospice:robospice-retrofit:1.4.11' compile 'com.commonsware.cwac:security:0.1.+' compile 'com.readystatesoftware.sqliteasset:sqliteassethelper:+' compile 'com.android.support:support-v4:19.+' compile 'uk.co.androidalliance:edgeeffectoverride:1.0.1+' compile 'de.greenrobot:eventbus:2.2.1+' compile project(':captureActivity') compile ('de.keyboardsurfer.android.widget:crouton:1.8.+') { exclude group: 'com.google.android', module: 'support-v4' } compile files('libs/CWAC-LoaderEx.jar') }

    Read the article

  • WiX unresolved reference error

    - by David
    I'm using Wix version 3.0.5419.0. I have two .wxs files, one which is a fragment, and another which uses the fragment to create the .msi file. Here is the file which uses the fragment (DaisyFarmer.wxs): <?xml version='1.0' encoding='windows-1252'?> <Wix xmlns='http://schemas.microsoft.com/wix/2006/wi' xmlns:iis='http://schemas.microsoft.com/wix/IIsExtension'> <Product Name='Daisy Web Site 1.0' Id='BB7FBBE4-0A25-4cc7-A39C-AC916B665220' UpgradeCode='8A5311DE-A125-418f-B0E1-5A30B9C667BD' Language='1033' Codepage='1252' Version='1.0.0' Manufacturer='the man'> <Package Id='5F341544-4F95-4e01-A2F8-EF74448C0D6D' Keywords='Installer' Description="desc" Manufacturer='the man' InstallerVersion='100' Languages='1033' Compressed='yes' SummaryCodepage='1252' /> <Media Id='1' Cabinet='Sample.cab' EmbedCab='yes' DiskPrompt="CD-ROM #1" /> <Property Id='DiskPrompt' Value="the man" /> <PropertyRef Id="NETFRAMEWORK35"/> <Condition Message='This setup requires the .NET Framework 3.5.'> <![CDATA[Installed OR (NETFRAMEWORK35)]]> </Condition> <Feature Id='DaisyFarmer' Title='DaisyFarmer' Level='1'> <ComponentRef Id='SchedulerComponent' /> </Feature> </Product> </Wix> The fragment I'm referencing is (Scheduler.wxs): <?xml version="1.0" encoding="utf-8"?> <Wix xmlns="http://schemas.microsoft.com/wix/2006/wi"> <Fragment> <DirectoryRef Id="TARGETDIR"> <Directory Id="dir2787390E4B7313EB8005DE08108EFEA4" Name="scheduler"> <Component Id="SchedulerComponent" Guid="{9254F7E1-DE41-4EE5-BC0F-BA668AF051CB}"> <File Id="fil9A013D0BFB837BAC71FED09C59C5501B" KeyPath="yes" Source="SourceDir\DTBookMonitor.exe" /> <File Id="fil4F0D8D05F53E6AFBDB498E7C75C2D98F" KeyPath="no" Source="SourceDir\DTBookMonitor.exe.config" /> <File Id="filF02F4686267D027CB416E044E8C8C2FA" KeyPath="no" Source="SourceDir\monitor.bat" /> <File Id="fil05B8FF38A3C85FE6C4A58CD6FDFCD2FB" KeyPath="no" Source="SourceDir\output.txt" /> <File Id="fil397F04E2527DCFDF7E8AC1DD92E48264" KeyPath="no" Source="SourceDir\pipelineOutput.txt" /> <File Id="fil83DFACFE7F661A9FF89AA17428474929" KeyPath="no" Source="SourceDir\process.bat" /> <File Id="fil2809039236E0072642C52C6A52AD6F2F" KeyPath="no" Source="SourceDir\README.txt" /> </Component> </Directory> </DirectoryRef> </Fragment> </Wix> I then run the following commands: candle -ext WixUtilExtension -ext WiXNetFxExtension DaisyFarmer.wxs Scheduler.wxs light -sice:ICE20 -ext WixUtilExtension -ext WiXNetFxExtension Scheduler.wixobj DaisyFarmer.wixobj -out DaisyFarmer.msi I'm getting an error when I run light.exe which says "DaisyFarmer.wxs(20) : error LGHT0094 : Unresolved reference to symbol 'Component:SchedulerComponent' in section 'Product:{BB7FBBE4-0A25-4CC7-A39C-AC916B665220}'." What am I missing?

    Read the article

  • creating Linq to sqlite dbml from DbLinq source code

    - by Veer
    Hi All, I tried to create linq-to-sqlite dbml using DbLinq but in vain. Each time I get different type of errors. May be I'm somewhere wrong. Can anyone tell me the step by step procedure to create the dbml file from the Dblinq source code. Edit: Steps I Followed: I downloaded the source file from this link. Edited the "run_sqliteMetal.bat" file in \\DbLinq-0.19\src\DbMetal folder as 'DbMetal.exe -database:myDb.db3 -namespace:myNS -code:myCode.cs' -dbml:myDbml.dbml Tried to run the DbMetal project file to produce the executable but there was a runtime error since Options object in Parameters.cs was null. Hence downloaded the readymade exe file from this location Copied it into the \DbLinq-0.19\src\DbMetal folder Executed the "run_sqliteMetal.bat" file I got a blank screen and Windows Error Msg "DbLinq has stopped Working" Any help? Thanks in advance, Veer

    Read the article

< Previous Page | 695 696 697 698 699 700 701 702 703 704 705 706  | Next Page >