Search Results

Search found 70517 results on 2821 pages for 'file creation'.

Page 699/2821 | < Previous Page | 695 696 697 698 699 700 701 702 703 704 705 706  | Next Page >

  • Why Photoshop CS5's photomerge's result immediately disappear?

    - by koiyu
    I have a bunch of JPG-files which I want to stitch together with Photoshop's Photomerge function. I choose File → Automate → Photomerge... and browse for the files. Photoshop opens the files and starts analyzing. I see the process bar filling and different phases are mentioned on the process bar. Nothing weird there. When the merging is done (and if I don't blink my eyes), I can see layers-palette is populated with the chosen files and, by quickly judging from the layer thumbnails, they're properly aligned. Sometimes the image window itself can be seen, but not always. Problem is that the layers and the image disappear in a flash. There is no error message. Everything is like prior starting the photomerge. No file has been changed. I could continue to use Photoshop normally. This is what I've tried so far: Loaded folder which has 38 JPG images, 4272 x 2848 and ˜ 5 megabytes per file Loaded the same files, but chose Use Files instead of Use Folder in the photomerge's window Loaded 19 JPG images, 4272 x 2848 and ˜ 5 megabytes per file Loaded 10 JPG images, ⇑ see above Loaded 5 JPG images, see above Loaded 3 JPG images, see above Scaled the images to 2256 x 1504 and ˜< 1 megabytes per file Loaded in a set of 38, 19, 10, 5, 3 Following steps are tested with these smaller files and with a set of 5 images Read Adobe's forums and reduced the amount of RAM Photoshop uses gradually from ˜ 80 % to 50 % (though I didn't understand the logic behind this) Would've reduced cache tile size to 128K, but it was set so already Disabled OpenGL Scaled the images to 800 x 533 and ˜ 100 kilobytes per file, loaded a set of 5 Read more unanswered threads around the internet In between each test I closed and reopened Photoshop. This is the first time I've even tried using photomerge. Am I doing something wrong? How can I locate what is the problem? How do I fix this? Photoshop is 64 bit Extended CS5 version. I'm on a mid-2010 quad-core (i5) iMac with up-to-date Mac OS X 10.6.6. Edit: Weird. First loading the images into one file via File → Scripts → Load Files into Stack… and then using Edit → Auto-Align Layers…, which, effectively, is the same as photomerge (even the dialog looks kind of the same), works! Even with the original JPGs without any issues. This doesn't fix photomerge, though.

    Read the article

  • Convert Chinese character .wav song into .mp3 or .wma on English OS

    - by Jack
    I have bunch of Chinese .wav files on my hard disk that I'm trying to convert into .mp3 with Audacity but it appear that Audacity can not read Chinese character songs but the .wav file display correctly on my 32 bits Win7 Ultimate(English) pc. I have to rename these Chinese character songs into English file name in order to convert them. Does anyone know if there is any software (prefer open source) that will take Chinese character file name(.wav) and convert it into .mp3 without renaming the file?

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • Automatic picture size adjustment

    - by CChriss
    Does anyone know of a free utility that allows you to paste into it a graphics file (any type would work for me, jpg, bmp, png, etc) and it will size the file to within a preset size boundary? For instance, if I preset it to resize files to be a maximum of 400 wide by 300 tall, and I paste in a file 500x500, it would shrink the file to fit within the 300 tall limit. Thanks.

    Read the article

  • Accessing a broken mdadm raid

    - by CarstenCarsten
    Hi! I used a western digital mybookworld (SOHO NAS storage using Linux) as backup for my Linux box. Suddenly, the mybookworld does not boot up any more. So I opened the box, removed the hard disk and put the hard disk into an external USB HDD case, and connected it to my Linux box. [ 530.640301] usb 2-1: new high speed USB device using ehci_hcd and address 3 [ 530.797630] scsi7 : usb-storage 2-1:1.0 [ 531.794844] scsi 7:0:0:0: Direct-Access WDC WD75 00AAKS-00RBA0 PQ: 0 ANSI: 2 [ 531.796490] sd 7:0:0:0: Attached scsi generic sg3 type 0 [ 531.797966] sd 7:0:0:0: [sdc] 1465149168 512-byte logical blocks: (750 GB/698 GiB) [ 531.800317] sd 7:0:0:0: [sdc] Write Protect is off [ 531.800327] sd 7:0:0:0: [sdc] Mode Sense: 38 00 00 00 [ 531.800333] sd 7:0:0:0: [sdc] Assuming drive cache: write through [ 531.803821] sd 7:0:0:0: [sdc] Assuming drive cache: write through [ 531.803836] sdc: sdc1 sdc2 sdc3 sdc4 [ 531.815831] sd 7:0:0:0: [sdc] Assuming drive cache: write through [ 531.815842] sd 7:0:0:0: [sdc] Attached SCSI disk The dmesg output looks normal, but I was wondering why the hardisk was not mounted at all. And why there are 4 different partitions on it. fdisk showed the following: root@ubuntu:/home/ubuntu# fdisk /dev/sdc WARNING: DOS-compatible mode is deprecated. It's strongly recommended to switch off the mode (command 'c') and change display units to sectors (command 'u'). Command (m for help): p Disk /dev/sdc: 750.2 GB, 750156374016 bytes 255 heads, 63 sectors/track, 91201 cylinders Units = cylinders of 16065 * 512 = 8225280 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x00007c00 Device Boot Start End Blocks Id System /dev/sdc1 4 369 2939895 fd Linux raid autodetect /dev/sdc2 370 382 104422+ fd Linux raid autodetect /dev/sdc3 383 505 987997+ fd Linux raid autodetect /dev/sdc4 506 91201 728515620 fd Linux raid autodetect Oh no! Everything seems to be created as a mdadm software raid. Calling mdadm --examine with the different partitions seems to affirm that. I think the only partition I am interested in, is /dev/sdc4 (because it is the largest). But nevertheless I called mdadm --examine with every partition. root@ubuntu:/home/ubuntu# mdadm --examine /dev/sdc1 /dev/sdc1: Magic : a92b4efc Version : 00.90.00 UUID : 5626a2d8:070ad992:ef1c8d24:cd8e13e4 Creation Time : Wed Feb 20 00:57:49 2002 Raid Level : raid1 Used Dev Size : 2939776 (2.80 GiB 3.01 GB) Array Size : 2939776 (2.80 GiB 3.01 GB) Raid Devices : 2 Total Devices : 1 Preferred Minor : 1 Update Time : Sun Nov 21 11:05:27 2010 State : clean Active Devices : 1 Working Devices : 1 Failed Devices : 1 Spare Devices : 0 Checksum : 4c90bc55 - correct Events : 16682 Number Major Minor RaidDevice State this 0 8 1 0 active sync /dev/sda1 0 0 8 1 0 active sync /dev/sda1 1 1 0 0 1 faulty removed root@ubuntu:/home/ubuntu# mdadm --examine /dev/sdc2 /dev/sdc2: Magic : a92b4efc Version : 00.90.00 UUID : 9734b3ee:2d5af206:05fe3413:585f7f26 Creation Time : Wed Feb 20 00:57:54 2002 Raid Level : raid1 Used Dev Size : 104320 (101.89 MiB 106.82 MB) Array Size : 104320 (101.89 MiB 106.82 MB) Raid Devices : 2 Total Devices : 1 Preferred Minor : 2 Update Time : Wed Oct 27 20:19:08 2010 State : clean Active Devices : 1 Working Devices : 1 Failed Devices : 1 Spare Devices : 0 Checksum : 55560b40 - correct Events : 9884 Number Major Minor RaidDevice State this 0 8 2 0 active sync /dev/sda2 0 0 8 2 0 active sync /dev/sda2 1 1 0 0 1 faulty removed root@ubuntu:/home/ubuntu# mdadm --examine /dev/sdc3 /dev/sdc3: Magic : a92b4efc Version : 00.90.00 UUID : 08f30b4f:91cca15d:2332bfef:48e67824 Creation Time : Wed Feb 20 00:57:54 2002 Raid Level : raid1 Used Dev Size : 987904 (964.91 MiB 1011.61 MB) Array Size : 987904 (964.91 MiB 1011.61 MB) Raid Devices : 2 Total Devices : 1 Preferred Minor : 3 Update Time : Sun Nov 21 11:05:27 2010 State : clean Active Devices : 1 Working Devices : 1 Failed Devices : 1 Spare Devices : 0 Checksum : 39717874 - correct Events : 73678 Number Major Minor RaidDevice State this 0 8 3 0 active sync 0 0 8 3 0 active sync 1 1 0 0 1 faulty removed root@ubuntu:/home/ubuntu# mdadm --examine /dev/sdc4 /dev/sdc4: Magic : a92b4efc Version : 00.90.00 UUID : febb75ca:e9d1ce18:f14cc006:f759419a Creation Time : Wed Feb 20 00:57:55 2002 Raid Level : raid1 Used Dev Size : 728515520 (694.77 GiB 746.00 GB) Array Size : 728515520 (694.77 GiB 746.00 GB) Raid Devices : 2 Total Devices : 1 Preferred Minor : 4 Update Time : Sun Nov 21 11:05:27 2010 State : clean Active Devices : 1 Working Devices : 1 Failed Devices : 1 Spare Devices : 0 Checksum : 2f36a392 - correct Events : 519320 Number Major Minor RaidDevice State this 0 8 4 0 active sync 0 0 8 4 0 active sync 1 1 0 0 1 faulty removed If I read the output correctly everything was removed, because it was faulty. Is there ANY way to see the contents of the largest partition? Or seeing somehow which files are broken? I see that everything is raid1 which is only mirroring, so this should be a normal partition. I am anxious to do anything with mdadm, in fear that I destroy the data on the hard disk. I would be very thankful for any help.

    Read the article

  • How can I unzip a .tar.gz in one step (using 7-Zip)?

    - by quickcel
    I am using 7-Zip on Windows XP and whenever I download a .tar.gz file it takes me two steps to completely extract the file(s). I right-click on the example.tar.gz file and choose 7-Zip -- Extract Here from the context menu. I then take the resulting example.tar file and the right-click again and choose 7-Zip -- Extract Here from the context menu. Is there a way through the context menu to do this in one step?

    Read the article

  • Password Security: Short and Complex versus ‘Short or Lengthy’ and Less Complex

    - by Akemi Iwaya
    Creating secure passwords for our online accounts is a necessary evil due to the huge increase in database and account hacking that occurs these days. The problem though is that no two companies have a similar policy for complex and secure password creation, then factor in the continued creation of insecure passwords or multi-site use of the same password and trouble is just waiting to happen. Ars Technica decided to take a look at multiple password types, how users fared with them, and how well those password types held up to cracking attempts in their latest study. The password types that Ars Technica looked at were comprehensive8, basic8, and basic16. The comprehensive type required a variety of upper-case, lower-case, digits, and symbols with no dictionary words allowed. The only restriction on the two basic types was the number of characters used. Which type do you think was easier for users to adopt and did better in the two password cracking tests? You can learn more about how well users did with the three password types and the results of the tests by visiting the article linked below. What are your thoughts on the matter? Are shorter, more complex passwords better or worse than using short or long, but less complex passwords? What methods do you feel work best since most passwords are limited to approximately 16 characters in length? Perhaps you use a service like LastPass or keep a dedicated list/notebook to manage your passwords. Let us know in the comments!    

    Read the article

  • CodePlex Daily Summary for Wednesday, December 08, 2010

    CodePlex Daily Summary for Wednesday, December 08, 2010Popular ReleasesAlgorithmia: Algorithmia 1.1: Algorithmia v1.1, released on December 8th, 2010.SubtitleTools: SubtitleTools 1.1: Added a better ToUTF-8 converter (not just from windows-1256 to utf-8). Refactored OpenFileDialogs to a more MVVM friendly behavior.SuperSocket, an extensible socket application framework: SuperSocket 1.0 SP1: Fixed bugs: fixed a potential bug that the running state hadn't been updated after socket server stopped fixed a synchronization issue when clearing timeout session fixed a bug in ArraySegmentList fixed a bug on getting configuration valueHydroDesktop - CUAHSI Hydrologic Information System Desktop Application: 1.1.340: HydroDesktop 1.1 Stable Release (Build 340)CslaGenFork: CslaGenFork 4.0 CTP 2: The version is 4.0.1 CTP2 and was released 2010 December 7 and includes the following files: CslaGenFork 4.0.1-2010-12-07 Setup.msi Templates-2010-10-07.zip For getting started instructions, refer to How to section. Overview of the changes Since CTP1 there were 53 work items closed (28 features, 24 issues and 1 task). During this 60 days a lot of work has been done on several areas. First the stereotypes: EditableRoot is OK EditableChild is OK EditableRootCollection is OK Editable...My Web Pages Starter Kit: 1.3.1 Production Release (Security HOTFIX): Due to a critical security issue, it's strongly advised to update the My Web Pages Starter Kit to this version. Possible attackers could misuse the image upload to transmit any type of file to the website. If you already have a running version of My Web Pages Starter Kit 1.3.0, you can just replace the ftb.imagegallery.aspx file in the root directory with the one attached to this release.EnhSim: EnhSim 2.2.0 ALPHA: 2.2.0 ALPHAThis release adds in the changes for 4.03a. at level 85 To use this release, you must have the Microsoft Visual C++ 2010 Redistributable Package installed. This can be downloaded from http://www.microsoft.com/downloads/en/details.aspx?FamilyID=A7B7A05E-6DE6-4D3A-A423-37BF0912DB84 To use the GUI you must have the .NET 4.0 Framework installed. This can be downloaded from http://www.microsoft.com/downloads/en/details.aspx?FamilyID=9cfb2d51-5ff4-4491-b0e5-b386f32c0992 - Updated En...ASP.NET MVC Project Awesome (jQuery Ajax helpers): 1.4: A rich set of helpers (controls) that you can use to build highly responsive and interactive Ajax-enabled Web applications. These helpers include Autocomplete, AjaxDropdown, Lookup, Confirm Dialog, Popup Form, Popup and Pager new stuff: popup WhiteSpaceFilterAttribute tested on mozilla, safari, chrome, opera, ie 9b/8/7/6nopCommerce. ASP.NET open source shopping cart: nopCommerce 1.90: To see the full list of fixes and changes please visit the release notes page (http://www.nopCommerce.com/releasenotes.aspx).TweetSharp: TweetSharp v2.0.0.0 - Preview 4: Documentation for this release may be found at http://tweetsharp.codeplex.com/wikipage?title=UserGuide&referringTitle=Documentation. Note: This code is currently preview quality. Preview 4 ChangesReintroduced fluent interface support via satellite assembly Added entities support, entity segmentation, and ITweetable/ITweeter interfaces for client development Numerous fixes reported by preview users Preview 3 ChangesNumerous fixes and improvements to core engine Twitter API coverage: a...myCollections: Version 1.2: New in version 1.2: Big performance improvement. New Design (Added Outlook style View, New detail view, New Groub By...) Added Sort by Media Added Manage Movie Studio Zoom preference is now saved. Media name are now editable. Added Portuguese version You can now Hide details panel Add support for FLAC tags You can now imports books from BibTex Xml file BugFixingmytrip.mvc (CMS & e-Commerce): mytrip.mvc 1.0.49.0 beta: mytrip.mvc 1.0.49.0 beta web Web for install hosting System Requirements: NET 4.0, MSSQL 2008 or MySql (auto creation table to database) if .\SQLEXPRESS auto creation database (App_Data folder) mytrip.mvc 1.0.49.0 beta src System Requirements: Visual Studio 2010 or Web Deweloper 2010 MSSQL 2008 or MySql (auto creation table to database) if .\SQLEXPRESS auto creation database (App_Data folder) Connector/Net 6.3.4, MVC3 RC WARNING For run and debug mytrip.mvc 1.0.49.0 beta src download and ...MiniTwitter: 1.62: MiniTwitter 1.62 ???? ?? ??????????????????????????????????????? 140 ?????????????????????????? ???????????????????????????????? ?? ??????????????????????????????????Phalanger - The PHP Language Compiler for the .NET Framework: 2.0 (December 2010): The release is targetted for stable daily use. With improved performance and enhanced compatibility with several latest PHP open source applications; it makes this release perfect replacement of your old PHP runtime. Changes made within this release include following and much more: Performance improvements based on real-world applications experience. We determined biggest bottlenecks and we found and removed overheads causing performance problems in many PHP applications. Reimplemented nat...Chronos WPF: Chronos v2.0 Beta 3: Release notes: Updated introduction document. Updated Visual Studio 2010 Extension (vsix) package. Added horizontal scrolling to the main window TaskBar. Added new styles for ListView, ListViewItem, GridViewColumnHeader, ... Added a new WindowViewModel class (allowing to fetch data). Added a new Navigate method (with several overloads) to the NavigationViewModel class (protected). Reimplemented Task usage for the WorkspaceViewModel.OnDelete method. Removed the reflection effect...MDownloader: MDownloader-0.15.26.7024: Fixed updater; Fixed MegauploadDJ - jQuery WebControls for ASP.NET: DJ 1.2: What is new? Update to support jQuery 1.4.2 Update to support jQuery ui 1.8.6 Update to Visual Studio 2010 New WebControls with samples added Autocomplete WebControl Button WebControl ToggleButt WebControl The example web site is including in source code project.LateBindingApi.Excel: LateBindingApi.Excel Release 0.7g: Unterschiede zur Vorgängerversion: - Zusätzliche Interior Properties - Group / Ungroup Methoden für Range - Bugfix COM Reference Handling für Application Objekt in einigen Klassen Release+Samples V0.7g: - Enthält Laufzeit DLL und Beispielprojekte Beispielprojekte: COMAddinExample - Demonstriert ein versionslos angebundenes COMAddin Example01 - Background Colors und Borders für Cells Example02 - Font Attributes undAlignment für Cells Example03 - Numberformats Example04 - Shapes, WordArts, P...ESRI ArcGIS Silverlight Toolkit: November 2010 - v2.1: ESRI ArcGIS Silverlight Toolkit v2.1 Added Windows Phone 7 build. New controls added: InfoWindow ChildPage (Windows Phone 7 only) See what's new here full details for : http://help.arcgis.com/en/webapi/silverlight/help/#/What_s_new_in_2_1/016600000025000000/ Note: Requires Visual Studio 2010, .NET 4.0 and Silverlight 4.0.ASP .NET MVC CMS (Content Management System): Atomic CMS 2.1.1: Atomic CMS 2.1.1 release notes Atomic CMS installation guide New ProjectsCore Motives Tracking Web Part: This C# web part was created to allow users of SharePoint 2007 to place CoreMotives (http://www.coremotives.com) tracking code on any web part page. Can also be used in master pages and page layouts.CPEBook: OsefEatFrsh: Keep Track of contents of your Fridge. Eat items while they are still fresh.ENUH10Publisher: Et prosjekt for studenter ved eCademy H10EVE Community Portal: EVE Community Portal is a complete community portal for EVE alliances (and corporations), which will host everything an eve alliance needs, from a forum and blogs to every tool you could whish for and more...FER CSLA.NET Compact: .NET Compact Framework edition of CSLA.NET application framework.Finger Mouse: it's a good idea and simple program help you to use the mouse feature from webcam (without mouse) note : you should have i3 or higher processorGambaru: Gambaru é um techdemo de um game 3D desenvolvido em Delphi. Utiliza engine de física Newton e Open GL (pacote GL-Scene). Foi apresentado como trabalho de conclusão de curso no SENAC-SP por Marcelo, Daniel e Thais em 2007. Exploramos o universo Samurai. Contribua, programe, sonhe!GameBoyEmu: ????,GameBoy ???GenericList Inherits IDataReader ( ListEx<T>() : IDataReader ): This Generic List implements the IDataReader interface and displays the usage of Linq, Lamba expressions and some creative thought around working with collection types. I hope it can serve as reference to your projects.Guard: Provides the argument validation class Guard, ubiquitously used throughout all .NET projects but with no central place for updates.HolidayChecker Library: HolidayChecker Library is a usefull library that allows programmers to know if a certain date is a festivity or not. This library also allows the calculation of Easter day based on the algorithm of Tondering. It's developed in C#.JuniorTour - Junior Golf Tour Silverlight Application: JuniorTour makes it easier for golf tour operators to publish tournament results for multiple divisions and multiple seasons. You'll no longer have to manually edit player pages, tournament results, or compute rankings. It's developed in C# and Silverlight.LibGT: LibGT aims to reduce the amount of overall code a programmer has to write in C#. This library provides many shortcuts and extension methods to facilitate robust development rapidly even without the use of an IDE.Mayhem: Mayhem makes it simple for end users to control complex events with their PCs. Whether you want to Update a Twitter status when your cat is detected by your webcam or monitor your serial ports and trigger events, it's no problem with Mayhem -- wreak your own personal havoc.mmht: ???????,??????MobilePolice: my mobilepolice projectOpenCallback: This is a implementation of the callback handler pattern that allows you to invoke the callback handle methods with out type switching or if...else if chains.Project Baron: Simple, yet powerful Project Management System.PS3Lib for SDK 1.92: Création d'une librairie de ceveloppement pour le SDK 1.92Remote Controller for Trackmania: Evzrecon is a remote controller for Trackmania Forever dedicated servers, much like XASECO but written in Java.SharePointSocial: SharePointSocial is focused on taking social interaction within SharePoint to the next level, extending beyond the corporate boundaries. Corporate listening, one-click interaction through key social media outlets and data-driven management and reporting are planned features.SIGS: ssSimple Routing: Simple Routing allows you to associate arbitrary routes with static methods in an ASP.NET application through attribution.SlimCRM: Aplicación de referencia de buenas prácticas de programaciónTalkBoard: ????????,?????????!uHelpsy - Umbraco Helper Library: uHelpsy is a tiny (but growing) library which makes programatically interacting with Umbraco 4.5.2 much more pleasant. It provides helper methods for creating and updating nodes, working with the Umbraco cache, and dealing with unpublished nodes. VCSS: VCSS is a decorated version of CSS (Cascading Style Sheets) that allows you to specify variables and also nest rules. The VCSS file can be compiled into a standard CSS file to be used on any website.Vote: ?,???????????????!WP7 GPS Simulator: Use this project to simulate GPS while doing development on your Windows Phone 7.WPF_CAD: this proyect it's a college proyect form grafic computer course. Consist in the development of a cad soft implementing all grafics algoritms.Xml-Racing: Réaliser une application Web 3-tiers qui permette d'interroger une BD et de restituer les infos sous forme de graphiques et cartes.

    Read the article

  • Quick guide to Oracle IRM 11g: Server installation

    - by Simon Thorpe
    Quick guide to Oracle IRM 11g index This is the first of a set of articles designed to assist with the successful installation, configuration and deployment of a document security solution using Oracle IRM. This article goes through a set of simple instructions which detail how to download, install and configure the IRM server, the starting point for building a document security solution. This article contains a subset of information from the official documentation and is focused on installing the server on Oracle Enterprise Linux. If you are planning to deploy on a non-Linux platform, you will need to reference the documentation for platform specific information. Contents Introduction Downloading the software Preparing a database Creating the schema WebLogic Server installation Installing Oracle IRM Introduction Because we are using Oracle Enterprise Linux in this guide, and before we get into the detail of IRM, i'd like to share some tips with Linux to make life a bit easier.Use a 64bit platform, IRM 11g runs just fine on a 32bit server but with 64bit you will build a more future proof service. Download and install the latest Java JDK package. Make sure you get the 64bit version if you are on a 64bit server. Configure Linux to use a good Yum server to simplify installing packages. For Oracle Enterprise Linux we maintain a great public Yum here. Have at least 20GB of free disk space on the partition you intend to install the IRM server. The downloads are big, then you extract them and then install. This quickly consumes disk space which you can easily recover by deleting the downloaded and extracted files after wards. But it's nice to have the disk space spare to keep these around in case you need to restart any part of the installation process again. Downloading the software OK, so before you can do anything, you need the software install kits. Luckily Oracle allows you to freely download every technology we create. You'll need to get the following; Oracle WebLogic Server Oracle Database Oracle Repository Creation Utility (rcu) Oracle IRM server You can use Microsoft SQL server 2005 or 2008, in this guide i've used Oracle RDBMS 11gR2 for Linux. Preparing the database I'm not going to go through the finer points of installing the database. There are many very good guides on installing the Oracle Database. However one thing I would suggest you think about is enabling TDE, network encryption and using Database Vault. These Oracle database security technologies are excellent for creating a complete end to end security solution. No point in going to all the effort to secure document access with IRM when someone can go directly to the database and assign themselves rights to documents. To understand this further, you can see a video of the IRM service using these database security technologies here. With a database up and running we need to create a schema to hold the IRM data. This schema contains the rights model, cryptographic keys, user account id's and associated rights etc. Creating the IRM database schema Oracle uses the Repository Creation Tool which builds your schema, extract the files from the rcu zip. Then in a terminal window; cd /oracle/install/rcu/bin ./rcu This will launch the Repository Creation Tool and you will be presented with the image to the right. Hit next and continue onto the next dialog. You are asked if you are going to be creating a new schema or wish to drop an existing one, you obviously just need to click next at this point to create a new schema. The RCU next needs to know where your database is so you'll need the following details of your database instance. Below, for reference, is the information for my installation. Hostname: irm.oracle.demo Port: 1521 (This is the default TCP port for the Oracle Database) Service Name: irm.oracle.demo. Note this is not the SID, but the service name. Username: sys Password: ******** Role: SYSDBA And then select next. Because the RCU contains schemas for many of the Oracle Technologies, you now need to select to just deploy the Oracle IRM schema. Open the section under "Enterprise Content Management" and tick the "Oracle Information Rights Management" component. Note that you also get the chance to select a prefix which defaults to "DEV" (for development). I usually change this to something that reflects my own install. PROD for a production system, INT for internal only etc. The next step asks for the passwords for the schema users. We are only creating one schema here so you just enter one password. Some brave souls store this password in an Excel spreadsheet which is then secure against the IRM server you're about to install in this guide. Nearing the end of the schema creation is the mapping of the tablespaces to the schema. Note I had setup a table space already that was encrypted using TDE and at this point I was able to select that tablespace by clicking in the "Default Tablespace" column. The next dialog confirms your actions and clicking on next causes it to create the schema and default data. After this you are presented with the completion summary. WebLogic Server installation The database is now ready and the next step is to install the application server. Oracle IRM 11g is a JEE application and currently only supported in Oracle WebLogic Server. So the next step is get WebLogic Server installed, which is pretty easy. Depending on the version you download, you either run the binary or for a 64 bit platform (like mine) run the following command. java -d64 -jar wls1033_generic.jar And in the resulting dialog hit next to start walking through the install. Next choose a directory into which you will install WebLogic Server. I like to change from the default and install into /oracle/. Then all my software goes into this one folder, all owned by the "oracle" user. The next dialog asks for your Oracle support information to ensure you are kept up to date. If you have an Oracle support account, enter your details but for most evaluation systems I leave these fields blank. Again, for evaluation or development systems, I usually stick with the "Typical" install type which you are next asked for. Next you are asked for the JDK which will be used for the server. When installing from the generic jar on a 64bit platform like in this guide, no JDK is bundled with the installer. But as you can see in the image on the right, that it does a good job of detecting the one you've got installed. Defaults for the install directories are usually taken, no changes here, just click next. And finally we are ready to install, hit next, sit back and relax. Typically this takes about 10 minutes. After the install, do not run the quick start, we need to deploy the IRM install itself from which we will create a new WebLogic domain. For now just hit done and lets move to the final step of the installation process. Installing Oracle IRM The last piece of the puzzle to getting your environment ready is to deploy the IRM files themselves. Unzip the Oracle Enterprise Content Management 11g zip file and it will create a Disk1 directory. Switch to this folder and in the console run ./runInstaller. This will launch the installer which will also ask for the location of the JDK. Look at the image on the right for the detail. You should now see the first stage of the IRM installation. The dialog warns you need to have a WebLogic server installed and have created the schema's, but you've just done all that above (I hope) so we are ready to go. The installer now checks that you have all the required libraries installed and other system parameters are correct. Because nearly all of my development and evaluation installations have the database server on the same system, the installer passes these checks without issue... Next... Now chose where to install the IRM files, you must install into the same Middleware Home as the WebLogic Server installation you just performed. Usually the installer already defaults to this location anyway. I also tend to change the Oracle Home Directory to Oracle_IRM so it's clear this is just an IRM install. The summary page tells you about space needed to deploy the files. Unfortunately the IRM install comes with all of the other Oracle ECM software, you can't just select the IRM files, everything gets deployed to disk and uses 1.6GB of space! Not fun, but Oracle has to package up similar technologies otherwise we would have a very large number of installers to QA and manage, again, not fun. Hit Install, time for another drink, maybe a piece of cake or a donut... on a half decent system this part of the install took under 10 minutes. Finally the installation of your IRM server is complete, click on finish and the next phase is to create the WebLogic domain and start configuring your server. Now move onto the next article in this guide... configuring your IRM server ready to seal your first document.

    Read the article

  • CodePlex Daily Summary for Thursday, December 09, 2010

    CodePlex Daily Summary for Thursday, December 09, 2010Popular ReleasesAutoLoL: AutoLoL v1.4.3: AutoLoL now supports importing the build pages from Mobafire.com as well! Just insert the url to the build and voila. (For example: http://www.mobafire.com/league-of-legends/build/unforgivens-guide-how-to-build-a-successful-mordekaiser-24061) Stable release of AutoChat (It is still recommended to use with caution and to read the documentation) It is now possible to associate *.lolm files with AutoLoL to quickly open them The selected spells are now displayed in the masteries tab for qu...SubtitleTools: SubtitleTools 1.2: - Added auto insertion of RLE (RIGHT-TO-LEFT EMBEDDING) Unicode character for the RTL languages. - Fixed delete rows issue.PHP Manager for IIS: PHP Manager 1.1 for IIS 7: This is a final stable release of PHP Manager 1.1 for IIS 7. This is a minor incremental release that contains all the functionality available in 53121 plus additional features listed below: Improved detection logic for existing PHP installations. Now PHP Manager detects the location to php.ini file in accordance to the PHP specifications Configuring date.timezone. PHP Manager can automatically set the date.timezone directive which is required to be set starting from PHP 5.3 Ability to ...Algorithmia: Algorithmia 1.1: Algorithmia v1.1, released on December 8th, 2010.SuperSocket, an extensible socket application framework: SuperSocket 1.0 SP1: Fixed bugs: fixed a potential bug that the running state hadn't been updated after socket server stopped fixed a synchronization issue when clearing timeout session fixed a bug in ArraySegmentList fixed a bug on getting configuration valueCslaGenFork: CslaGenFork 4.0 CTP 2: The version is 4.0.1 CTP2 and was released 2010 December 7 and includes the following files: CslaGenFork 4.0.1-2010-12-07 Setup.msi Templates-2010-10-07.zip For getting started instructions, refer to How to section. Overview of the changes Since CTP1 there were 53 work items closed (28 features, 24 issues and 1 task). During this 60 days a lot of work has been done on several areas. First the stereotypes: EditableRoot is OK EditableChild is OK EditableRootCollection is OK Editable...Windows Workflow Foundation on Codeplex: WF AppFabric Caching Activity Pack 0.1: This release includes a set of AppFabric Caching Activities that allow you to use Windows Server AppFabric Caching with WF4. Video endpoint.tv - New WF4 Caching Activities for Windows Server AppFabric ActivitiesDataCacheAdd DataCacheGet DataCachePut DataCacheGet DataCacheRemove WaitForCacheBulkNotification WaitForCacheNotification WaitForFailureNotification WaitForItemNotification WaitForRegionNotification Unit TestsUnit tests are included in the source. Be sure to star...My Web Pages Starter Kit: 1.3.1 Production Release (Security HOTFIX): Due to a critical security issue, it's strongly advised to update the My Web Pages Starter Kit to this version. Possible attackers could misuse the image upload to transmit any type of file to the website. If you already have a running version of My Web Pages Starter Kit 1.3.0, you can just replace the ftb.imagegallery.aspx file in the root directory with the one attached to this release.EnhSim: EnhSim 2.2.0 ALPHA: 2.2.0 ALPHAThis release adds in the changes for 4.03a. at level 85 To use this release, you must have the Microsoft Visual C++ 2010 Redistributable Package installed. This can be downloaded from http://www.microsoft.com/downloads/en/details.aspx?FamilyID=A7B7A05E-6DE6-4D3A-A423-37BF0912DB84 To use the GUI you must have the .NET 4.0 Framework installed. This can be downloaded from http://www.microsoft.com/downloads/en/details.aspx?FamilyID=9cfb2d51-5ff4-4491-b0e5-b386f32c0992 - Updated En...ASP.NET MVC Project Awesome (jQuery Ajax helpers): 1.4: A rich set of helpers (controls) that you can use to build highly responsive and interactive Ajax-enabled Web applications. These helpers include Autocomplete, AjaxDropdown, Lookup, Confirm Dialog, Popup Form, Popup and Pager new stuff: popup WhiteSpaceFilterAttribute tested on mozilla, safari, chrome, opera, ie 9b/8/7/6nopCommerce. ASP.NET open source shopping cart: nopCommerce 1.90: To see the full list of fixes and changes please visit the release notes page (http://www.nopCommerce.com/releasenotes.aspx).TweetSharp: TweetSharp v2.0.0.0 - Preview 4: Documentation for this release may be found at http://tweetsharp.codeplex.com/wikipage?title=UserGuide&referringTitle=Documentation. Note: This code is currently preview quality. Preview 4 ChangesReintroduced fluent interface support via satellite assembly Added entities support, entity segmentation, and ITweetable/ITweeter interfaces for client development Numerous fixes reported by preview users Preview 3 ChangesNumerous fixes and improvements to core engine Twitter API coverage: a...Aura: Aura Preview 1: Rewritten from scratch. This release supports getting color only from icon of foreground window.MBG Extensions Library: MBG.Extensions_v1.3: MBG.Extensions Collections.CollectionExtensions - AddIfNew - RemoveRange (Moved From ListExtensions to here, where it should have been) Collections.EnumerableExtensions - ToCommaSeparatedList has been replaced by: Join() and ToValueSeparatedList Join is for a single line of values. ToValueSeparatedList is generally for collection and will separate each entity in the collection by a new line character - ToQueue - ToStack Core.ByteExtensions - TripleDESDecrypt Core.DateTimeExtension...myCollections: Version 1.2: New in version 1.2: Big performance improvement. New Design (Added Outlook style View, New detail view, New Groub By...) Added Sort by Media Added Manage Movie Studio Zoom preference is now saved. Media name are now editable. Added Portuguese version You can now Hide details panel Add support for FLAC tags You can now imports books from BibTex Xml file BugFixingmytrip.mvc (CMS & e-Commerce): mytrip.mvc 1.0.49.0 beta: mytrip.mvc 1.0.49.0 beta web Web for install hosting System Requirements: NET 4.0, MSSQL 2008 or MySql (auto creation table to database) if .\SQLEXPRESS auto creation database (App_Data folder) mytrip.mvc 1.0.49.0 beta src System Requirements: Visual Studio 2010 or Web Deweloper 2010 MSSQL 2008 or MySql (auto creation table to database) if .\SQLEXPRESS auto creation database (App_Data folder) Connector/Net 6.3.4, MVC3 RC WARNING For run and debug mytrip.mvc 1.0.49.0 beta src download and ...Menu and Context Menu for Silverlight 4.0: Silverlight Menu and Context Menu v2.3 Beta: - Added keyboard navigation support with access keys - Shortcuts like Ctrl-Alt-A are now supported(where the browser permits it) - The PopupMenuSeparator is now completely based on the PopupMenuItem class - Moved item manipulation code to a partial class in PopupMenuItemsControl.cs - Moved menu management and keyboard navigation code to the new PopupMenuManager class - Simplified the layout by removing the RootGrid element(all content is now placed in OverlayCanvas and is accessed by the new ...MiniTwitter: 1.62: MiniTwitter 1.62 ???? ?? ??????????????????????????????????????? 140 ?????????????????????????? ???????????????????????????????? ?? ??????????????????????????????????Phalanger - The PHP Language Compiler for the .NET Framework: 2.0 (December 2010): The release is targetted for stable daily use. With improved performance and enhanced compatibility with several latest PHP open source applications; it makes this release perfect replacement of your old PHP runtime. Changes made within this release include following and much more: Performance improvements based on real-world applications experience. We determined biggest bottlenecks and we found and removed overheads causing performance problems in many PHP applications. Reimplemented nat...Chronos WPF: Chronos v2.0 Beta 3: Release notes: Updated introduction document. Updated Visual Studio 2010 Extension (vsix) package. Added horizontal scrolling to the main window TaskBar. Added new styles for ListView, ListViewItem, GridViewColumnHeader, ... Added a new WindowViewModel class (allowing to fetch data). Added a new Navigate method (with several overloads) to the NavigationViewModel class (protected). Reimplemented Task usage for the WorkspaceViewModel.OnDelete method. Removed the reflection effect...New Projects:WinK: WinK Project1000 bornes: This project is the adaptation of the famous French card game 1000 bornes (http://en.wikipedia.org/wiki/Mille_Bornes) There will be 3 types of clients: - Windows Application (WPF) - Internet Application (ASP.NET, Ajax) - Silverlight Application It's developed in C#.AutomaTones: BDSA Project 2010. Team Anders is developing an application that uses automatons to generate music.EIRENE: UnknownFinal: TDD driven analize of avalable tdd frameworks ect.HomeGrown Database Project tools: A set of tools that can be used to deploy Visual Studio SQL Databse and Server Projects. Developed using Visual Basic .Net 4.0mcssolution: no summaryMobile-enabled ASP.NET Web Forms / MVC application samples: Code samples for the whitepaper "Add mobile pages to your ASP.NET Web Forms / MVC application" linked from http://asp.net/mobileMSDI Projects: www.msdi.cnObject TreeView Visualizer: This is a Helper Library for easy Access to Visual a Object to an treeview. Nice feature to display data, if an error happen. One Place To Rule Them All: Desktop system to manage basics system functions in 3d environmant. Optra also provide community support and easy transfer data and setups between varius devices using xmpp protocol and OpenFire jabber server.Performance Data Suite: The Performance Data Suite will help you to monitor, analyze and optimize your server infrastructure. There will be predefined sets of data collections(e.g. MySQL, Apache, IIS) but it will also help you to create collections on your own.Secure Group Communication in AdHoc Networks: Secure Group Communication in AdHoc Networksimweb: simweb - is a research project which own by GCR and all its copyright belong to GCR. You can download the code for reference only but not able to be commercial without a fees.starLiGHT.Engine: starLiGHT.Engine is a set of libraries for indie game developers using XNA. It is in development for some years now as a closed source project. Now I will release some (most) parts as Open Source (dual licensing).UMC? ???? .NET ??? ?? ???? ???: ???(Junil, Um)? ???? .NET ???? ?? ?? ???? ??? ???.University of Ottawa tour for WP7: This is a Windows Phone 7 tour guide app for the University of Ottawa. vutpp for VS2010: C++ UnitTest Gui Addin????: ????

    Read the article

  • News about Oracle Documaker Enterprise Edition

    - by Susanne Hale
    Updates come from the Documaker front on two counts: Oracle Documaker Awarded XCelent Award for Best Functionality Celent has published a NEW report entitled Document Automation Solution Vendors for Insurers 2011. In the evaluation, Oracle received the XCelent award for Functionality, which recognizes solutions as the leader in this category of the evaluation. According to Celent, “Insurers need to address issues related to the creation and handling of all sorts of documents. Key issues in document creation are complexity and volume. Today, most document automation vendors provide an array of features to cope with the complexity and volume of documents insurers need to generate.” The report ranks ten solution providers on Technology, Functionality, Market Penetration, and Services. Each profile provides detailed information about the vendor and its document automation system, the professional services and support staff it offers, product features, insurance customers and reference feedback, its technology, implementation process, and pricing.  A summary of the report is available at Celent’s web site. Documaker User Group in Wisconsin Holds First Meeting Oracle Documaker users in Wisconsin made the first Documaker User Group meeting a great success, with representation from eight companies. On April 19, over 25 attendees got together to share information, best practices, experiences and concepts related to Documaker and enterprise document automation; they were also able to share feedback with Documaker product management. One insurer shared how they publish and deliver documents to both internal and external customers as quickly and cost effectively as possible, since providing point of sale documents to the sales force in real time is crucial to obtaining and maintaining the book of business. They outlined best practices that ensure consistent development and testing strategies processes are in place to maximize performance and reliability. And, they gave an overview of the supporting applications they developed to monitor and improve performance as well as monitor and track each transaction. Wisconsin User Group meeting photos are posted on the Oracle Insurance Facebook page http://www.facebook.com/OracleInsurance. The Wisconsin User Group will meet again on October 26. If you and other Documaker customers in your area are interested in setting up a user group in your area, please contact Susanne Hale ([email protected]), (703) 927-0863.

    Read the article

  • Creating an email notification system based on polling database rows

    - by Ashish Sharma
    I have to design an email notification system based on the following requirements: The email notifications would be created based on polling rows in a Mysql 5.5 DB table when they are in a particular 'Completed' state. The email notification should be sent out in no more than 5 minutes from the time the row was created in the DB table (At the time of DB table row creation the state of the row might not be 'Completed'). Once 5 minutes for the DB table row expire in reaching the 'Completed' state, separate email notification need to be sent (basically telling the user that the original email notification would be delayed) and then sending the email notification as and when the row state reaches to being 'Completed'. The rest of the system requirements are : Adding relevant checks to monitor the whole system via MBeans interface. The system should be scalable so that if the rate of DB table rows creation increases so does the Email notification system be able to ramp up. So I request suggestions on following lines: What approach should I take in solving the problem described from a programming/Design pattern point of view? Suggestion for any third party plugin/software that can be used to solve the problem described? Points to take care regarding scalability and monitoring the health of the system? Java is the language of preference but I am open to using off the shelf components that can be interfaced with Java language or provide standard ports for communication. Currently I do have an in house grown system (written in Java) that is catering to the specified requirements, but it's now crumbling under increased load and now I want to give the problem a fresh look. thanks in advance Ashish

    Read the article

  • Teaching high school kids ASP.NET programming

    - by dotneteer
    During the 2011 Microsoft MVP Global Summit, I have been talking to people about teaching kids ASP.NET programming. I want to work with volunteer organizations to provide kids volunteer opportunities while learning technical skills that can be applied elsewhere. The goal is to teach motivated kids enough skill to be productive with no more than 6 hours of instruction. Based on my prior teaching experience of college extension courses and involvement with high school math and science competitions, I think this is quite doable with classic ASP but a challenge with ASP.NET. I don’t want to use ASP because it does not provide a good path into the future. After some considerations, I think this is possible with ASP.NET and here are my thoughts: · Create a framework within ASP.NET for kids programming. · Use existing editor. No extra compiler and intelligence work needed. · Using a subset of C# like a scripting language. Teaches data type, expression, statements, if/for/while/switch blocks and functions. Use existing classes but no class creation and OOP. · Linear rendering model. No complicated life cycle. · Bare-metal html with some MVC style helpers for widget creation; ASP.NET control is optional. I want to teach kids to understand something and avoid black boxes as much as possible. · Use SQL for CRUD with a helper class. Again, I want to teach understanding rather than black boxes. · Provide a template to encourage clean separation of concern. · Provide a conversion utility to convert the code that uses template to ASP.NET MVC. This will allow kids with AP Computer Science knowledge to step up to ASP.NET MVC. Let me know if you have thoughts or can help.

    Read the article

  • OFM 11g: Implementing OAM SSO with Forms

    - by olaf.heimburger
    There is some confusion about the integration of OFM 11g Forms with Oracle Access Manager 11g (OAM). Some say this does not work, some say it works, but.... Actually, having implemented it many times I belong to the later group. Here is how. Caveat Before you start installing anything, take a step back and consider your current implementation and what you really need and want to achieve. The current integration of Forms 11g with OAM 11g does not support self-service account creation and password resets from the Forms application. If you really need this, you must use the existing Oracle AS 10.1.4.3 infrastructure. On the other hand, if your user population is pretty stable, you can enjoy the latest Forms 11g with OAM 11g. Assumptions The whole process should be done in one day. I assume that all domains and instances are started during setup, if you need to restart them on demand or purpose, be sure to have proper start/stop scripts, I don't mention them. Preparation It goes without saying, that you always should do a proper backup before you change anything on your production environment. With proper backup, I also mean a tested and verified restore process. If you dared to test it before, do it now. It pays off. Requirements For OAM 11g to work properly you need a LDAP repository. For the integration of Forms 11g you need an Oracle Internet Directory (OID) configured with the Oracle AS SSO LDAP extensions. For better support I usually give the latest version a try, in this case OID 11g is a good choice.During the Installation and Integration steps we use an upgrade wizard that needs the old OID configuration on the same host but in a different ORACLE_HOME. Installation vs Configuration With OFM 11g Oracle introduced a clear separation between Installation of the binaries (the software) and the Configuration of the instances (the runtime). This is really great as you can install all the software and create new instances when needed. In the following we adhere to this scheme and install the software first and then configure the instances later. Installation Steps The Oracle documentation contains all the necessary steps for the installation of all pieces of software. But some hints help to avoid traps and pitfalls. Step 1 The Database Start the installation with the database. It is quite obvious but we need an Oracle database for all the other steps. If you have one at hand, fine. If not, just install at least a Oracle 10.2.0.4 version. This database can be on a different host. Step 2 The Repository Creation Utility The next step should be to run the Repository Creation Utility (RCU). This is a client application that just needs to connect to your database. It can be run on any host that can reach the database and is a Windows or Linux 32-bit machine. When you run it, be sure to install the OID schema and the OAM schema. If you miss one of these, you can run the RCU again to install the missing schema. Step 3 The Foundation With OFM 11g Oracle started to use WebLogic Server 11g (WLS) as its foundation for all OFM 11g installation. We therefore install it first. Depending on your operating system, it might be possible, that no native installer is available. My approach to this dilemma is to use the WLS Generic Installer for all my installations. It does not include a JDK either but if you have both for your platform you are ready to go. Step 3a The JDK To make things interesting, Oracle currently has two JDKs in its portfolio. The Sun JDK and the JRockit JDK. Both are available for a number of platforms. If you are lucky and both are available for your platform, install both in a separate directory (and not one of your ORACLE_HOMEs) each, You can use the later as you like. Step 3b Install WLS for OID and OAM With the JDK installed, we start the generic installer with java -jar wls_generic.jar.STOP! Before you do this, check the version first. It should be 1.6.0_18 or later and not the GCC one (Some Linux distros have it installed by default). To verify the version, issue a java -version command and make sure that the output does not contain the text gcj and the version matches. If this does not work, use an absolute path like /opt/java/jdk1.6.0_23/bin/java to start the installer. The installer allows you to specify a path to install the software into, say /opt/oracle/iam/11.1.1.3 for the OID and OAM installation. We will call this IAM_HOME. Step 4 Install OID Now we are ready to install OID. Start the OID installer (in the Disk1 directory) and just select the installation only step. This will install the software only and does not configure the instance. Use the IAM_HOME as the target directory. Step 5 Install SOA Suite The IAM 11g Suite uses the BPEL component of the SOA Suite 11g for its workflows. This is a pretty closed environment and not to be used for SCA Composites. We install the SOA Suite in $IAM_HOME/soa. The installer only installs the binaries. Configuration will be done later. Step 6 Install OAM Once the installation of OID and SOA is done, we are ready to install the OAM software in the same IAM_HOME. Make sure to install the OAM binaries in a directory different from the one you used during the OID and SOA installation. As before, we only install the software, the instance will be created later. Step 7 Backup the Installation At this point, I normally do a backup (or snapshot in a virtual image) of the installation. Good when you need to go back to this point. Step 8 Configure OID The software is installed and now we need instances to run it. This process is called configuration. For OID use the config.sh found in $IAM_HOME/oid/bin to start the configuration wizard. Normally this runs smoothly. If you encounter some issues check the Oracle Support site for help. This configuration will also start the OID instance. Step 9 Install the Oracle AS SSO Schema Before we install the Forms software we need to install the Oracle AS SSO Schema into the database and OID. This is a rather dangerous procedure, but fully documented in the IAM Installation Guide, Chapter 10. You should finish this in one go, do not reboot your host during the whole procedure. As a precaution, you should make a backup of the OID instance before you start the procedure. Once the backup is ready, read the chapter, including every note, carefully. You can avoid a number of issues by following all the steps and will succeed with a working solution. Step 10 Configure OAM Reached this step? Great. You are ready to create an OAM instance. Use the $IAM_HOME/iam/common/binconfig.sh for this. This will open the WLS Domain Creation Wizard and asks for the libraries to be installed. You should at least select the OAM with Database repository item. The configuration will also start the OAM instance. Step 11 Install WLS for Forms 11g It is quite tempting to install everything in one ORACLE_HOME. Unfortunately this does not work for all OFM packages. Therefore we do another WLS installation in another ORACLE_HOME. The same considerations as in step 3b apply. We call this one FORMS_HOME. Step 12 Install Forms In the FORMS_HOME we now install the binaries for the Forms 11g software. Again, this is a install only step. Configuration starts with the next step. Step 13 Configure Forms To configure Forms 11g we start the Configuration Wizard (config.sh) in FORMS_HOME/bin. This wizard should create a new WebLogic Domain and an OHS instance! Do not extend existing domains or instances! Forms should run in its own instances! When all information is supplied, the wizard will create the domain and instance and starts them automatically.Step 14 Setup your Forms SSO EnvironmentOnce you have implemented and tested your Forms 11g instance, you can configured it for SSO. Yes, this requires the old Oracle AS SSO solution, OIDDAS for creating and assigning users and SSO to setup your partner applications. In this step you should consider to create every user necessary for use within the environment. When done, do not forget to test it. Step 15 Migrate the SSO Repository Since the final goal is to get rid of the old SSO implementation we need to migrate the old SSO repository into the new OID structure. Additionally, this step will also migrate all partner application configurations into OAM 11g. Quite convenient. To do this step, you have to start the upgrade agent (ua or ua.bat or ua.cmd) on the operating system level in $IAM_HOME/bin. Once finished, this wizard will create new osso.conf files for each partner application in $IAM_HOME/upgrade/temp/oam/.Note: At the time of this writing, this step only works if everything is on the same host (ie. OID, OAM, etc.). This restriction might be lifted in later releases. Step 16 Change your OHS sso.conf and shut down OC4J_SECURITY In Step 14 we verified that SSO for our Forms environment works fine. Now, we are shutting the old system done and reconfigure the OHS that acts as the Forms entry point. First we go to the OHS configuration directory and rename the old osso.conf  to osso.conf.10g. Now we change the moduleconf/mod_osso.conf  to point to the new osso.conf file. Copy the new osso.conf  file from $IAM_HOME/upgrade/temp/oam/ to the OHS configuration directory. Restart OHS, test forms by using the same forms links. OAM should now kick in and show the login dialog to ask for your user credentials.Done. Now your Forms environment is successfully integrated with OAM 11g.Enjoy. What's Next? This rather lengthy setup is just the foundation for your growing environment of OAM 11g protections. In the next entry we will show that Forms 11g and ADF Faces 11g can use the same OAM installation and provide real single sign-on. References Nearly everything is documented. Use the documentation! Oracle® Fusion Middleware Installation Guide for Oracle Identity Management 11gR1 Oracle® Fusion Middleware Installation Guide for Oracle Identity Management 11gR1, Chapter 11-14 Oracle® Fusion Middleware Administrator's Guide for Oracle Access Manager 11gR1, Appendix B Oracle® Fusion Middleware Upgrade Guide for Oracle Identity Management 11gR1, Chapter 10   

    Read the article

  • 256 Windows Azure Worker Roles, Windows Kinect and a 90's Text-Based Ray-Tracer

    - by Alan Smith
    For a couple of years I have been demoing a simple render farm hosted in Windows Azure using worker roles and the Azure Storage service. At the start of the presentation I deploy an Azure application that uses 16 worker roles to render a 1,500 frame 3D ray-traced animation. At the end of the presentation, when the animation was complete, I would play the animation delete the Azure deployment. The standing joke with the audience was that it was that it was a “$2 demo”, as the compute charges for running the 16 instances for an hour was $1.92, factor in the bandwidth charges and it’s a couple of dollars. The point of the demo is that it highlights one of the great benefits of cloud computing, you pay for what you use, and if you need massive compute power for a short period of time using Windows Azure can work out very cost effective. The “$2 demo” was great for presenting at user groups and conferences in that it could be deployed to Azure, used to render an animation, and then removed in a one hour session. I have always had the idea of doing something a bit more impressive with the demo, and scaling it from a “$2 demo” to a “$30 demo”. The challenge was to create a visually appealing animation in high definition format and keep the demo time down to one hour.  This article will take a run through how I achieved this. Ray Tracing Ray tracing, a technique for generating high quality photorealistic images, gained popularity in the 90’s with companies like Pixar creating feature length computer animations, and also the emergence of shareware text-based ray tracers that could run on a home PC. In order to render a ray traced image, the ray of light that would pass from the view point must be tracked until it intersects with an object. At the intersection, the color, reflectiveness, transparency, and refractive index of the object are used to calculate if the ray will be reflected or refracted. Each pixel may require thousands of calculations to determine what color it will be in the rendered image. Pin-Board Toys Having very little artistic talent and a basic understanding of maths I decided to focus on an animation that could be modeled fairly easily and would look visually impressive. I’ve always liked the pin-board desktop toys that become popular in the 80’s and when I was working as a 3D animator back in the 90’s I always had the idea of creating a 3D ray-traced animation of a pin-board, but never found the energy to do it. Even if I had a go at it, the render time to produce an animation that would look respectable on a 486 would have been measured in months. PolyRay Back in 1995 I landed my first real job, after spending three years being a beach-ski-climbing-paragliding-bum, and was employed to create 3D ray-traced animations for a CD-ROM that school kids would use to learn physics. I had got into the strange and wonderful world of text-based ray tracing, and was using a shareware ray-tracer called PolyRay. PolyRay takes a text file describing a scene as input and, after a few hours processing on a 486, produced a high quality ray-traced image. The following is an example of a basic PolyRay scene file. background Midnight_Blue   static define matte surface { ambient 0.1 diffuse 0.7 } define matte_white texture { matte { color white } } define matte_black texture { matte { color dark_slate_gray } } define position_cylindrical 3 define lookup_sawtooth 1 define light_wood <0.6, 0.24, 0.1> define median_wood <0.3, 0.12, 0.03> define dark_wood <0.05, 0.01, 0.005>     define wooden texture { noise surface { ambient 0.2  diffuse 0.7  specular white, 0.5 microfacet Reitz 10 position_fn position_cylindrical position_scale 1  lookup_fn lookup_sawtooth octaves 1 turbulence 1 color_map( [0.0, 0.2, light_wood, light_wood] [0.2, 0.3, light_wood, median_wood] [0.3, 0.4, median_wood, light_wood] [0.4, 0.7, light_wood, light_wood] [0.7, 0.8, light_wood, median_wood] [0.8, 0.9, median_wood, light_wood] [0.9, 1.0, light_wood, dark_wood]) } } define glass texture { surface { ambient 0 diffuse 0 specular 0.2 reflection white, 0.1 transmission white, 1, 1.5 }} define shiny surface { ambient 0.1 diffuse 0.6 specular white, 0.6 microfacet Phong 7  } define steely_blue texture { shiny { color black } } define chrome texture { surface { color white ambient 0.0 diffuse 0.2 specular 0.4 microfacet Phong 10 reflection 0.8 } }   viewpoint {     from <4.000, -1.000, 1.000> at <0.000, 0.000, 0.000> up <0, 1, 0> angle 60     resolution 640, 480 aspect 1.6 image_format 0 }       light <-10, 30, 20> light <-10, 30, -20>   object { disc <0, -2, 0>, <0, 1, 0>, 30 wooden }   object { sphere <0.000, 0.000, 0.000>, 1.00 chrome } object { cylinder <0.000, 0.000, 0.000>, <0.000, 0.000, -4.000>, 0.50 chrome }   After setting up the background and defining colors and textures, the viewpoint is specified. The “camera” is located at a point in 3D space, and it looks towards another point. The angle, image resolution, and aspect ratio are specified. Two lights are present in the image at defined coordinates. The three objects in the image are a wooden disc to represent a table top, and a sphere and cylinder that intersect to form a pin that will be used for the pin board toy in the final animation. When the image is rendered, the following image is produced. The pins are modeled with a chrome surface, so they reflect the environment around them. Note that the scale of the pin shaft is not correct, this will be fixed later. Modeling the Pin Board The frame of the pin-board is made up of three boxes, and six cylinders, the front box is modeled using a clear, slightly reflective solid, with the same refractive index of glass. The other shapes are modeled as metal. object { box <-5.5, -1.5, 1>, <5.5, 5.5, 1.2> glass } object { box <-5.5, -1.5, -0.04>, <5.5, 5.5, -0.09> steely_blue } object { box <-5.5, -1.5, -0.52>, <5.5, 5.5, -0.59> steely_blue } object { cylinder <-5.2, -1.2, 1.4>, <-5.2, -1.2, -0.74>, 0.2 steely_blue } object { cylinder <5.2, -1.2, 1.4>, <5.2, -1.2, -0.74>, 0.2 steely_blue } object { cylinder <-5.2, 5.2, 1.4>, <-5.2, 5.2, -0.74>, 0.2 steely_blue } object { cylinder <5.2, 5.2, 1.4>, <5.2, 5.2, -0.74>, 0.2 steely_blue } object { cylinder <0, -1.2, 1.4>, <0, -1.2, -0.74>, 0.2 steely_blue } object { cylinder <0, 5.2, 1.4>, <0, 5.2, -0.74>, 0.2 steely_blue }   In order to create the matrix of pins that make up the pin board I used a basic console application with a few nested loops to create two intersecting matrixes of pins, which models the layout used in the pin boards. The resulting image is shown below. The pin board contains 11,481 pins, with the scene file containing 23,709 lines of code. For the complete animation 2,000 scene files will be created, which is over 47 million lines of code. Each pin in the pin-board will slide out a specific distance when an object is pressed into the back of the board. This is easily modeled by setting the Z coordinate of the pin to a specific value. In order to set all of the pins in the pin-board to the correct position, a bitmap image can be used. The position of the pin can be set based on the color of the pixel at the appropriate position in the image. When the Windows Azure logo is used to set the Z coordinate of the pins, the following image is generated. The challenge now was to make a cool animation. The Azure Logo is fine, but it is static. Using a normal video to animate the pins would not work; the colors in the video would not be the same as the depth of the objects from the camera. In order to simulate the pin board accurately a series of frames from a depth camera could be used. Windows Kinect The Kenect controllers for the X-Box 360 and Windows feature a depth camera. The Kinect SDK for Windows provides a programming interface for Kenect, providing easy access for .NET developers to the Kinect sensors. The Kinect Explorer provided with the Kinect SDK is a great starting point for exploring Kinect from a developers perspective. Both the X-Box 360 Kinect and the Windows Kinect will work with the Kinect SDK, the Windows Kinect is required for commercial applications, but the X-Box Kinect can be used for hobby projects. The Windows Kinect has the advantage of providing a mode to allow depth capture with objects closer to the camera, which makes for a more accurate depth image for setting the pin positions. Creating a Depth Field Animation The depth field animation used to set the positions of the pin in the pin board was created using a modified version of the Kinect Explorer sample application. In order to simulate the pin board accurately, a small section of the depth range from the depth sensor will be used. Any part of the object in front of the depth range will result in a white pixel; anything behind the depth range will be black. Within the depth range the pixels in the image will be set to RGB values from 0,0,0 to 255,255,255. A screen shot of the modified Kinect Explorer application is shown below. The Kinect Explorer sample application was modified to include slider controls that are used to set the depth range that forms the image from the depth stream. This allows the fine tuning of the depth image that is required for simulating the position of the pins in the pin board. The Kinect Explorer was also modified to record a series of images from the depth camera and save them as a sequence JPEG files that will be used to animate the pins in the animation the Start and Stop buttons are used to start and stop the image recording. En example of one of the depth images is shown below. Once a series of 2,000 depth images has been captured, the task of creating the animation can begin. Rendering a Test Frame In order to test the creation of frames and get an approximation of the time required to render each frame a test frame was rendered on-premise using PolyRay. The output of the rendering process is shown below. The test frame contained 23,629 primitive shapes, most of which are the spheres and cylinders that are used for the 11,800 or so pins in the pin board. The 1280x720 image contains 921,600 pixels, but as anti-aliasing was used the number of rays that were calculated was 4,235,777, with 3,478,754,073 object boundaries checked. The test frame of the pin board with the depth field image applied is shown below. The tracing time for the test frame was 4 minutes 27 seconds, which means rendering the2,000 frames in the animation would take over 148 hours, or a little over 6 days. Although this is much faster that an old 486, waiting almost a week to see the results of an animation would make it challenging for animators to create, view, and refine their animations. It would be much better if the animation could be rendered in less than one hour. Windows Azure Worker Roles The cost of creating an on-premise render farm to render animations increases in proportion to the number of servers. The table below shows the cost of servers for creating a render farm, assuming a cost of $500 per server. Number of Servers Cost 1 $500 16 $8,000 256 $128,000   As well as the cost of the servers, there would be additional costs for networking, racks etc. Hosting an environment of 256 servers on-premise would require a server room with cooling, and some pretty hefty power cabling. The Windows Azure compute services provide worker roles, which are ideal for performing processor intensive compute tasks. With the scalability available in Windows Azure a job that takes 256 hours to complete could be perfumed using different numbers of worker roles. The time and cost of using 1, 16 or 256 worker roles is shown below. Number of Worker Roles Render Time Cost 1 256 hours $30.72 16 16 hours $30.72 256 1 hour $30.72   Using worker roles in Windows Azure provides the same cost for the 256 hour job, irrespective of the number of worker roles used. Provided the compute task can be broken down into many small units, and the worker role compute power can be used effectively, it makes sense to scale the application so that the task is completed quickly, making the results available in a timely fashion. The task of rendering 2,000 frames in an animation is one that can easily be broken down into 2,000 individual pieces, which can be performed by a number of worker roles. Creating a Render Farm in Windows Azure The architecture of the render farm is shown in the following diagram. The render farm is a hybrid application with the following components: ·         On-Premise o   Windows Kinect – Used combined with the Kinect Explorer to create a stream of depth images. o   Animation Creator – This application uses the depth images from the Kinect sensor to create scene description files for PolyRay. These files are then uploaded to the jobs blob container, and job messages added to the jobs queue. o   Process Monitor – This application queries the role instance lifecycle table and displays statistics about the render farm environment and render process. o   Image Downloader – This application polls the image queue and downloads the rendered animation files once they are complete. ·         Windows Azure o   Azure Storage – Queues and blobs are used for the scene description files and completed frames. A table is used to store the statistics about the rendering environment.   The architecture of each worker role is shown below.   The worker role is configured to use local storage, which provides file storage on the worker role instance that can be use by the applications to render the image and transform the format of the image. The service definition for the worker role with the local storage configuration highlighted is shown below. <?xml version="1.0" encoding="utf-8"?> <ServiceDefinition name="CloudRay" >   <WorkerRole name="CloudRayWorkerRole" vmsize="Small">     <Imports>     </Imports>     <ConfigurationSettings>       <Setting name="DataConnectionString" />     </ConfigurationSettings>     <LocalResources>       <LocalStorage name="RayFolder" cleanOnRoleRecycle="true" />     </LocalResources>   </WorkerRole> </ServiceDefinition>     The two executable programs, PolyRay.exe and DTA.exe are included in the Azure project, with Copy Always set as the property. PolyRay will take the scene description file and render it to a Truevision TGA file. As the TGA format has not seen much use since the mid 90’s it is converted to a JPG image using Dave's Targa Animator, another shareware application from the 90’s. Each worker roll will use the following process to render the animation frames. 1.       The worker process polls the job queue, if a job is available the scene description file is downloaded from blob storage to local storage. 2.       PolyRay.exe is started in a process with the appropriate command line arguments to render the image as a TGA file. 3.       DTA.exe is started in a process with the appropriate command line arguments convert the TGA file to a JPG file. 4.       The JPG file is uploaded from local storage to the images blob container. 5.       A message is placed on the images queue to indicate a new image is available for download. 6.       The job message is deleted from the job queue. 7.       The role instance lifecycle table is updated with statistics on the number of frames rendered by the worker role instance, and the CPU time used. The code for this is shown below. public override void Run() {     // Set environment variables     string polyRayPath = Path.Combine(Environment.GetEnvironmentVariable("RoleRoot"), PolyRayLocation);     string dtaPath = Path.Combine(Environment.GetEnvironmentVariable("RoleRoot"), DTALocation);       LocalResource rayStorage = RoleEnvironment.GetLocalResource("RayFolder");     string localStorageRootPath = rayStorage.RootPath;       JobQueue jobQueue = new JobQueue("renderjobs");     JobQueue downloadQueue = new JobQueue("renderimagedownloadjobs");     CloudRayBlob sceneBlob = new CloudRayBlob("scenes");     CloudRayBlob imageBlob = new CloudRayBlob("images");     RoleLifecycleDataSource roleLifecycleDataSource = new RoleLifecycleDataSource();       Frames = 0;       while (true)     {         // Get the render job from the queue         CloudQueueMessage jobMsg = jobQueue.Get();           if (jobMsg != null)         {             // Get the file details             string sceneFile = jobMsg.AsString;             string tgaFile = sceneFile.Replace(".pi", ".tga");             string jpgFile = sceneFile.Replace(".pi", ".jpg");               string sceneFilePath = Path.Combine(localStorageRootPath, sceneFile);             string tgaFilePath = Path.Combine(localStorageRootPath, tgaFile);             string jpgFilePath = Path.Combine(localStorageRootPath, jpgFile);               // Copy the scene file to local storage             sceneBlob.DownloadFile(sceneFilePath);               // Run the ray tracer.             string polyrayArguments =                 string.Format("\"{0}\" -o \"{1}\" -a 2", sceneFilePath, tgaFilePath);             Process polyRayProcess = new Process();             polyRayProcess.StartInfo.FileName =                 Path.Combine(Environment.GetEnvironmentVariable("RoleRoot"), polyRayPath);             polyRayProcess.StartInfo.Arguments = polyrayArguments;             polyRayProcess.Start();             polyRayProcess.WaitForExit();               // Convert the image             string dtaArguments =                 string.Format(" {0} /FJ /P{1}", tgaFilePath, Path.GetDirectoryName (jpgFilePath));             Process dtaProcess = new Process();             dtaProcess.StartInfo.FileName =                 Path.Combine(Environment.GetEnvironmentVariable("RoleRoot"), dtaPath);             dtaProcess.StartInfo.Arguments = dtaArguments;             dtaProcess.Start();             dtaProcess.WaitForExit();               // Upload the image to blob storage             imageBlob.UploadFile(jpgFilePath);               // Add a download job.             downloadQueue.Add(jpgFile);               // Delete the render job message             jobQueue.Delete(jobMsg);               Frames++;         }         else         {             Thread.Sleep(1000);         }           // Log the worker role activity.         roleLifecycleDataSource.Alive             ("CloudRayWorker", RoleLifecycleDataSource.RoleLifecycleId, Frames);     } }     Monitoring Worker Role Instance Lifecycle In order to get more accurate statistics about the lifecycle of the worker role instances used to render the animation data was tracked in an Azure storage table. The following class was used to track the worker role lifecycles in Azure storage.   public class RoleLifecycle : TableServiceEntity {     public string ServerName { get; set; }     public string Status { get; set; }     public DateTime StartTime { get; set; }     public DateTime EndTime { get; set; }     public long SecondsRunning { get; set; }     public DateTime LastActiveTime { get; set; }     public int Frames { get; set; }     public string Comment { get; set; }       public RoleLifecycle()     {     }       public RoleLifecycle(string roleName)     {         PartitionKey = roleName;         RowKey = Utils.GetAscendingRowKey();         Status = "Started";         StartTime = DateTime.UtcNow;         LastActiveTime = StartTime;         EndTime = StartTime;         SecondsRunning = 0;         Frames = 0;     } }     A new instance of this class is created and added to the storage table when the role starts. It is then updated each time the worker renders a frame to record the total number of frames rendered and the total processing time. These statistics are used be the monitoring application to determine the effectiveness of use of resources in the render farm. Rendering the Animation The Azure solution was deployed to Windows Azure with the service configuration set to 16 worker role instances. This allows for the application to be tested in the cloud environment, and the performance of the application determined. When I demo the application at conferences and user groups I often start with 16 instances, and then scale up the application to the full 256 instances. The configuration to run 16 instances is shown below. <?xml version="1.0" encoding="utf-8"?> <ServiceConfiguration serviceName="CloudRay" xmlns="http://schemas.microsoft.com/ServiceHosting/2008/10/ServiceConfiguration" osFamily="1" osVersion="*">   <Role name="CloudRayWorkerRole">     <Instances count="16" />     <ConfigurationSettings>       <Setting name="DataConnectionString"         value="DefaultEndpointsProtocol=https;AccountName=cloudraydata;AccountKey=..." />     </ConfigurationSettings>   </Role> </ServiceConfiguration>     About six minutes after deploying the application the first worker roles become active and start to render the first frames of the animation. The CloudRay Monitor application displays an icon for each worker role instance, with a number indicating the number of frames that the worker role has rendered. The statistics on the left show the number of active worker roles and statistics about the render process. The render time is the time since the first worker role became active; the CPU time is the total amount of processing time used by all worker role instances to render the frames.   Five minutes after the first worker role became active the last of the 16 worker roles activated. By this time the first seven worker roles had each rendered one frame of the animation.   With 16 worker roles u and running it can be seen that one hour and 45 minutes CPU time has been used to render 32 frames with a render time of just under 10 minutes.     At this rate it would take over 10 hours to render the 2,000 frames of the full animation. In order to complete the animation in under an hour more processing power will be required. Scaling the render farm from 16 instances to 256 instances is easy using the new management portal. The slider is set to 256 instances, and the configuration saved. We do not need to re-deploy the application, and the 16 instances that are up and running will not be affected. Alternatively, the configuration file for the Azure service could be modified to specify 256 instances.   <?xml version="1.0" encoding="utf-8"?> <ServiceConfiguration serviceName="CloudRay" xmlns="http://schemas.microsoft.com/ServiceHosting/2008/10/ServiceConfiguration" osFamily="1" osVersion="*">   <Role name="CloudRayWorkerRole">     <Instances count="256" />     <ConfigurationSettings>       <Setting name="DataConnectionString"         value="DefaultEndpointsProtocol=https;AccountName=cloudraydata;AccountKey=..." />     </ConfigurationSettings>   </Role> </ServiceConfiguration>     Six minutes after the new configuration has been applied 75 new worker roles have activated and are processing their first frames.   Five minutes later the full configuration of 256 worker roles is up and running. We can see that the average rate of frame rendering has increased from 3 to 12 frames per minute, and that over 17 hours of CPU time has been utilized in 23 minutes. In this test the time to provision 140 worker roles was about 11 minutes, which works out at about one every five seconds.   We are now half way through the rendering, with 1,000 frames complete. This has utilized just under three days of CPU time in a little over 35 minutes.   The animation is now complete, with 2,000 frames rendered in a little over 52 minutes. The CPU time used by the 256 worker roles is 6 days, 7 hours and 22 minutes with an average frame rate of 38 frames per minute. The rendering of the last 1,000 frames took 16 minutes 27 seconds, which works out at a rendering rate of 60 frames per minute. The frame counts in the server instances indicate that the use of a queue to distribute the workload has been very effective in distributing the load across the 256 worker role instances. The first 16 instances that were deployed first have rendered between 11 and 13 frames each, whilst the 240 instances that were added when the application was scaled have rendered between 6 and 9 frames each.   Completed Animation I’ve uploaded the completed animation to YouTube, a low resolution preview is shown below. Pin Board Animation Created using Windows Kinect and 256 Windows Azure Worker Roles   The animation can be viewed in 1280x720 resolution at the following link: http://www.youtube.com/watch?v=n5jy6bvSxWc Effective Use of Resources According to the CloudRay monitor statistics the animation took 6 days, 7 hours and 22 minutes CPU to render, this works out at 152 hours of compute time, rounded up to the nearest hour. As the usage for the worker role instances are billed for the full hour, it may have been possible to render the animation using fewer than 256 worker roles. When deciding the optimal usage of resources, the time required to provision and start the worker roles must also be considered. In the demo I started with 16 worker roles, and then scaled the application to 256 worker roles. It would have been more optimal to start the application with maybe 200 worker roles, and utilized the full hour that I was being billed for. This would, however, have prevented showing the ease of scalability of the application. The new management portal displays the CPU usage across the worker roles in the deployment. The average CPU usage across all instances is 93.27%, with over 99% used when all the instances are up and running. This shows that the worker role resources are being used very effectively. Grid Computing Scenarios Although I am using this scenario for a hobby project, there are many scenarios where a large amount of compute power is required for a short period of time. Windows Azure provides a great platform for developing these types of grid computing applications, and can work out very cost effective. ·         Windows Azure can provide massive compute power, on demand, in a matter of minutes. ·         The use of queues to manage the load balancing of jobs between role instances is a simple and effective solution. ·         Using a cloud-computing platform like Windows Azure allows proof-of-concept scenarios to be tested and evaluated on a very low budget. ·         No charges for inbound data transfer makes the uploading of large data sets to Windows Azure Storage services cost effective. (Transaction charges still apply.) Tips for using Windows Azure for Grid Computing Scenarios I found the implementation of a render farm using Windows Azure a fairly simple scenario to implement. I was impressed by ease of scalability that Azure provides, and by the short time that the application took to scale from 16 to 256 worker role instances. In this case it was around 13 minutes, in other tests it took between 10 and 20 minutes. The following tips may be useful when implementing a grid computing project in Windows Azure. ·         Using an Azure Storage queue to load-balance the units of work across multiple worker roles is simple and very effective. The design I have used in this scenario could easily scale to many thousands of worker role instances. ·         Windows Azure accounts are typically limited to 20 cores. If you need to use more than this, a call to support and a credit card check will be required. ·         Be aware of how the billing model works. You will be charged for worker role instances for the full clock our in which the instance is deployed. Schedule the workload to start just after the clock hour has started. ·         Monitor the utilization of the resources you are provisioning, ensure that you are not paying for worker roles that are idle. ·         If you are deploying third party applications to worker roles, you may well run into licensing issues. Purchasing software licenses on a per-processor basis when using hundreds of processors for a short time period would not be cost effective. ·         Third party software may also require installation onto the worker roles, which can be accomplished using start-up tasks. Bear in mind that adding a startup task and possible re-boot will add to the time required for the worker role instance to start and activate. An alternative may be to use a prepared VM and use VM roles. ·         Consider using the Windows Azure Autoscaling Application Block (WASABi) to autoscale the worker roles in your application. When using a large number of worker roles, the utilization must be carefully monitored, if the scaling algorithms are not optimal it could get very expensive!

    Read the article

  • Oracle IRM video demonstration of seperating duties of document security

    - by Simon Thorpe
    One thing an Information Rights Management technology should do well is separate out three main areas of responsibility.The business process of defining and controlling the classifications to which content is secured and the definition of the roles employees, customers, partners and contractors have when accessing secured content. Allow IT to manage the server and perform the role of authorizing the creation of new classifications to meet business needs but yet once the classification has been created and handed off to the business, IT no longer plays a role on the ongoing management. Empower the business to take ownership of classifications to which their own content is secured. For example an employee who is leading an acquisition project should be responsible for defining who has access to confidential project documents. This person should be able to manage the rights users have in the classification and also be the point of contact for those wishing to gain rights. Oracle IRM has since it's creation in the late 1990's had this core model at the heart of its design. Due in part to the important seperation of rights from the documents themselves, Oracle IRM places the right functionality within the right parts of the business. For example some IRM technologies allow the end user to make decisions about what users can print, edit or save a secured document. This in practice results in a wide variety of content secured with a plethora of options that don't conform to any policy. With Oracle IRM users choose from a list of classifications to which they have been given the ability to secure information against. Their role in the classification was given to them by the business owner of the classification, yet the definition of the role resides within the realm of corporate security who own the overall business classification policies. It is this type of design and philosophy in Oracle IRM that makes it an enterprise solution that works beyond a few users and a few secured documents to hundreds of thousands of users and millions of documents. This following video shows how Oracle IRM 11g, the market leading document security solution, lets the security organization manage and create classifications whilst the business owns and manages them. If you want to experience using Oracle IRM secured content and the effects of different roles users have, why not sign up for our free demonstration.

    Read the article

  • "Failed to create swap space" error during installation

    - by Welsh Heron
    I've been trying to install Ubuntu for the past two days or so, but I've been running into a problem: every time I run the installation program on the LiveCD, I always get the same (or a very similar) error: "Failed to create Swap space The creation of swap space in partition #3 of SCSI5 (0,0,0)(sda) failed." So far, I've run DBAN (Darik's Boot and Nuke) on my HDD once, to make absolutely sure that everything on it had been erased. Then, I simply put in the LiveCD, and let it run the automated install. I get the above error directly after I tell it to automatically partition the HDD (it will work for a second or so, then this will pop up), forcing me back to the screen that lets me choose whether I want to automatically or manually partition the HDD. Well, after failing to install the software manually, I did a little research and learned enough about partitioning Linux to use the 'Manual partitioning' option. I partitioned the HDD as follows (it's a 1TB drive): /home - (the rest)- ext2, / - 20GB - ext2, /boot - 100MB - ext2, /swap - 8GB /EFIboot - 40MB The only difference when I tried this method was that I got THIS message: "Failed to create Swap space The creation of swap space in partition #2 of SCSI5 (0,0,0)(sda) failed." Basically, the only difference was that there was now a '2' instead of a '3'. If I may ask, what exactly am I doing wrong? I've tried looking around the internet (that's basically all I've done for the last two days), but no one seems to have the same problem that I have, and I've tried most of the solutions for similar problems (DBAN, formatting partitions in ext2 format, etc). The only thing I haven't tried is using the terminal to manually partition the HDD...and I actually DID try to do this, but I wasn't able to get past 'su' 's password demand, so I wasn't able to use the terminal. Thank you for your help in advance. ~Welsh

    Read the article

  • array and array_view from amp.h

    - by Daniel Moth
    This is a very long post, but it also covers what are probably the classes (well, array_view at least) that you will use the most with C++ AMP, so I hope you enjoy it! Overview The concurrency::array and concurrency::array_view template classes represent multi-dimensional data of type T, of N dimensions, specified at compile time (and you can later access the number of dimensions via the rank property). If N is not specified, it is assumed that it is 1 (i.e. single-dimensional case). They are rectangular (not jagged). The difference between them is that array is a container of data, whereas array_view is a wrapper of a container of data. So in that respect, array behaves like an STL container, whereas the closest thing an array_view behaves like is an STL iterator (albeit with random access and allowing you to view more than one element at a time!). The data in the array (whether provided at creation time or added later) resides on an accelerator (which is specified at creation time either explicitly by the developer, or set to the default accelerator at creation time by the runtime) and is laid out contiguously in memory. The data provided to the array_view is not stored by/in the array_view, because the array_view is simply a view over the real source (which can reside on the CPU or other accelerator). The underlying data is copied on demand to wherever the array_view is accessed. Elements which differ by one in the least significant dimension of the array_view are adjacent in memory. array objects must be captured by reference into the lambda you pass to the parallel_for_each call, whereas array_view objects must be captured by value (into the lambda you pass to the parallel_for_each call). Creating array and array_view objects and relevant properties You can create array_view objects from other array_view objects of the same rank and element type (shallow copy, also possible via assignment operator) so they point to the same underlying data, and you can also create array_view objects over array objects of the same rank and element type e.g.   array_view<int,3> a(b); // b can be another array or array_view of ints with rank=3 Note: Unlike the constructors above which can be called anywhere, the ones in the rest of this section can only be called from CPU code. You can create array objects from other array objects of the same rank and element type (copy and move constructors) and from other array_view objects, e.g.   array<float,2> a(b); // b can be another array or array_view of floats with rank=2 To create an array from scratch, you need to at least specify an extent object, e.g. array<int,3> a(myExtent);. Note that instead of an explicit extent object, there are convenience overloads when N<=3 so you can specify 1-, 2-, 3- integers (dependent on the array's rank) and thus have the extent created for you under the covers. At any point, you can access the array's extent thought the extent property. The exact same thing applies to array_view (extent as constructor parameters, incl. convenience overloads, and property). While passing only an extent object to create an array is enough (it means that the array will be written to later), it is not enough for the array_view case which must always wrap over some other container (on which it relies for storage space and actual content). So in addition to the extent object (that describes the shape you'd like to be viewing/accessing that data through), to create an array_view from another container (e.g. std::vector) you must pass in the container itself (which must expose .data() and a .size() methods, e.g. like std::array does), e.g.   array_view<int,2> aaa(myExtent, myContainerOfInts); Similarly, you can create an array_view from a raw pointer of data plus an extent object. Back to the array case, to optionally initialize the array with data, you can pass an iterator pointing to the start (and optionally one pointing to the end of the source container) e.g.   array<double,1> a(5, myVector.begin(), myVector.end()); We saw that arrays are bound to an accelerator at creation time, so in case you don’t want the C++ AMP runtime to assign the array to the default accelerator, all array constructors have overloads that let you pass an accelerator_view object, which you can later access via the accelerator_view property. Note that at the point of initializing an array with data, a synchronous copy of the data takes place to the accelerator, and then to copy any data back we'll see that an explicit copy call is required. This does not happen with the array_view where copying is on demand... refresh and synchronize on array_view Note that in the previous section on constructors, unlike the array case, there was no overload that accepted an accelerator_view for array_view. That is because the array_view is simply a wrapper, so the allocation of the data has already taken place before you created the array_view. When you capture an array_view variable in your call to parallel_for_each, the copy of data between the non-CPU accelerator and the CPU takes place on demand (i.e. it is implicit, versus the explicit copy that has to happen with the array). There are some subtleties to the on-demand-copying that we cover next. The assumption when using an array_view is that you will continue to access the data through the array_view, and not through the original underlying source, e.g. the pointer to the data that you passed to the array_view's constructor. So if you modify the data through the array_view on the GPU, the original pointer on the CPU will not "know" that, unless one of two things happen: you access the data through the array_view on the CPU side, i.e. using indexing that we cover below you explicitly call the array_view's synchronize method on the CPU (this also gets called in the array_view's destructor for you) Conversely, if you make a change to the underlying data through the original source (e.g. the pointer), the array_view will not "know" about those changes, unless you call its refresh method. Finally, note that if you create an array_view of const T, then the data is copied to the accelerator on demand, but it does not get copied back, e.g.   array_view<const double, 5> myArrView(…); // myArrView will not get copied back from GPU There is also a similar mechanism to achieve the reverse, i.e. not to copy the data of an array_view to the GPU. copy_to, data, and global copy/copy_async functions Both array and array_view expose two copy_to overloads that allow copying them to another array, or to another array_view, and these operations can also be achieved with assignment (via the = operator overloads). Also both array and array_view expose a data method, to get a raw pointer to the underlying data of the array or array_view, e.g. float* f = myArr.data();. Note that for array_view, this only works when the rank is equal to 1, due to the data only being contiguous in one dimension as covered in the overview section. Finally, there are a bunch of global concurrency::copy functions returning void (and corresponding concurrency::copy_async functions returning a future) that allow copying between arrays and array_views and iterators etc. Just browse intellisense or amp.h directly for the full set. Note that for array, all copying described throughout this post is deep copying, as per other STL container expectations. You can never have two arrays point to the same data. indexing into array and array_view plus projection Reading or writing data elements of an array is only legal when the code executes on the same accelerator as where the array was bound to. In the array_view case, you can read/write on any accelerator, not just the one where the original data resides, and the data gets copied for you on demand. In both cases, the way you read and write individual elements is via indexing as described next. To access (or set the value of) an element, you can index into it by passing it an index object via the subscript operator. Furthermore, if the rank is 3 or less, you can use the function ( ) operator to pass integer values instead of having to use an index object. e.g. array<float,2> arr(someExtent, someIterator); //or array_view<float,2> arr(someExtent, someContainer); index<2> idx(5,4); float f1 = arr[idx]; float f2 = arr(5,4); //f2 ==f1 //and the reverse for assigning, e.g. arr(idx[0], 7) = 6.9; Note that for both array and array_view, regardless of rank, you can also pass a single integer to the subscript operator which results in a projection of the data, and (for both array and array_view) you get back an array_view of rank N-1 (or if the rank was 1, you get back just the element at that location). Not Covered In this already very long post, I am not going to cover three very cool methods (and related overloads) that both array and array_view expose: view_as, section, reinterpret_as. We'll revisit those at some point in the future, probably on the team blog. Comments about this post by Daniel Moth welcome at the original blog.

    Read the article

  • Oracle Delivers Special Recognition for Specialized Partners

    - by michaela.seika(at)oracle.com
    Since announcing Oracle PartnerNetwork Specialized (OPN Specialized) in October 2009, Oracle has been focused on building a program that first enables solution providers to become highly skilled Oracle partners who deliver value to customers and that then recognizes and rewards their achievements in a meaningful way. Today the company unveiled new benefits reserved for partners who have achieved one or more of the over 50 specializations currently available. The benefits demonstrate Oracle's commitment to showcase these valued partners to three key audiences: customers, other partners, and Oracle employees.With today's launch of www.oracle.com/specialized Oracle has taken what IDC believes is a first of its kind approach to putting top partners front and center with customers and prospects. While most vendors offer a business partner finder tool on their website none has gone as far as Oracle with the creation of this new site dedicated to the promotion of Specialized Partners. The tag lines - "Recognized by Oracle, Preferred by Customers" and "Specialized. Recognized. Preferred." gets right to the point - these are the solution providers with which customers should choose to engage. The contents of the page offer multiple proof points to justify the marketing phrases.One of the benefits Oracle offers its Specialized Partners is video creation and placement. While Oracle works with partners to create informal or "guerilla" videos which often are placed on YouTube to generate awareness and buzz, the company also produces professional videos for its partners. The greatest value the partner receives from this benefit isn't the non-trivial production costs that Oracle covers but instead the prominent exposure Oracle gives the finished product. Partner videos are featured on www.oracle.com/specialized, used as part of monthly OPN Specialized Partners monthly webcasts, placed on a customer facing website, the Oracle Media Network, which includes several partner sites such as PartnerCast. A solution provider gains a great deal of credibility when they can send a prospect to an Oracle website where they are featured. Read the full article here.

    Read the article

  • CodePlex Daily Summary for Monday, May 28, 2012

    CodePlex Daily Summary for Monday, May 28, 2012Popular ReleasesScreenShot: InstallScreenShot: This is the current stable release..Net Code Samples: Code Samples: Code samples (SLNs).LINQ_Koans: LinqKoans v.02: Cleaned up a bitKeelKit: KeelKit 3.0.7600.638: ?、??MySQL?Model?? Mysql ????? ? http://dev.mysql.com/downloads/connector/net/ ??? mysql-connector-net-6.5.4.msi ???, VS???KeelKit ???????MySQL , ????????? ?? DemoMySQL.rar ???, ???????????MySqL??Model. ?????? C:\Windows\Microsoft.NET\Framework\v4.0.30319\Config\machine.config ??? ??????。 <system.data> <DbProviderFactories> <add name="MySQL Data Provider" invariant="MySql.Data.MySqlClient" description=".Net Framework Data Provider for MySQL" type="MySql.Data.MySqlClient.MySqlC...TwitterOAuth: TwitterOauth 0.25.16.0116: Beta releasetesttom05242012git02: d1: d1testdd05242012git001: zxczxc: zxczxczxcCODE Framework: 4.0.20524.0: This release has quite a few enhancements for WPF applications and SOA features. See change logs for more details.CommonLibrary.NET: CommonLibrary.NET 0.9.8 - Final Release: A collection of very reusable code and components in C# 4.0 ranging from ActiveRecord, Csv, Command Line Parsing, Configuration, Holiday Calendars, Logging, Authentication, and much more. FluentscriptCommonLibrary.NET 0.9.8 contains a scripting language called FluentScript. Application: FluentScript Version: 0.9.8 Build: 0.9.8.4 Changeset: 75050 ( CommonLibrary.NET ) Release date: May 24, 2012 Binaries: CommonLibrary.dll Namespace: ComLib.Lang Project site: http://fluentscript.codeplex.com...System Center Orchestrator Integration Packs: Active Directory 3.2: An integration pack enabling AD Automation 3.2 Updates LDAP Pathing updated to support cross forest scenarios Get Object Property Value Filtering efficiency enhancementsBunch of Small Tools: Mélangeur de vocabulaire japonais: Permet de générer des exercices de vocabulaire aléatoire à partir de listes de vocabulaire japonais. 22 listes sont fournies avec le programme.Expression Tree Visualizer for VS 2010: Expression Tree Visualizer Beta: This is a beta release, in this release some expression types are not handled and use a default visualization behavior. The first release will be published soon. Wait for it...Ulfi: Ulfi source: Build with Visual Studio 2010 Express C# or betterJayData - The cross-platform HTML5 data-management library for JavaScript: JayData 1.0 RC1 Refresh 2: JayData is a unified data access library for JavaScript developers to query and update data from different sources like webSQL, indexedDB, OData, Facebook or YQL. See it in action in this 6 minutes video: http://www.youtube.com/watch?v=LlJHgj1y0CU RC1 R2 Release highlights Knockout.js integrationUsing the Knockout.js module, your UI can be automatically refreshed when the data model changes, so you can develop the front-end of your data manager app even faster. Querying 1:N relations in W...Christoc's DotNetNuke Module Development Template: 00.00.08 for DNN6: BEFORE USE YOU need to install the MSBuild Community Tasks available from http://msbuildtasks.tigris.org For best results you should configure your development environment as described in this blog post Then read this latest blog post about customizing and using these custom templates. Installation is simple To use this template place the ZIP (not extracted) file in your My Documents\Visual Studio 2010\Templates\ProjectTemplates\Visual C#\Web OR for VB My Documents\Visual Studio 2010\Te...Microsoft Ajax Minifier: Microsoft Ajax Minifier 4.53: fix issue #18106, where member operators on numeric literals caused the member part to be duplicated when not minifying numeric literals ADD NEW FEATURE: ability to create source map files! The first mapfile format to be supported is the Script# format. Use the new -map filename switch to create map files when building your sources.CreditAnalytics: CreditAnalytics Release 1.5: 22 May 2012 (v1.5) (Build 449) Regressor Framework: Implementation of the regressor set, tolerance check, curve scenario regressors, regression framework suite, and the eventual regression output. Discount Curve Regression: Regressing Base Curve Creation, scenario Curve creation, and calculation of spot/effective implied rates and discount factors. Credit Curve Regression: Regressing Base Curve Creation, scenario Curve creation, and calculation of spot/effective implied hazard rates, reco...BlackJumboDog: Ver5.6.3: 2012.05.22 Ver5.6.3  (1) HTTP????????、ftp://??????????????????????LogicCircuit: LogicCircuit 2.12.5.22: Logic Circuit - is educational software for designing and simulating logic circuits. Intuitive graphical user interface, allows you to create unrestricted circuit hierarchy with multi bit buses, debug circuits behavior with oscilloscope, and navigate running circuits hierarchy. Changes of this versionThis release is fixing start up issue.Orchard Project: Orchard 1.4.2: This is a service release to address 1.4 and 1.4.1 bugs. Please read our release notes for Orchard 1.4.2: http://docs.orchardproject.net/Documentation/Orchard-1-4-Release-NotesNew Projects.Net Code Samples: Various .Net code samples. AFSAspnetPusherV1: my new wns project lolAFSAspnetPusherV2: renewed version ofAFSAspnetPusherV4: renewed one v4AgileDesign Utilities Library: This library provides common functionality usable for most software projects: Logger - Asynchronous logging on top of new Microsoft logging class TraceSource with simplified API NameOf - Avoid using string names using static reflection Various reflection helpersAssociate Many to Many Relationship Entities Tool for Dynamics CRM 2011: Associate Many to many relationship tool is used for Dynamics CRM 2011 to associate or disassociate N:N relationship entities. This tool is dynamics crm 2011 solution, which consist of one entity and one plugin. Entity "Many to Many Relationship" record is used by Many to many relationship plugin to associate or disassociate entities. If many to many relationship entity record is created then plugin associate/disassociate entities from record data.Boxhead Multiplayer Server: A PHP dedicated server for my multiplayer version of Boxhead.CodedUITraceFiletoCSV: Console Application to parse the result file generated by Coded UI Test execution ".trx" into a comma separated file for more readable and detailed result.FlipExt: FlipExt is an easy to use image converter. It converts any image to .png .bmp .jpg .gif .tif .jpeg .tiff .ico. More extensions will be added soon.Foo Values Maker: Foo creates values for your test class variables so that you can write tests faster.FoodFree: Projeto de monitoramento de enchentesHouodeProject: ????ITLand of Dreams, Codename: Waterloo: We want to create a classical Live-MMORPG you can play on your smartphone (in the first step only “Windows Phone” will be supported) with the basic idea of Ultima Online or similiar games in our mind. You can create one or more characters, choose some name, gender, basic attributes (skin and hair color, …) a race (e.g. ‘Human’) and a profession (e.g. ‘fighter’ or ‘craftsman’). Now he can freely travel through the whole world, meeting other players, fighting monsters, absolving quests, tra...Makecert UI: Makecert UI is a shell layer application on top of the Microsoft makecert.exe utility. Makecert UI makes it easy for you to create self signed certificates, even from your own CA.MS CRM Rich Text box: Rich text box plug-in for MS CRM 2011. Hope it will be helpful for many of you. Thank you for using it and let me know if any further help needed.Nivo Slider Web Part SharePoint 2010: SharePoint 2010 implementation of Nivo Slider. Easy way to put Nivo slider on any page!!Office365 Weather WebPart: Office 365 WebPart that displays a 5 day weather forecast for a given location. The weather data is retrieved from the Met Office feed hosted on the Windows Azure Data Market. This is a free data feed that provides weather data for the UK only.Private Cloud Solution Design: This project is named “Training Cloud”. It provides an appropriate solution which can be used for technical audiences self learning with a hands-on-lab experience using Microsoft technology hosted in a virtualized environment built on System Center 2012. Since it depends on hardware, such as RAM, Sotrage, Network , etc. At last, the end user could have all labs ready which deloyed on private cloud. And it can be easily matain , setup labs with cloud’s function. pyUpdater: pyupdater provides a platform for updating python based applications.SharePoint Document Navigator: SP Document Navigator is a front-end solution for navigating a document library using jQuery and jQuery Mobile Trimetable: Train schedule for WP7Upload Master Pages & Page Layouts to Master Page Gallery using PowerShell: This document details the steps to upload Master pages and Page Layouts to Master Page Gallery using the “Upload Master Pages” Utility. 1- Download the .zip file 2- Edit the “UploadMasterPages.bat” file and Change the <<site collection url>> in the text below with respect to the environment. e.g. http://sitecollectionurl 3- Save the “UploadMasterPages.bat” file and close it. 4- Put all of your master pages and page layouts to Doc folder. 5- Run “UploadMasterPages.bat” file as Administrat...vivo: vivo Vietnamese Voice Vietnamese Voice recognition project thaihung.bkhn@gmail.com http://eking.vnvnv: VNV Vietnamese Voice Vietnamese Voice recognition project thaihung.bkhn@gmail.com http://eking.vnWindows Phone 7 User Guide Page: Take your app's users through a guided tour! Make your app's hidden gems shine, make users understand your app's logic and UX better.WP-FTS: This plugin for Wordpress replaces the default search engine, implemented using a simple "LIKE" operator, with the usage of the more powerful Full-Text Engine that comes with SQL Server.

    Read the article

  • ASP.NET MVC Application In Action - I (DailyJournal)

    - by Rajesh Pillai
    Its been long due I was planning to write an article on creating some useful ASP.NET MVC application. I have code named it "DailyJournal". Its a simple application which allows creation of multiple activities and assign tasks to these activities. Its' kind of "Yet another Task/Todo application". The credentials which you can use with the attached demo application is shown below.   Collapse Copy Code User Name : admin Password : admin123 Framework/Libraries Used ASP.NET MVC jQuery + jQuery UI (for ajax and UI) ELMAH for Error logging Warning Ahead This is just a rough draft and so I am putting down some of the known limitation. Some points of warning before we move further with this application. This is just an early prototype. As such many of the design principles have been ignored. But, I try to cover that up in the next update once I get my head around this. The application in its current state supports the following features Create users Assign Activities to users Assign tasks to activities Assign a status to a task The user creation/authentication is being done by the default Membership provider. Most of the activities are highly visual i.e. you can drag-drop task to different areas, in-place edition of task details and so on.   The following are the current issues with the design which I promise to refactor in the second version. No Validations Fat Controller XSS/CSS vulnerable No Service model/abstraction yet. For the demo LINQ to SQL is implemented. No separation of layers UI Design et el... This is just an extract.  For source code and more information proceed to http://www.codeproject.com/KB/aspnet/mvcinaction.aspx Hope you like this!

    Read the article

  • Use Oracle Product Hub Business Events to Integrate Additional Logic into Your Business Flows

    - by ToddAC-Oracle
    Business events provide a mechanism to plug-in and integrate some additional business processes or custom code into standard business flows.  You could send a notification to a business User, write to advanced queues or perform some custom processes. In-built business events are available specifically for each flow like Item Creation, Item Updation, User-Defined Attribute Changes, Change Order Creation, Change Order Status Changes and others.To get a list of business events, refer to the PIM implementation Guide or Using Business Events in PLM and PIM Data Librarian (Doc ID 372814.1) .If you are planning to use business events, Doc ID 1074754.1 walks you through a setup with examples. How to Subscribe and Use Product Hub (PIM / APC) Business Events [Video] ? (Doc ID 1074754.1). Review the 'Presentation' section of Doc ID 1074754.1 for complete information and best practices to follow while implementing code for subscriptions. Learn things you might want to avoid, like commit statements for instance. Doc ID 1074754.1 also provides sample code for testing, and can be used to troubleshoot missing setups or frequently experienced issues. Take advantage and run a test ahead of time with the sample code to isolate any issues from within business specific subscription code.Get more out of Oracle Product Hub by using Business Events!

    Read the article

  • 5 Mac Applications For Web And Graphic Design

    - by Jyoti
    In this article free applications useful and effective for the development and creation of websites with your Mac computer. Without further ado, here are 5 Excellent Mac Application for Web and Graphic Design. Fotoflexer : Fotoflexer claims to be “The world’s most advanced online image editor”. It offers completely free access to numerous features such as photo effects, graphics, shapes, morphing, and the creation of collages. You can also integrate and share your art with social sites like MySpace, Flickr, Facebook, and more. This can be an important app if the site you are creating is going to use applications. Simple CSS : With Simple CSS you can create Cascading Style Sheets from scratch or edit them right from the comfort of your desktop. Update styles on multiple pages all at once and reduce the data transfer usage on your page for faster loads. Blender : Blender is an open source software that allows you to create 3D animation with interactive playback leaves you with the option to optimize the style of your site with a few graphics. You can create animations with shades of colors, glossy features, soft shadows and advanced rendering features. JAlbum : Jalbum is a very useful app that allows you to create stylish photo galleries to publish on the web. All you have to do is simply drag selected folders into a pane where any images contained within the folder will automatically be arranged into a photo gallery. You can add several different themes and templates to enhance the appearance of your gallery, later then gain the HTML code and publish the complete gallery onto the web. Colorate : With Colorate you can create harmonized color palettes along with color schemes. Generate these palettes for images, photographs and more.

    Read the article

  • Oracle Delivers Special Recognition for Specialized Partners

    - by michaela.seika(at)oracle.com
    Since announcing Oracle PartnerNetwork Specialized (OPN Specialized) in October 2009, Oracle has been focused on building a program that first enables solution providers to become highly skilled Oracle partners who deliver value to customers and that then recognizes and rewards their achievements in a meaningful way. Today the company unveiled new benefits reserved for partners who have achieved one or more of the over 50 specializations currently available. The benefits demonstrate Oracle's commitment to showcase these valued partners to three key audiences: customers, other partners, and Oracle employees.With today's launch of www.oracle.com/specialized Oracle has taken what IDC believes is a first of its kind approach to putting top partners front and center with customers and prospects. While most vendors offer a business partner finder tool on their website none has gone as far as Oracle with the creation of this new site dedicated to the promotion of Specialized Partners. The tag lines - "Recognized by Oracle, Preferred by Customers" and "Specialized. Recognized. Preferred." gets right to the point - these are the solution providers with which customers should choose to engage. The contents of the page offer multiple proof points to justify the marketing phrases.One of the benefits Oracle offers its Specialized Partners is video creation and placement. While Oracle works with partners to create informal or "guerilla" videos which often are placed on YouTube to generate awareness and buzz, the company also produces professional videos for its partners. The greatest value the partner receives from this benefit isn't the non-trivial production costs that Oracle covers but instead the prominent exposure Oracle gives the finished product. Partner videos are featured on www.oracle.com/specialized, used as part of monthly OPN Specialized Partners monthly webcasts, placed on a customer facing website, the Oracle Media Network, which includes several partner sites such as PartnerCast. A solution provider gains a great deal of credibility when they can send a prospect to an Oracle website where they are featured. Read the full article here.

    Read the article

< Previous Page | 695 696 697 698 699 700 701 702 703 704 705 706  | Next Page >