Search Results

Search found 391 results on 16 pages for 'substitute'.

Page 7/16 | < Previous Page | 3 4 5 6 7 8 9 10 11 12 13 14  | Next Page >

  • Windows Live Messenger replacement

    - by Mark T
    I really do not like the Windows Live Messenger interface, and every time they revise it, it gets even worse. I want to use a replacement, ... but I don't want to lose the message history. My company uses Messenger for discussion of technical problems, and I often need to visit the history to find a previous discussion. Is there any substitute client that will use/continue the message history? It must also support file transfer. I'm running Windows XP/Pro, as required by my company.

    Read the article

  • When Citrix desktop disconnects SAP Client holds session and can't log back in

    - by Stradas
    We have a fairly large Citrix implementation and have just pushed out SAP desktop client to all of the desktops. Everything else is working fine except the following problem: If a user Disconnects their session and the session is running the SAP client, (logging off works fine) the user can not reconnect and log back in. We have a script on the server that terminates the session as a work around. We can see on the server that it is the SAP client that is holding on and running. This is at a large office, but the SAP servers are in another hemisphere. As is the custom Citrix says its SAP and SAP says it is Citrix. I don't like using a powershell script as a substitute for a system configuration solution.

    Read the article

  • Named ports in windows!

    - by Jay
    I wonder how stuff like this works in windows (xp and other that have telnet): Start-> Run -> cmd -> telnet <xyz.com> http Start-> Run -> cmd -> telnet <xyz.com> pop3 Start-> Run -> cmd -> telnet <xyz.com> smtp Are these "named" ports? Only windows knows that it has to substitute port numbers coz these are standard ports? Is there way I could create such a named port on windows? I would like something like this : telnet <xyz.com> oracle to translate to telnet <xyz.com> 1521

    Read the article

  • Font name used in files shared between OSX and Windows

    - by Paul
    Our designer uses OSX, and creates InDesign or AI files. They are then passed to us for changes. When we open the files on Windows, we are told that fonts are missing. In this example, the Futura font is being used. The Windows machine has Futura installed, from BitStream. The nane of the font is "Futura Std", whereas on OSX, it is simply Futura. So InDesign chooses a random font to substitute Futura with on Windows, it does not choose Futura Std. Now we can use the Find Font feature, and change all the instances of "Futura" to "Futura Std", but if we pass the file back to the designer, they have to then do the reverse. What is the right way for managing this?

    Read the article

  • Command line safety tricks

    - by deadprogrammer
    Command line and scripting is dangerous. Make a little typo with rm -rf and you are in a world of hurt. Confuse prod with stage in the name of the database while running an import script and you are boned (if they are on the same server, which is not good, but happens). Same for noticing too late that the server name where you sshed is not what you thought it was after funning some commands. You have to respect the Hole Hawg. I have a few little rituals before running risky commands - like doing a triple take check of the server I'm on. Here's an interesting article on rm safety. What little rituals, tools and tricks keeps you safe on the command line? And I mean objective things, like "first run ls foo*, look at the output of that and then substitute ls with rm -rf to avoid running rm -rf foo * or something like that", not "make sure you know what the command will do".

    Read the article

  • Edit inherited ACE's using icacls

    - by RedPheonix
    I am trying to write a script that will allow me to replace the user associated with certain permissions with another username. For example say I have a user Administrators and a user Administrator. Using icacls.exe I want to be able to replace all of the permissions given to Administrators and give them to Administrator. I also want to remove all instances of Administrators. So far I have used the following commands: icacls File1.txt /save acls.bin icacls . /substitute Administrator Administrators /restore acls.bin But when I run icacls File1.txt I get: User-PC\Administrator:(F) NT AUTHORITY\SYSTEM:(I)(F) BUILTIN\Administrators:(I)(F) User-PC\User:(I)(F) I have read that icacls has trouble dealing with inherited permissions but I was wondering if there was a method that allowed you to edit all of the permissions including the inherited ones.

    Read the article

  • Chrome and Firefox freeze when I begin typing

    - by mschulze
    Last night, chrome began freezing whenever I tried to type anything. After a fresh reinstall the problem went away but it is back again this morning. I installed Firefox as a substitute browser but it has the same problem. I cannot even get past the homepage because typing in the u r l bar freezes both programs. Last night internet explorer froze once too, but it has not happened since. Disabling shock-wave does not have any affect on the problem. Because it is happening across multiple browsers, I do not believe it to be caused by any extensions I have installed on Chrome. I also tried running Chrome as a new user and the problem still occurred. I can open any apps or web sites that are on my homepage, but as soon as I try to type anything the program freezes. Any ideas?

    Read the article

  • Search and replace global modifier

    - by mrucci
    Is there any reason why non-global/first-occurrence substitution is the default in many text editing programs (vim, sed, perl, etc.)? I am talking about the /g flag of search and replace commands like: :s/pan/focaccia/g # in vim sed 's/sfortuna/fortuna/g' # with sed that will substitute every occurrence of the search pattern with the replacement string. After (not too) many years of vim and sed usage I still did not find any use case for non-global substitutions. Is there some valid historical reason? Or it is because it is? Thanks.

    Read the article

  • How to report a bug against Ubuntu's upgrade process?

    - by Kim
    I just upgraded to lucid and discovered a nasty bug. It prevents the system from booting and took me hours to resolve. Now I'd like to report it along with the workaround I found. The only problem is: Where? Other such bugs have been filed against "update-manager", but that's just the GUI calling some scripts which do the real work. so what do I do? What should I substitute for XYZ in ubuntu-bug XYZ ?

    Read the article

  • What is the proper way to report a bug against the upgrade process from Ubuntu 9.10 to 10.4?

    - by Kim
    I just upgraded to lucid and discovered a nasty bug. It prevents the system from booting and took me hours to resolve. Now I'd like to report it along with the workaround I found. The only problem is: Where? Other such bugs have been filed against "update-manager", but that's just the GUI calling some scripts which do the real work. so what do I do? What should I substitute for XYZ in ubuntu-bug XYZ ?

    Read the article

  • prevent use of 'net user' command to change passwords on windows vista / xp

    - by guest
    hello the point is, if i'm logged in (and as almost every windows user, i've got an admin-account), and someone comes across my not locked pc, it is possible to change my password the pro-way through using: net user Admin %NEW_PASSWD% what can i do to prevent that, besides not being logged in as admin. i once saw a way, where the 'net user' command was substituted by a .bat file. so if you call 'net user Admin ...', it runs this .bat-file instead, which locks the notebook immediately. problem is, i honestly don't know how i could let windows substitute eg net.exe with a .bat-file. (too little windows knowledge) do you know any way how to do it? i'd appreciate it.

    Read the article

  • Privileged command as part of cronjob

    - by user42756
    Hi, I'm facing a weired problem on a unix-based machine. Here is the story: I have a personal username/password on a unix machine with limited privileges. Whenever I need to execute some commands I have to substitute user using the su command, then I execute it normally. Now, I need to add a cronjob that uses such privileged commands so I added the cronjob on the crontab of the user I substituted to in order to have access to these commands. Strangely, it turned out to me that these commands fail to run for some reason as a cronjob although when I execute them directly from shell (after su) they work seamlessly. Why does this happen? Why do these commands not work as part of cronjobs? Thank you

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Google Chrome not using local cache

    - by Steve
    Hi. I've been using Google Chrome as a substitute for Firefox not being able to handle having lots of tabs open at the same time. Unfortunately, it looks like Chrome is having the same problem. Freakin useless. I had to end Chrome as my whole system had slowed to a crawl. When I restarted it, I opted to restore the tabs that were last open. At this stage, every one of the 20+ tabs srated downloading the pages they had previously had open. My question is: why can't they open a locally stored/saved copy of the web page from cache? Does Google Chrome store pages in a cache? Also: after most of the pages had completed their downloading, I clicked on each tab to view the page. Half of them only display a white page, and I have to reload the page manually. What is causing this? Thanks for your help.

    Read the article

  • Text after Control Sequence

    - by SPAM SPAM SPAM SPAM
    I am trying to parse the output of a command that expects to be writing to the screen. It has data separated by move-to-origin control sequences (for the VT220, ESC[1;1H). I only need the last part (i.e. after the last move-to-origin). I have tried doing this multiple ways (primarily awk and sed), but the problem is always that parts of the control sequence have special meaning (to the program, not just to the shell), and I cannot quote them when I substitute tput's output. Any suggestions?

    Read the article

  • Visual Studio 2010 Productivity Tips and Tricks-Part 2: Key Shortcuts

    - by ToStringTheory
    Ask anyone that knows me, and they will confirm that I hate the mouse.  This isn’t because I deny affection to objects that don’t look like their mammalian-named self, but rather for a much more simple and not-insane reason: I have terrible eyesight.  Introduction Thanks to a degenerative eye disease known as Choroideremia, I have learned to rely more on the keyboard which I can feel digital/static positions of keys relative to my fingers, than the much more analog/random position of the mouse.  Now, I would like to share some of the keyboard shortcuts with you now, as I believe that they not only increase my productivity, but yours as well once you know them (if you don’t already of course)...  I share one of my biggest tips for productivity in the conclusion at the end. Visual Studio Key Shortcuts Global Editor Shortcuts These are shortcuts that are available from almost any application running in Windows, however are many times forgotten. Shortcut Action Visual Studio 2010 Functionality Ctrl + X Cut This shortcut works without a selection. If nothing is selected, the entire line that the caret is on is cut from the editor. Ctrl + C Copy This shortcut works without a selection. If nothing is selected, the entire line that the caret is on is copied from the editor. Ctrl + V Paste If you copied an entire line by the method above, the data is pasted in the line above the current caret line. Ctrl + Shift + V Next Clipboard Element Cut/Copy multiple things, and then hit this combo repeatedly to switch to the next clipboard item when pasting. Ctrl + Backspace Delete Previous Will delete the previous word from the editor directly before the caret. If anything is selected, will just delete that. Ctrl + Del Delete Next Word Will delete the next word/space from the editor directly after the caret. If anything is selected, will just delete that. Shift + Del Delete Focused Line Will delete the line from the editor that the caret is on. If something is selected, will just delete that. Ctrl + ? or Ctrl + ? Left/Right by Word This will move the caret left or right by word or special character boundary. Holding Shift will also select the word. Ctrl + F Quick Find Either the Quick Find panel, or the search bar if you have the Productivity Power Tools installed. Ctrl + Shift + F Find in Solution Opens up the 'Find in Files' window, allowing you to search your solution, as well as using regex for pattern matching. F2 Rename File... While not debugging, selecting a file in the solution explorer\navigator and pressing F2 allows you to rename the selected file. Global Application Shortcuts These are shortcuts that are available from almost any application running in Windows, however are many times forgotten... Again... Shortcut Action Visual Studio 2010 Functionality Ctrl + N New File dialog Opens up the 'New File' dialog to add a new file to the current directory in the Solution\Project. Ctrl + O Open File dialog Opens up the 'Open File' dialog to open a file in the editor, not necessarily in the solution. Ctrl + S Save File dialog Saves the currently focused editor tab back to your HDD/SSD. Ctrl + Shift + S Save All... Quickly save all open/edited documents back to your disk. Ctrl + Tab Switch Panel\Tab Tapping this combo switches between tabs quickly. Holding down Ctrl when hitting tab will bring up a chooser window. Building Shortcuts These are shortcuts that are focused on building and running a solution. These are not usable when the IDE is in Debug mode, as the shortcut changes by context. Shortcut Action Visual Studio 2010 Functionality Ctrl + Shift + B Build Solution Starts a build process on the solution according to the current build configuration manager settings. Ctrl + Break Cancel a Building Solution Will cancel a build operation currently in progress. Good for long running builds when you think of one last change. F5 Start Debugging Will build the solution if needed and launch debugging according to the current configuration manager settings. Ctrl + F5 Start Without Debugger Will build the solution if needed and launch the startup project without attaching a debugger. Debugging Shortcuts These are shortcuts that are used when debugging a solution. Shortcut Action Visual Studio 2010 Functionality F5 Continue Execution Continues execution of code until the next breakpoint. Ctrl + Alt + Break Pause Execution Pauses the program execution. Shift + F5 Stop Debugging Stops the current debugging session. NOTE: Web apps will still continue processing after stopping the debugger. Keep this in mind if working on code such as credit card processing. Ctrl + Shift + F5 Restart Debugging Stops the current debugging session and restarts the debugging session from the beginning. F9 Place Breakpoint Toggles/Places a breakpoint in the editor on the current line. Set a breakpoint in condensed code by highlighting the statement first. F10 Step Over Statement When debugging, executes all code in methods/properties on the current line until the next line. F11 Step Into Statement When debugging, steps into a method call so you can walk through the code executed there (if available). Ctrl + Alt + I Immediate Window Open the Immediate Window to execute commands when execution is paused. Navigation Shortcuts These are shortcuts that are used for navigating in the IDE or editor panel. Shortcut Action Visual Studio 2010 Functionality F4 Properties Panel Opens the properties panel for the selected item in the editor/designer/solution navigator (context driven). F12 Go to Definition Press F12 with the caret on a member to navigate to its declaration. With the Productivity tools, Ctrl + Click works too. Ctrl + K Ctrl + T View Call Hierarchy View the call hierarchy of the member the caret is on. Great for going through n-tier solutions and interface implementations! Ctrl + Alt + B Breakpoint Window View the breakpoint window to manage breakpoints and their advanced options. Allows easy toggling of breakpoints. Ctrl + Alt + L Solution Navigator Open the solution explorer panel. Ctrl + Alt + O Output Window View the output window to see build\general output from Visual Studio. Ctrl + Alt + Enter Live Web Preview Only available with the Web Essential plugin. Launches the auto-updating Preview panel. Testing Shortcuts These are shortcuts that are used for running tests in the IDE. Please note, Visual Studio 2010 is all about context. If your caret is within a test method when you use one of these combinations, the combination will apply to that test. If your caret is within a test class, it will apply to that class. If the caret is outside of a test class, it will apply to all tests. Shortcut Action Visual Studio 2010 Functionality Ctrl + R T Run Test(s) Run all tests in the current context without a debugger attached. Breakpoints will not be stopped on. Ctrl + R Ctrl + T Run Test(s) (Debug) Run all tests in the current context with a debugger attached. This allows you to use breakpoints. Substitute A for T from the preceding combos to run/debug ALL tests in the current context. Substitute Y for T from the preceding combos to run/debug ALL impacted/covering tests for a method in the current context. Advanced Editor Shortcuts These are shortcuts that are used for more advanced editing in the editor window. Shortcut Action Visual Studio 2010 Functionality Shift + Alt + ? Shift + Alt + ? Multiline caret up/down Use this combo to edit multiple lines at once. Not too many uses for it, but once in a blue moon one comes along. Ctrl + Alt + Enter Insert Line Above Inserts a blank line above the line the caret is currently on. No need to be at end or start of line, so no cutting off words/code. Ctrl + K Ctrl + C Comment Selection Comments the current selection out of compilation. Ctrl + K Ctrl + U Uncomment Selection Uncomments the current selection into compilation. Ctrl + K Ctrl + D Format Document Automatically formats the document into a structured layout. Lines up nodes or code into columns intelligently. Alt + ? Alt + ? Code line up/down *Use this combo to move a line of code up or down quickly. Great for small rearrangements of code. *Requires the Productivity Power pack from Microsoft. Conclusion This list is by no means meant to be exhaustive, but these are the shortcuts I use regularly every hour/minute of the day. There are still 100s more in Visual Studio that you can discover through the configuration window, or by tooltips. Something that I started doing months ago seems to have interest in my office.. In my last post, I talked about how I hated a cluttered UI. One of the ways that I aimed to resolve that was by systematically cleaning up the toolbars week by week. First day, I removed ALL icons that I already knew shortcuts to, or would never use them (Undo in a toolbar?!). Then, every week from that point on, I make it a point to remove an icon/two from the toolbar and make an effort to remember its key combination. I gain extra space in the toolbar area, AND become more productive at the same time! I hope that you found this article interesting or at least somewhat informative.. Maybe a shortcut or two you didn't know. I know some of them seem trivial, but I often see people going to the edit menu for Copy/Paste... Thought a refresher might be helpful!

    Read the article

  • Fixing up Configurations in BizTalk Solution Files

    - by Elton Stoneman
    Just a quick one this, but useful for mature BizTalk solutions, where over time the configuration settings can get confused, meaning Debug configurations building in Release mode, or Deployment configurations building in Development mode. That can cause issues in the build which aren't obvious, so it's good to fix up the configurations. It's time-consuming in VS or in a text editor, so this bit of PowerShell may come in useful - just substitute your own solution path in the $path variable: $path = 'C:\x\y\z\x.y.z.Integration.sln' $backupPath = [System.String]::Format('{0}.bak', $path) [System.IO.File]::Copy($path, $backupPath, $True) $sln = [System.IO.File]::ReadAllText($path)   $sln = $sln.Replace('.Debug|.NET.Build.0 = Deployment|.NET', '.Debug|.NET.Build.0 = Development|.NET') $sln = $sln.Replace('.Debug|.NET.Deploy.0 = Deployment|.NET', '.Debug|.NET.Deploy.0 = Development|.NET') $sln = $sln.Replace('.Debug|Any CPU.ActiveCfg = Deployment|.NET', '.Debug|Any CPU.ActiveCfg = Development|.NET') $sln = $sln.Replace('.Deployment|.NET.ActiveCfg = Debug|Any CPU', '.Deployment|.NET.ActiveCfg = Release|Any CPU') $sln = $sln.Replace('.Deployment|Any CPU.ActiveCfg = Debug|Any CPU', '.Deployment|Any CPU.ActiveCfg = Release|Any CPU') $sln = $sln.Replace('.Deployment|Any CPU.Build.0 = Debug|Any CPU', '.Deployment|Any CPU.Build.0 = Release|Any CPU') $sln = $sln.Replace('.Deployment|Mixed Platforms.ActiveCfg = Debug|Any CPU', '.Deployment|Mixed Platforms.ActiveCfg = Release|Any CPU') $sln = $sln.Replace('.Deployment|Mixed Platforms.Build.0 = Debug|Any CPU', '.Deployment|Mixed Platforms.Build.0 = Release|Any CPU') $sln = $sln.Replace('.Deployment|.NET.ActiveCfg = Debug|Any CPU', '.Deployment|.NET.ActiveCfg = Release|Any CPU') $sln = $sln.Replace('.Debug|.NET.ActiveCfg = Deployment|.NET', '.Debug|.NET.ActiveCfg = Development|.NET')   [System.IO.File]::WriteAllText($path, $sln) The script creates a backup of the solution file first, and then fixes up all the configs to use the correct builds. It's a simple search and replace list, so if there are any patterns that need to be added let me know and I'll update the script. A RegEx replace would be neater, but when it comes to hacking solution files, I prefer the conservative approach of knowing exactly what you're changing.

    Read the article

  • Dynamic model choice field in django formset using multiple select elements

    - by Aryeh Leib Taurog
    I posted this question on the django-users list, but haven't had a reply there yet. I have models that look something like this: class ProductGroup(models.Model): name = models.CharField(max_length=10, primary_key=True) def __unicode__(self): return self.name class ProductRun(models.Model): date = models.DateField(primary_key=True) def __unicode__(self): return self.date.isoformat() class CatalogItem(models.Model): cid = models.CharField(max_length=25, primary_key=True) group = models.ForeignKey(ProductGroup) run = models.ForeignKey(ProductRun) pnumber = models.IntegerField() def __unicode__(self): return self.cid class Meta: unique_together = ('group', 'run', 'pnumber') class Transaction(models.Model): timestamp = models.DateTimeField() user = models.ForeignKey(User) item = models.ForeignKey(CatalogItem) quantity = models.IntegerField() price = models.FloatField() Let's say there are about 10 ProductGroups and 10-20 relevant ProductRuns at any given time. Each group has 20-200 distinct product numbers (pnumber), so there are at least a few thousand CatalogItems. I am working on formsets for the Transaction model. Instead of a single select menu with the several thousand CatalogItems for the ForeignKey field, I want to substitute three drop-down menus, for group, run, and pnumber, which uniquely identify the CatalogItem. I'd also like to limit the choices in the second two drop-downs to those runs and pnumbers which are available for the currently selected product group (I can update them via AJAX if the user changes the product group, but it's important that the initial page load as described without relying on AJAX). What's the best way to do this? As a point of departure, here's what I've tried/considered so far: My first approach was to exclude the item foreign key field from the form, add the substitute dropdowns by overriding the add_fields method of the formset, and then extract the data and populate the fields manually on the model instances before saving them. It's straightforward and pretty simple, but it's not very reusable and I don't think it is the right way to do this. My second approach was to create a new field which inherits both MultiValueField and ModelChoiceField, and a corresponding MultiWidget subclass. This seems like the right approach. As Malcolm Tredinnick put it in a django-users discussion, "the 'smarts' of a field lie in the Field class." The problem I'm having is when/where to fetch the lists of choices from the db. The code I have now does it in the Field's __init__, but that means I have to know which ProductGroup I'm dealing with before I can even define the Form class, since I have to instantiate the Field when I define the form. So I have a factory function which I call at the last minute from my view--after I know what CatalogItems I have and which product group they're in--to create form/formset classes and instantiate them. It works, but I wonder if there's a better way. After all, the field should be able to determine the correct choices much later on, once it knows its current value. Another problem is that my implementation limits the entire formset to transactions relating to (CatalogItems from) a single ProductGroup. A third possibility I'm entertaining is to put it all in the Widget class. Once I have the related model instance, or the cid, or whatever the widget is given, I can get the ProductGroup and construct the drop-downs. This would solve the issues with my second approach, but doesn't seem like the right approach.

    Read the article

  • What are the legal considerations when forking a BSD-licensed project?

    - by Thomas Owens
    I'm interested in forking a project released under a two-clause BSD license: Copyright (c) 2010 {copyright holder} All rights reserved. Redistribution and use in source and binary forms, with or without modification, are permitted provided that the following conditions are met: (1) Redistributions of source code must retain the above copyright notice, this list of conditions and the disclaimer at the end. Redistributions in binary form must reproduce the above copyright notice, this list of conditions and the following disclaimer in the documentation and/or other materials provided with the distribution. (2) Neither the name of {copyright holder} nor the names of its contributors may be used to endorse or promote products derived from this software without specific prior written permission. DISCLAIMER THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. I've never forked a project before, but this project is very similar to something that I need/want. However, I'm not sure how far I'll get, so my plan is to pull the latest from their repository and start working. Maybe, eventually, I'll get it to where I want it, and be able to release it. Is this the right approach? How, exactly, does this impact forking of the project? How do I track who owns what components or sections (what's copyright me, what's copyright the original creators, once I start stomping over their code base)? Can I fork this project? What must I do prior to releasing, and when/if I decide to release the software derived from this BSD-licensed work?

    Read the article

  • Two things I learned this week...

    - by noreply(at)blogger.com (Thomas Kyte)
    I often say "I learn something new about Oracle every day".  It really is true - there is so much to know about it, it is hard to keep up sometimes.Here are the two new things I learned - the first is regarding temporary tablespaces.  In the past - when people have asked "how can I shrink my temporary tablespace" I've said "create a new one that is smaller, alter your database/users to use this new one by default, wait a bit, drop the old one".  Actually I usually said first - "don't, it'll just grow again" but some people really wanted to make it smaller.Now, there is an easier way:http://docs.oracle.com/cd/E11882_01/server.112/e26088/statements_3002.htm#SQLRF53578Using alter tablespace temp shrink space .The second thing is just a little sqlplus quirk that I probably knew at one point but totally forgot.  People run into problems with &'s in sqlplus all of the time as sqlplus tries to substitute in for an &variable.  So, if they try to select '&hello world' from dual - they'll get:ops$tkyte%ORA11GR2> select '&hello world' from dual;Enter value for hello: old   1: select '&hello world' from dualnew   1: select ' world' from dual'WORLD------ worldops$tkyte%ORA11GR2> One solution is to "set define off" to disable the substitution (or set define to some other character).  Another oft quoted solution is to use chr(38) - select chr(38)||'hello world' from dual.  I never liked that one personally.  Today - I was shown another wayhttps://asktom.oracle.com/pls/apex/f?p=100:11:0::::P11_QUESTION_ID:4549764300346084350#4573022300346189787 ops$tkyte%ORA11GR2> select '&' || 'hello world' from dual;'&'||'HELLOW------------&hello worldops$tkyte%ORA11GR2>just concatenate '&' to the string, sqlplus doesn't touch that one!  I like that better than chr(38) (but a little less than set define off....)

    Read the article

  • Class Design for special business rules

    - by Samuel Front
    I'm developing an application that allows people to place custom manufacturing orders. However, while most require similar paperwork, some of them have custom paperwork that only they require. My current class design has a Manufacturer class, of which of one of the member variables is an array of RequiredSubmission objects. However, there are two issues that I am somewhat concerned about. First, some manufacturers are willing to accept either a standard form or their own custom form. I'm thinking of storing this in the RequiredSubmission object, with an array of alternate forms that are a valid substitute. I'm not sure that this is ideal, however. The major issue, however, is that some manufacturers have deadline cycles. For example, forms A, B and C have to be delivered by January 1, while payment must be rendered by January 10. If you miss those, you'll have to wait until the next cycle. I'm not exactly sure how I can get this to work with my existing classes—how can I say "this set of dates all belong to the same cycle, with date A for form A, date B for form B, etc." I would greatly appreciate any insights on how to best design these classes.

    Read the article

  • Does this BSD-like license achieve what I want it to?

    - by Joseph Szymborski
    I was wondering if this license is: self defeating just a clone of an existing, better established license practical any more "corporate-friendly" than the GPL too vague/open ended and finally, if there is a better license that achieves a similar effect? I wanted a license that would (in simple terms) be as flexible/simple as the "Simplified BSD" license (which is essentially the MIT license) allow anyone to make modifications as long as I'm attributed require that I get a notification that such a derived work exists require that I have access to the source code and be given license to use the code not oblige the author of the derivative work to have to release the source code to the general public not oblige the author of the derivative work to license the derivative work under a specific license Here is the proposed license, which is just the simplified BSD with a couple of additional clauses (all of which are bolded). Copyright (c) (year), (author) (email) All rights reserved. Redistribution and use in source and binary forms, with or without modification, are permitted provided that the following conditions are met: Redistributions of source code must retain the above copyright notice, this list of conditions and the following disclaimer. Redistributions in binary form must reproduce the above copyright notice, this list of conditions and the following disclaimer in the documentation and/or other materials provided with the distribution. The copyright holder(s) must be notified of any redistributions of source code. The copyright holder(s) must be notified of any redistributions in binary form The copyright holder(s) must be granted access to the source code and/or the binary form of any redistribution upon the copyright holder's request. THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.

    Read the article

  • What is Mark Shuttleworth's "Easter eggs" blog a reference to? [closed]

    - by fluteflute
    I saw this blog post today, and I was wondering if there's some meaning within the Ubuntu community that I've missed? (I know what an easter egg is in a computer context.) One of our ducks has started dropping eggs in random locations in the garden. I don’t know which duck, but I assume it’s one of the new females we took in from the SPCA, who hasn’t figured out “nesting” yet. I do love ‘em but they’re not African Grey’s in the IQ department. Anyhow, I think I finally understand why people hide eggs in the garden at Easter. Because ducks used to do it for them! I suppose, for millennia, this has been the season to go hunting for eggs. Now we just substitute chocolate ones instead. For the moment, I’ve kept them in a cool shady spot while I keep an eye out for an actual nest. If a polecat doesn’t find them first, I may be able to slip them onto the nest in time for them to get hatched along with some cousins.

    Read the article

  • Can you add doubleclick macros to exisiting ads

    - by picus
    Setup: A few weeks back I made some very simple html5 "ads" to run on a few of our partner sites. They weren't paid ads as we also manage these sites, however there are a few of them, so I made a modular solution that is hosted on one of our web servers and included on each page via javascript which outputs an iframe. Each search (ad has a search box) or click appends a url param that we track using custom vars in Google Analytics. In essence, the ad is a HTML page served in an iframe via javscript. Problem: We have an opportunity to run these ads on a third party site, I had sent them a brief how-to for inserting them and they came back saying that: The creative code doesn't contain the %u macro. We can’t substitute the default click-through URL without it. I am somewhat familiar with doubleclick from a web developer's POV, i have inserted DC dart tags before and even have implemented the ad tool for publishers. I have not, however, actually ever created an ad for the doubleclick network before. I assume the publisher needs these tags to track clicks and hence charge us. However, they have not responded to me in regards to these questions. Are macros something I can just add to or replace the existing links with, or do I need to completely setup the ad with doubleclcik - a big issue in the short term given we do not have a advertiser's account set up with them. Thanks in advance

    Read the article

  • Understanding Asynchronous Programming with .NET Reflector

    - by Nick Harrison
    When trying to understand and learn the .NET framework, there is no substitute for being able to see what is going on behind at the scenes inside even the most confusing assemblies, and .NET Reflector makes this possible. Personally, I never fully understood connection pooling until I was able to poke around in key classes in the System.Data assembly. All of a sudden, integrating with third party components was much simpler, even without vendor documentation!With a team devoted to developing and extending Reflector, Red Gate have made it possible for us to step into and actually debug assemblies such as System.Data as though the source code was part of our solution. This maybe doesn’t sound like much, but it dramatically improves the way you can relate to and understand code that isn’t your own.Now that Microsoft has officially launched Visual Studio 2012, Reflector is also fully integrated with the new IDE, and supports the most complex language feature currently at our command: Asynchronous processing.Without understanding what is going on behind the scenes in the .NET Framework, it is difficult to appreciate what asynchronocity actually bring to the table and, without Reflector, we would never know the Arthur C. Clarke Magicthat the compiler does on our behalf.Join me as we explore the new asynchronous processing model, as well as review the often misunderstood and underappreciated yield keyword (you’ll see the connection when we dive into how the CLR handles async).Read more here

    Read the article

< Previous Page | 3 4 5 6 7 8 9 10 11 12 13 14  | Next Page >