Search Results

Search found 30894 results on 1236 pages for 'best practice'.

Page 707/1236 | < Previous Page | 703 704 705 706 707 708 709 710 711 712 713 714  | Next Page >

• Regular Expression to replace the numbers in a file

  - by Yongwei Xing

  Hi all There are a lot of numbers like 200 20.5 329.2...in a file. Now, I need replace every number A with A*0.8. Is there any simple method to replace original value with another based on original value? Best Regards,

  Read the article

• Platform Independent, Lightweight Programming Language

  - by Jack Mills

  I need to write an extremely lightweight program (trying to get below 8Kb) that performs some simple math. The language also needs to be platform independent. Which language do you think would work the best? (Oh, and no frameworks allowed.)

  Read the article

• How to find size of individual columns and indexes in mysql/innodb database?

  - by taw

  SHOW TABLE STATUS LIKE 'foo' returns Data_length - size of all data, and Index_length - size of all indexes. What's the best way to get per-column and per-index breakdown?

  Read the article

• How to hide password in configuration files

  - by xRobot

  Is there a way to hide my password in php configuration files ? What is the best way to do this ?

  Read the article

• Traversing stack and retrieving main arguments

  - by dlee313

  Given the size of the code of the main function in bytes passed as a parameter to a function, what is the best way to get to the base address for the main code and retrieve the first char * in the argv array?

  Read the article

• Parsing complicated query parameters

  - by Will

  My Python server receives jobs that contain a list of the items to act against, rather like a search query term; an example input: (Customer:24 OR Customer:24 OR (Group:NW NOT Customer:26)) To complicate matters, customers can join and leave groups at any time, and the job should be updated live when this happens. How is best to parse, apply and store (in my RDBMS) this kind of list of constraints?

  Read the article

• Printing values of all fields in C++ structure

  - by Zhinkaas

  Say a simple structure struct abc { int a; char b; } I got some value in a variable defined as its structure and now I want to print below a = [some value] b = [some character] What is the best way to achieve this for an arbitrary structure without having to write a dump...(...) function for each of the structure I encounter?

  Read the article

• Extended MAPI: How to get the entry ID of messages moved by CopyMessages

  - by marijne

  I have found that if I move a message using IMAPIFolder::CopyMessages (using the MESSAGE_MOVE flag) the message gets a new entry ID. However I do not see any reliable way of getting the entry ID of the message in its new location, or otherwise getting a reference to it. The best suggestion I have had so far involves tagging the message with the old custom property before moving, and then doing a search afterwards, but I was wondering if there is a less convoluted solution.

  Read the article

• Android "hello world" - versions

  - by Ianb

  Starter question: My "Hello World" attempt won't run, ("No compatible targets were found"), I think this is bacause I selected the latest version for my project (2.2), and the highest AVD version is 2.0.1. Does this make sense? Can I change my project version (haven't been able to find a way to do this), or do I have to start again? If the versions are not backwards compatible, what is the best version to use for the majority of Android devices out there? Thanks

  Read the article

• How to transfer Core Data store from provisioned iPhone to iPhone simulator?

  - by Jason

  I have a lot of data stores in my app on my provisioned device, and I want to do additional testing on my computer which is much faster than using the device. What is the best way to transfer the data store into the iPhone simulator so I can access it on the computer?

  Read the article

• Rewriting URL's in ASP.net (Simple question)

  - by Tom Gullen

  On my master page I have: <link rel="stylesheet" href="css/default.css" /> I also have a page "blog.aspx" in the root directory. I have the rule: <rewrite url="~/blog/blog.aspx" to="~/blog.aspx" /> My questions are: Am I meant to make all my links in my site point to blog/blog.aspx now instead of just blog.aspx where it is physically located How is best to cope with the paths of the stylesheets etc now being messed up because they are one dir up?

  Read the article

• CVS: Modules vs Subdirectories

  - by Glaxalg

  Does anyone know what is the best approach to define structure of modules/directories in CVS? Specifically what if I have big project that could possibly has many sub-projects (even not related). Is it better to define module for each sub-project or use subdirectories: Approach #1 Modules CVSROOT Main Project Platform A Sub-project1 Platform A Sub-project2 Platform B Sub-project3 ... Approach #2 subdirectories CVSROOT Project Main Platform A Sub-Project 1 Sub-Project 2 Platform B Sub-Project 3 ...

  Read the article

• Localize Strings in Javascript

  - by SaaS Developer

  I'm currently using .resx files to manage my server side resources for .Net. The application that I am dealing with also allows developers to plugin javascript into various event handlers for client side validation, etc.. What is the best way for me to localize my javascript messages and strings? Ideally, I would like to store the strings in the .resx files to keep them with the rest of the localized resources. I'm open to suggestions.

  Read the article

• regex removing specified empty xml tag using C#

  - by John

  Hi, I would like to remove tag like the following one with its attributes using C# .Net how can i do it? <aaa type="1" class="2" /> other tags like <bbb type="5" class="4" /> i would like to keep. Best Regards,

  Read the article

• Create word document and add image from .NET app

  - by fearofawhackplanet

  I need a way of generating a word document (from a template or something) and inserting an image at a specific place. Does anyone have any pointers on the best way to do this? I worked on a project that used Office Automation in .NET 1.1 a few years ago, and it was really unspeakably poor. I'm assuming OA has either been improved or been superceeded by a better solution, but I'm not finding much advice on google.

  Read the article

• How to I "scan" a website(or page) for info, and bring it into my program?

  - by James

  Well, I'm pretty much trying to figure out how to pull information from a webpage, and bring it into my program(in Java). For example, if I know the exact page I want info from, for the sake of simplicity a Best Buy item page, how would I get the appropriate info I need off of that page? Like the title, price, description? What would this process even be called? I have no idea were to even began researching this :'(

  Read the article

• how to build a mail server in java

  - by ylazez

  greetings all i have an app(spring+hibernate) that needs to send thousands of emails simultaneously and i was told that the best solution here is to have a mail server i don't have any idea where to start or if there's a framework or a service that is better so please guys give me some info where to start, thank you.

  Read the article

• sed or greo or awk to match very very long lines

  - by yael

  more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

  Read the article

• Ways to restrict WCF Service so only our apps can access it.

  - by RP

  I have a public WCF Service. I have a WPF Desktop app & a silverlight app. My apps does not have any login requirements. I want to make it difficult for another developer / website to make use of my service. What's the best way to restrict access to my service? Use SSL and have the desktop / silverlight app store a token inside of it?

  Read the article

• Calling a getter multiple times or calling once and assigning to a variable?

  - by GK

  say suppose I have class as : public class Age { private int age; public int getAge() { return this.age; } } In my Main class I am calling the getAge() method many times. So I wanted to know is it advisable to call so many times or call once and assign it to some variable and use that variable. Which is best and why?

  Read the article

• how to disable JList selection change event and invoke it only on double click ?

  - by yurib

  As the title says... I'd like items in a JList to be "selected" only when they are double clicked. what would be the best way to achieve this kind of behavior ?

  Read the article

• move data in bulk from oracle to SQL database

  - by Soja

  Hi All... Would like to know which is the best way to move data in bulk from oracle to SQL database programmatically in VB.NET application.This application is suppose to run continuously and moves data from Oracle to SQL whenever data comes. I have found OPENDATASOURCE but does not know the exact syntax. Can someone help me out. Thanks in advance,

  Read the article

• svn: default name for a tag when name is not important?

  - by Jason S

  I need to tag the current state of my source tree in svn. My problem is I don't care what the name is, I just need to mark the current revision in an immutable* manner. (*subject to malicious behavior) What's the best way to do this? branches/ tags/ ??? trunk/ should ??? be the date, an incrementing sequence, the repository rev # ...?

  Read the article

• Calendar formatting issues

  - by Philipp

  Hi folks! We're searching for information on how to format instances of java.util.Calendar and more general information and coding hints regarding transition from using java.util.Date to java.util.Calendar. best, phil

  Read the article

• How do I tell when a CUPS print jobs has been completed plus info about that job?

  - by Lawrence Johnston

  I need to know each time a Mac print job is created/completed, plus some information about that job (what was printed, pages, copies, etc). The best method I've come up with thus far is to use kqueue() on /var/spool/cups/ and then parse the c##### files as they're created, but I'm wondering if there's a better way.

  Read the article

< Previous Page | 703 704 705 706 707 708 709 710 711 712 713 714  | Next Page >