Search Results

Search found 4275 results on 171 pages for 'symbol capture'.

Page 71/171 | < Previous Page | 67 68 69 70 71 72 73 74 75 76 77 78  | Next Page >

  • Nginx redirect requests to sub-domains that do not exist to custom 404 page when wild card A record is set?

    - by Anagio
    Is there a way to capture all requests to arbitrary sub-domains which do not have a virtual host setup, and redirect to a custom 404 page in nginx? I will have a wild card A record setup *.example.com and all our users will have a sub-domain username.example.com. If someone enters a sub-domain which does not exist how can I redirect to a custom 404 page rather than have it resolve since wild card is setup?

    Read the article

  • Troubleshooting latency spikes on ESXi NFS datastores

    - by exo_cw
    I'm experiencing fsync latencies of around five seconds on NFS datastores in ESXi, triggered by certain VMs. I suspect this might be caused by VMs using NCQ/TCQ, as this does not happen with virtual IDE drives. This can be reproduced using fsync-tester (by Ted Ts'o) and ioping. For example using a Grml live system with a 8GB disk: Linux 2.6.33-grml64: root@dynip211 /mnt/sda # ./fsync-tester fsync time: 5.0391 fsync time: 5.0438 fsync time: 5.0300 fsync time: 0.0231 fsync time: 0.0243 fsync time: 5.0382 fsync time: 5.0400 [... goes on like this ...] That is 5 seconds, not milliseconds. This is even creating IO-latencies on a different VM running on the same host and datastore: root@grml /mnt/sda/ioping-0.5 # ./ioping -i 0.3 -p 20 . 4096 bytes from . (reiserfs /dev/sda): request=1 time=7.2 ms 4096 bytes from . (reiserfs /dev/sda): request=2 time=0.9 ms 4096 bytes from . (reiserfs /dev/sda): request=3 time=0.9 ms 4096 bytes from . (reiserfs /dev/sda): request=4 time=0.9 ms 4096 bytes from . (reiserfs /dev/sda): request=5 time=4809.0 ms 4096 bytes from . (reiserfs /dev/sda): request=6 time=1.0 ms 4096 bytes from . (reiserfs /dev/sda): request=7 time=1.2 ms 4096 bytes from . (reiserfs /dev/sda): request=8 time=1.1 ms 4096 bytes from . (reiserfs /dev/sda): request=9 time=1.3 ms 4096 bytes from . (reiserfs /dev/sda): request=10 time=1.2 ms 4096 bytes from . (reiserfs /dev/sda): request=11 time=1.0 ms 4096 bytes from . (reiserfs /dev/sda): request=12 time=4950.0 ms When I move the first VM to local storage it looks perfectly normal: root@dynip211 /mnt/sda # ./fsync-tester fsync time: 0.0191 fsync time: 0.0201 fsync time: 0.0203 fsync time: 0.0206 fsync time: 0.0192 fsync time: 0.0231 fsync time: 0.0201 [... tried that for one hour: no spike ...] Things I've tried that made no difference: Tested several ESXi Builds: 381591, 348481, 260247 Tested on different hardware, different Intel and AMD boxes Tested with different NFS servers, all show the same behavior: OpenIndiana b147 (ZFS sync always or disabled: no difference) OpenIndiana b148 (ZFS sync always or disabled: no difference) Linux 2.6.32 (sync or async: no difference) It makes no difference if the NFS server is on the same machine (as a virtual storage appliance) or on a different host Guest OS tested, showing problems: Windows 7 64 Bit (using CrystalDiskMark, latency spikes happen mostly during preparing phase) Linux 2.6.32 (fsync-tester + ioping) Linux 2.6.38 (fsync-tester + ioping) I could not reproduce this problem on Linux 2.6.18 VMs. Another workaround is to use virtual IDE disks (vs SCSI/SAS), but that is limiting performance and the number of drives per VM. Update 2011-06-30: The latency spikes seem to happen more often if the application writes in multiple small blocks before fsync. For example fsync-tester does this (strace output): pwrite(3, "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"..., 1048576, 0) = 1048576 fsync(3) = 0 ioping does this while preparing the file: [lots of pwrites] pwrite(3, "********************************"..., 4096, 1036288) = 4096 pwrite(3, "********************************"..., 4096, 1040384) = 4096 pwrite(3, "********************************"..., 4096, 1044480) = 4096 fsync(3) = 0 The setup phase of ioping almost always hangs, while fsync-tester sometimes works fine. Is someone capable of updating fsync-tester to write multiple small blocks? My C skills suck ;) Update 2011-07-02: This problem does not occur with iSCSI. I tried this with the OpenIndiana COMSTAR iSCSI server. But iSCSI does not give you easy access to the VMDK files so you can move them between hosts with snapshots and rsync. Update 2011-07-06: This is part of a wireshark capture, captured by a third VM on the same vSwitch. This all happens on the same host, no physical network involved. I've started ioping around time 20. There were no packets sent until the five second delay was over: No. Time Source Destination Protocol Info 1082 16.164096 192.168.250.10 192.168.250.20 NFS V3 WRITE Call (Reply In 1085), FH:0x3eb56466 Offset:0 Len:84 FILE_SYNC 1083 16.164112 192.168.250.10 192.168.250.20 NFS V3 WRITE Call (Reply In 1086), FH:0x3eb56f66 Offset:0 Len:84 FILE_SYNC 1084 16.166060 192.168.250.20 192.168.250.10 TCP nfs > iclcnet-locate [ACK] Seq=445 Ack=1057 Win=32806 Len=0 TSV=432016 TSER=769110 1085 16.167678 192.168.250.20 192.168.250.10 NFS V3 WRITE Reply (Call In 1082) Len:84 FILE_SYNC 1086 16.168280 192.168.250.20 192.168.250.10 NFS V3 WRITE Reply (Call In 1083) Len:84 FILE_SYNC 1087 16.168417 192.168.250.10 192.168.250.20 TCP iclcnet-locate > nfs [ACK] Seq=1057 Ack=773 Win=4163 Len=0 TSV=769110 TSER=432016 1088 23.163028 192.168.250.10 192.168.250.20 NFS V3 GETATTR Call (Reply In 1089), FH:0x0bb04963 1089 23.164541 192.168.250.20 192.168.250.10 NFS V3 GETATTR Reply (Call In 1088) Directory mode:0777 uid:0 gid:0 1090 23.274252 192.168.250.10 192.168.250.20 TCP iclcnet-locate > nfs [ACK] Seq=1185 Ack=889 Win=4163 Len=0 TSV=769821 TSER=432716 1091 24.924188 192.168.250.10 192.168.250.20 RPC Continuation 1092 24.924210 192.168.250.10 192.168.250.20 RPC Continuation 1093 24.924216 192.168.250.10 192.168.250.20 RPC Continuation 1094 24.924225 192.168.250.10 192.168.250.20 RPC Continuation 1095 24.924555 192.168.250.20 192.168.250.10 TCP nfs > iclcnet_svinfo [ACK] Seq=6893 Ack=1118613 Win=32625 Len=0 TSV=432892 TSER=769986 1096 24.924626 192.168.250.10 192.168.250.20 RPC Continuation 1097 24.924635 192.168.250.10 192.168.250.20 RPC Continuation 1098 24.924643 192.168.250.10 192.168.250.20 RPC Continuation 1099 24.924649 192.168.250.10 192.168.250.20 RPC Continuation 1100 24.924653 192.168.250.10 192.168.250.20 RPC Continuation 2nd Update 2011-07-06: There seems to be some influence from TCP window sizes. I was not able to reproduce this problem using FreeNAS (based on FreeBSD) as a NFS server. The wireshark captures showed TCP window updates to 29127 bytes in regular intervals. I did not see them with OpenIndiana, which uses larger window sizes by default. I can no longer reproduce this problem if I set the following options in OpenIndiana and restart the NFS server: ndd -set /dev/tcp tcp_recv_hiwat 8192 # default is 128000 ndd -set /dev/tcp tcp_max_buf 1048575 # default is 1048576 But this kills performance: Writing from /dev/zero to a file with dd_rescue goes from 170MB/s to 80MB/s. Update 2011-07-07: I've uploaded this tcpdump capture (can be analyzed with wireshark). In this case 192.168.250.2 is the NFS server (OpenIndiana b148) and 192.168.250.10 is the ESXi host. Things I've tested during this capture: Started "ioping -w 5 -i 0.2 ." at time 30, 5 second hang in setup, completed at time 40. Started "ioping -w 5 -i 0.2 ." at time 60, 5 second hang in setup, completed at time 70. Started "fsync-tester" at time 90, with the following output, stopped at time 120: fsync time: 0.0248 fsync time: 5.0197 fsync time: 5.0287 fsync time: 5.0242 fsync time: 5.0225 fsync time: 0.0209 2nd Update 2011-07-07: Tested another NFS server VM, this time NexentaStor 3.0.5 community edition: Shows the same problems. Update 2011-07-31: I can also reproduce this problem on the new ESXi build 4.1.0.433742.

    Read the article

  • Visual Studio Project build Error [closed]

    - by Mina Sobhy
    I installed Visual Studio 2010 on Windows7 SP1 but a debug error occurs: 1>------ Build started: Project: x, Configuration: Debug Win32 ------ 1>MSVCRTD.lib(crtexe.obj) : error LNK2019: unresolved external symbol main referenced in function __tmainCRTStartup 1>C:\Users\mina\Documents\Visual Studio 2010\Projects\x\Debug\x.exe : fatal error LNK1120: 1 unresolved externals ========== Build: 0 succeeded, 1 failed, 0 up-to-date, 0 skipped ==========

    Read the article

  • Displaying dual monitor screenshot in "dual fullscreen" mode

    - by ohadsc
    Suppose I take a PNG screenshot on a dual monitor system (let's assume for simplicity they are identical), The screenshot will capture both monitors. Now say I want to display that screenshot in an image viewer (windows photo viewer, xnview, etc) at fullscreen - I will then have to choose which monitor to display it on, distorting the image. Is there a way to strech it accross both monitors (aside of changing the windows display mode in the screen configuration window) ? I am using Windows 7 Thanks

    Read the article

  • How to check if Emacs is in GUI mode (and execute `tool-bar-mode` only then)?

    - by dehmann
    I have this line in my .emacs file: (tool-bar-mode 0) because I hate the toolbars in my GUI emacs (/Applications/Emacs.app/Contents/MacOS/Emacs). But when I start up my other, text-based emacs in the terminal (/opt/local/bin/emacs) it complains about that command: Symbol's function definition is void: tool-bar-mode How can I add an if condition so that it executes the tool-bar-mode command only when I'm in the GUI emacs? Thanks!

    Read the article

  • Why can't I get Apache2 mod_dumpio working under Lucid Lynx Ubuntu?

    - by bland328
    I'm trying to capture all of the traffic to and from an Apache2 web server for troubleshooting purposes, so I did the following to try to set mod_dumpio up properly: Used a2enmod to enable mod_dumpio Changed LogLevel to "debug" in apache2.config Added "DumpIOInput On", "DumpIOOutput On" and "DumpIOLogLevel debug" to apache2.config Issued "/etc/init.d/apache2 restart" to restart Apache Issued "apache2ctl -t -D DUMP_MODULES" to make sure mod_dumpio was loaded I'm watching /var/log/apache2/error.log, but not seeing much there, and certainly not a dump of all input and output. Can anyone help?

    Read the article

  • Logitech keboard wrong keys under MAC OSX

    - by David Casillas
    I have a Logitech MK250 keyboard I use with my Macbook. One day the "minor/mayor than" and the "back slash" keys flip their functionality, so I have to hit "backslash" to get a "minor than" symbol and press the "alt + minor than" key to get the "backslash". Is there any way to reverse this annoying behavior? I often switch to Windows, where the keys work the expected way, and I'm always missing the right key.

    Read the article

  • virtual mac osx 10.6.8 in VMWare does not save screen captures

    - by epeleg
    I have a VMWare image of a mac OSX 10.6.8 (fully updated). When I click Commnd+Shift+3 it makes a camera shutter sound, but no screen-capture is saved anywhere that I can find. When running: defaults read com.apple.screencapture location it returns /Users/admin/Pictures/Captures this folder exists and is empty also executed chmod 777 /Users/admin/Pictures/Captures Any ideas anyone ? Could this be related to the VMware screen resolution(Size) of this MAC? (currently set to 1348x1391)

    Read the article

  • quicktime recording: only a region?

    - by David.Chu.ca
    The newest QT has a feature to record or capture the current screen. My iMac 27 is too big if I want to record the whole screen. Can I designate a region or an application window for recording? I could not find a way to do that. Not sure if I have to use alternative applications to do it.

    Read the article

  • Apache Error Upgrading to PHP 5.5

    - by user195385
    I am trying to upgrade php and received this error at the command line: httpd: Syntax error on line 493 of /private/etc/apache2/httpd.conf: Syntax error on line 8 of /private/etc/apache2/other/+php-osx.conf: Cannot load /usr/local/php5/libphp5.so into server: dlopen(/usr/local/php5/libphp5.so, 10): Symbol not found: _libiconv\n Referenced from: /usr/local/php5/lib/libintl.8.dylib\n Expected in: /usr/lib/libiconv.2.dylib\n in /usr/local/php5/lib/libintl.8.dylib I was trying to upgrade at http://php-osx.liip.ch/ using the command: curl -s http://php-osx.liip.ch/install.sh | bash -s 5.5 Any help would be appreciated!

    Read the article

  • What is a good program for mixed mode circuit simulation?

    - by Jeff Shattock
    I'm looking for a program that will perform schematic capture and mixed-mode (analog and digital) circuit simulation. If it also did PCB layout and routing, that would be a bonus, but not necessary. I currently use an old version of CircuitMaker/TraxMaker, but its dated, and the simulation engine is a bit lacking. Windows or Linux, doesn't really matter. What is a good program for this purpose?

    Read the article

  • android camera preview blank screen

    - by user1104836
    I want to capture a photo manually not by using existing camera apps. So i made this Activity: public class CameraActivity extends Activity { private Camera mCamera; private Preview mPreview; @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.activity_camera); // Create an instance of Camera // mCamera = Camera.open(0); // Create our Preview view and set it as the content of our activity. mPreview = new Preview(this); mPreview.safeCameraOpen(0); FrameLayout preview = (FrameLayout) findViewById(R.id.camera_preview); preview.addView(mPreview); } @Override public boolean onCreateOptionsMenu(Menu menu) { // Inflate the menu; this adds items to the action bar if it is present. getMenuInflater().inflate(R.menu.activity_camera, menu); return true; } } This is the CameraPreview which i want to use: public class Preview extends ViewGroup implements SurfaceHolder.Callback { SurfaceView mSurfaceView; SurfaceHolder mHolder; //CAM INSTANCE ================================ private Camera mCamera; List<Size> mSupportedPreviewSizes; //============================================= /** * @param context */ public Preview(Context context) { super(context); mSurfaceView = new SurfaceView(context); addView(mSurfaceView); // Install a SurfaceHolder.Callback so we get notified when the // underlying surface is created and destroyed. mHolder = mSurfaceView.getHolder(); mHolder.addCallback(this); mHolder.setType(SurfaceHolder.SURFACE_TYPE_PUSH_BUFFERS); } /** * @param context * @param attrs */ public Preview(Context context, AttributeSet attrs) { super(context, attrs); // TODO Auto-generated constructor stub } /** * @param context * @param attrs * @param defStyle */ public Preview(Context context, AttributeSet attrs, int defStyle) { super(context, attrs, defStyle); // TODO Auto-generated constructor stub } /* (non-Javadoc) * @see android.view.ViewGroup#onLayout(boolean, int, int, int, int) */ @Override protected void onLayout(boolean arg0, int arg1, int arg2, int arg3, int arg4) { // TODO Auto-generated method stub } @Override public void surfaceChanged(SurfaceHolder holder, int format, int width, int height) { // Now that the size is known, set up the camera parameters and begin // the preview. Camera.Parameters parameters = mCamera.getParameters(); parameters.setPreviewSize(width, height); requestLayout(); mCamera.setParameters(parameters); /* Important: Call startPreview() to start updating the preview surface. Preview must be started before you can take a picture. */ mCamera.startPreview(); } @Override public void surfaceCreated(SurfaceHolder holder) { // TODO Auto-generated method stub } @Override public void surfaceDestroyed(SurfaceHolder holder) { // Surface will be destroyed when we return, so stop the preview. if (mCamera != null) { /* Call stopPreview() to stop updating the preview surface. */ mCamera.stopPreview(); } } /** * When this function returns, mCamera will be null. */ private void stopPreviewAndFreeCamera() { if (mCamera != null) { /* Call stopPreview() to stop updating the preview surface. */ mCamera.stopPreview(); /* Important: Call release() to release the camera for use by other applications. Applications should release the camera immediately in onPause() (and re-open() it in onResume()). */ mCamera.release(); mCamera = null; } } public void setCamera(Camera camera) { if (mCamera == camera) { return; } stopPreviewAndFreeCamera(); mCamera = camera; if (mCamera != null) { List<Size> localSizes = mCamera.getParameters().getSupportedPreviewSizes(); mSupportedPreviewSizes = localSizes; requestLayout(); try { mCamera.setPreviewDisplay(mHolder); } catch (IOException e) { e.printStackTrace(); } /* Important: Call startPreview() to start updating the preview surface. Preview must be started before you can take a picture. */ mCamera.startPreview(); } } public boolean safeCameraOpen(int id) { boolean qOpened = false; try { releaseCameraAndPreview(); mCamera = Camera.open(id); mCamera.startPreview(); qOpened = (mCamera != null); } catch (Exception e) { // Log.e(R.string.app_name, "failed to open Camera"); e.printStackTrace(); } return qOpened; } Camera.PictureCallback mPicCallback = new Camera.PictureCallback() { @Override public void onPictureTaken(byte[] data, Camera camera) { // TODO Auto-generated method stub Log.d("lala", "pic is taken"); } }; public void takePic() { mCamera.startPreview(); // mCamera.takePicture(null, mPicCallback, mPicCallback); } private void releaseCameraAndPreview() { this.setCamera(null); if (mCamera != null) { mCamera.release(); mCamera = null; } } } This is the Layout of CameraActivity: <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" xmlns:tools="http://schemas.android.com/tools" android:layout_width="match_parent" android:layout_height="match_parent" tools:context=".CameraActivity" > <FrameLayout android:id="@+id/camera_preview" android:layout_width="0dip" android:layout_height="fill_parent" android:layout_weight="1" /> <Button android:id="@+id/button_capture" android:text="Capture" android:layout_width="wrap_content" android:layout_height="wrap_content" android:layout_gravity="center" /> </LinearLayout> But when i start the CameraActivity, i just see a blank white background and the Capture-Button??? Why i dont see the Camera-Screen?

    Read the article

  • Multiline code in Word 2007

    - by WaelJ
    I am using word 2007 and am inserting code into the document. I have a style with a fixed-width font and light grey background and all, and I use Notepad++ for syntax highlighting. My problem is with a "line" of code that is too long to display, so is there a way to auto-insert an arrow symbol at the beginning of a such lines to indicate that it is the same line (kind of like hyphenating, except on long lines instead of long words) So for e.g. something like this: public static void foo(String abcdefg, Boolean 123, ?String xyz)

    Read the article

  • Checking the configuration of two systems to determine changes

    - by None
    We are standing up a replicant data center at work and need to ensure that the new data center is configured (nearly) identically to the original. The new data center will be differently addressed and named than the original and will have differing user accounts, but all the COTS, patches, and configurations should be the same. We would normally ghost the original servers and install those images onto the new machines, however, we have a few problematic pieces of COTS that require we install them outside of an image due to how they capture the setup of the network during their installation and maintain it within their configuration information (in some cases storing it in various databases). We have tried multiple times and this piece of COTS cannot be captured within a ghost image unless the destination machine will have an identical network setup (all the same IPs, hostnames, user accounts, etc across the entire network) as the original. In truth, it is the setup of these special COTS that I want to audit the most because they are difficult to install and configure in the first place. In light of the fact that we can’t simply ghost, I’m trying to find a reasonable manner to audit the new data center and check to see if it is setup like the original (some sort of system wide configuration audit or integrity check). I’m considering using something like Tripwire for Servers to capture the configuration on the source machines and then run an audit on the destination machines. I understand that it will still show some differences due to the minor config changes, but I’m hoping that it will eliminate the majority of the work. Here are some of the constraints I’m working under: Data center is comprised of multiple Windows and Linux machines of differing versions (about 20 total) I absolutely cannot ghost or snap any other type of image of these machines … at least not in their final configuration I want to audit the final configuration to ensure all of the COTS, patches, configurations, etc are installed and setup properly (as compared to the original data center) I would rather not install any additional tools on these machines … I’d much rather run it from a standalone machine or off a DVD Price of tools is important but not an impossible burden, however, getting a solution soon is important (I can’t take the time to roll my own tools to do this) For the COTS that stores the network information, I don’t know all of the places it stores the network information … so it would be unlikely I could find a way in the near future to adjust its setup after the installation has occurred Anyone have any thoughts or alternate approaches? Can anyone recommend tools that would be usable for system wide configuration audits?

    Read the article

  • Capturing XEN Dom0 logs on Debian lenny ?

    - by Xavier
    I have a Dell server with Xen 3.2 (from Debian Lenny) running a Debian Lenny dom0. Since I am facing unexpected reboot without any clue in the debian logs, I would like to capture the Xen dom0 logs. Did anybody achieve this and how ? I tried to use the Dell serial port redirection without success.

    Read the article

  • windows misconfigured keyboard after installing usb keyboard

    - by goliatone
    have a dell vostro 1520, installed an external usb keyboard which works fine but the laptop's keyboard does not work properly. in the log in screen everything works as it should, once logged in the keyboard breaks. keys that have an alternate symbol accessible with the FN key render it by default. Meaning i have to press the FN key for it to render the proper ones- p has the * as FN, in order to get the p i have to press p+FN.

    Read the article

  • windows server 2008 r2 remote desktop issue with roaming clients

    - by Patrick D'Haese
    I have the following situation : a Dell windows server 2008 R2 computer, with remote desktop services installed. I have installed a java application making use of a PostgreSql database, and made this application available for clients using RDP. Clients are standard Win XP pc's and Psion Neo handheld devices running Windows CE 5 Pro. The application works fine for clients on standard XP pc's connected directly via cat 5E Ethernet cable to a Dell Powerconnect 2816 switch. The Psion Neo clients connect wireless to the network via Motorola AP6532 access points. These access points are connected via a POE adapter to the same switch as the XP pc's. The Psion devices can connect without any problem and very quickly to the server and to the application using RDP. So far, so good. When the Psion devices move around in the warehouse, and they roam from one access point to the other, the RDP session on the client freezes for approx 1 minute, and then it automatically resumes the session. This freezing is very annoying for the users. Can anyone help in solving this issue? Update (August 9) : After re-installing the access points we have a working situation, but only when connecting to the RDP host : * via a Win Xp SP3 laptop * via a Symbol MC9190 Win CE 6 mobile device When roaming we notice a small hick-up less then 1 second, what is very acceptable. With the Psion NEO it's still not working, when roaming the screen freezes from 2 to 30 seconds. The RDP client on the win xp sp3 laptop and the symbol mc9190 is version 6.0. The RDP client on the neo is version 5.2. I have changed the security layer on the RDP host to RDP security layer (based on forums on the internet), because older RDP clients seem to have issues with the RDP 7.1 protocol on the Win server 2088 R2. Psion adviced us to do some network logging activity on the different devices. We made this logging via wireshark, and based on this the conclusion of Psion is that the server fails in handling tcp-requests. Can anyone give me a second opinion by analysing the wireshark loggings. Thanks in advance. Regards Patrick

    Read the article

  • Stream audio source from Mac OS X as MP3

    - by Adam Backstrom
    I'd like to broadcast audio from my Mac desktop to my Palm Pre, as the Pre is more portable and I can use it in the kitchen, or while I'm exercising, and so on. I can already capture the audio using Soundflower, but how might I create an MP3 stream out of the audio input device? For all intents and purposes, Soundflower can reduce this question down to, "How can I create an MP3 stream from the built-in microphone on my Mac?" as the answer can be applied equally well to iTunes output.

    Read the article

  • Can't start apache in linux, because of proxy module

    - by Silmaril89
    When I try to start apache or run the command, httpd -M each fail and print the following error: httpd: Syntax error on line 137 of /etc/httpd/conf/httpd.conf: Syntax error on line 2 of /etc/httpd/conf.d/proxy_ajp.conf: Cannot load /etc/httpd/modules/mod_proxy_ajp.so into server: /etc/httpd/modules/mod_proxy_ajp.so: undefined symbol: proxy_module Any ideas on how to fix this? Thanks.

    Read the article

  • How to get stack dump from crashing ASP.NET process?

    - by Dylan
    An unhandled exception ('System.Net.Sockets.SocketException') occurred in w3wp.exe [9740]. Just-In-Time debugging this exception failed with the following error: Debugger could not be started because no user is logged on. We're getting the above error in the Application log. Is there a way to capture a .NET stack trace that doesn't require user interactivity?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • cannot access a site from Mac OSX Lion but can from other machines on network?

    - by house9
    SOLVED: The issue is with the hamachi client, hamachi is hi-jacking all of the 5.0.0.0/8 address block http://en.wikipedia.org/wiki/Hamachi_(software)#Criticism http://b.logme.in/2012/11/07/changes-to-hamachi-on-november-19th/ The fix on Mac LogMeIn Hamachi Preferences Settings Advanced Peer Connections IP protocol mode IPv6 only (default is both) If you can only connect to some of your network over IPv4 this 'fix' will NOT work for you ----- A few weeks ago I started using a service - https://semaphoreapp.com I think they made DNS changes a week ago and ever since I cannot access the site from my Mac OSX Lion (10.7.4) machine (my main development machine) but I can access the site from other machines on my network ipad windows machine MacMini (10.6.8) After some google searching I tried both of these dscacheutil -flushcache sudo killall -HUP mDNSResponder but no go, I've contacted semaphoreapp as well, but nothing so far - also of interest, one of my colleagues has the exact same problem, cannot access via Mac OSX Lion but can via windows machine, we work remotely and are not on the same ISP some additional info Lion (10.7.4) cannot access site host semaphoreapp.com semaphoreapp.com has address 5.9.53.16 ping semaphoreapp.com PING semaphoreapp.com (5.9.53.16): 56 data bytes Request timeout for icmp_seq 0 Request timeout for icmp_seq 1 Request timeout for icmp_seq 2 Request timeout for icmp_seq 3 ping: sendto: No route to host Request timeout for icmp_seq 4 ping: sendto: Host is down Request timeout for icmp_seq 5 ping: sendto: Host is down Request timeout for icmp_seq 6 ping: sendto: Host is down Request timeout for icmp_seq 7 .... traceroute semaphoreapp.com traceroute to semaphoreapp.com (5.9.53.16), 64 hops max, 52 byte packets 1 * * * 2 * * * traceroute: sendto: No route to host 3 traceroute: wrote semaphoreapp.com 52 chars, ret=-1 *traceroute: sendto: Host is down traceroute: wrote semaphoreapp.com 52 chars, ret=-1 .... and MacMini (10.6.8) can access it host semaphoreapp.com semaphoreapp.com has address 5.9.53.16 ping semaphoreapp.com PING semaphoreapp.com (5.9.53.16): 56 data bytes 64 bytes from 5.9.53.16: icmp_seq=0 ttl=44 time=191.458 ms 64 bytes from 5.9.53.16: icmp_seq=1 ttl=44 time=202.923 ms 64 bytes from 5.9.53.16: icmp_seq=2 ttl=44 time=180.746 ms 64 bytes from 5.9.53.16: icmp_seq=3 ttl=44 time=200.616 ms 64 bytes from 5.9.53.16: icmp_seq=4 ttl=44 time=178.818 ms .... traceroute semaphoreapp.com traceroute to semaphoreapp.com (5.9.53.16), 64 hops max, 52 byte packets 1 192.168.0.1 (192.168.0.1) 1.677 ms 1.446 ms 1.445 ms 2 * LOCAL ISP 11.957 ms * 3 etc... 10.704 ms 14.183 ms 9.341 ms 4 etc... 32.641 ms 12.147 ms 10.850 ms 5 etc.... 44.205 ms 54.563 ms 36.243 ms 6 vlan139.car1.seattle1.level3.net (4.53.145.165) 50.136 ms 45.873 ms 30.396 ms 7 ae-32-52.ebr2.seattle1.level3.net (4.69.147.182) 31.926 ms 40.507 ms 49.993 ms 8 ae-2-2.ebr2.denver1.level3.net (4.69.132.54) 78.129 ms 59.674 ms 49.905 ms 9 ae-3-3.ebr1.chicago2.level3.net (4.69.132.62) 99.019 ms 82.008 ms 76.074 ms 10 ae-1-100.ebr2.chicago2.level3.net (4.69.132.114) 96.185 ms 75.658 ms 75.662 ms 11 ae-6-6.ebr2.washington12.level3.net (4.69.148.145) 104.322 ms 105.563 ms 118.480 ms 12 ae-5-5.ebr2.washington1.level3.net (4.69.143.221) 93.646 ms 99.423 ms 96.067 ms 13 ae-41-41.ebr2.paris1.level3.net (4.69.137.49) 177.744 ms ae-44-44.ebr2.paris1.level3.net (4.69.137.61) 199.363 ms 198.405 ms 14 ae-47-47.ebr1.frankfurt1.level3.net (4.69.143.141) 176.876 ms ae-45-45.ebr1.frankfurt1.level3.net (4.69.143.133) 170.994 ms ae-46-46.ebr1.frankfurt1.level3.net (4.69.143.137) 177.308 ms 15 ae-61-61.csw1.frankfurt1.level3.net (4.69.140.2) 176.769 ms ae-91-91.csw4.frankfurt1.level3.net (4.69.140.14) 178.676 ms 173.644 ms 16 ae-2-70.edge7.frankfurt1.level3.net (4.69.154.75) 180.407 ms ae-3-80.edge7.frankfurt1.level3.net (4.69.154.139) 174.861 ms 176.578 ms 17 as33891-net.edge7.frankfurt1.level3.net (195.16.162.94) 175.448 ms 185.658 ms 177.081 ms 18 hos-bb1.juniper4.rz16.hetzner.de (213.239.240.202) 188.700 ms 190.332 ms 188.196 ms 19 hos-tr4.ex3k14.rz16.hetzner.de (213.239.233.98) 199.632 ms hos-tr3.ex3k14.rz16.hetzner.de (213.239.233.66) 185.938 ms hos-tr2.ex3k14.rz16.hetzner.de (213.239.230.34) 182.378 ms 20 * * * 21 * * * 22 * * * any ideas? EDIT: adding tcpdump MacMini (which can connect) while running - ping semaphoreapp.com sudo tcpdump -v -i en0 dst semaphoreapp.com Password: tcpdump: listening on en0, link-type EN10MB (Ethernet), capture size 65535 bytes 17:33:03.337165 IP (tos 0x0, ttl 64, id 20153, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->3129)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 0, length 64 17:33:04.337279 IP (tos 0x0, ttl 64, id 26049, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->1a21)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 1, length 64 17:33:05.337425 IP (tos 0x0, ttl 64, id 47854, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->c4f3)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 2, length 64 17:33:06.337548 IP (tos 0x0, ttl 64, id 24772, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->1f1e)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 3, length 64 17:33:07.337670 IP (tos 0x0, ttl 64, id 8171, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->5ff7)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 4, length 64 17:33:08.337816 IP (tos 0x0, ttl 64, id 35810, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->f3ff)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 5, length 64 17:33:09.337948 IP (tos 0x0, ttl 64, id 31120, offset 0, flags [none], proto ICMP (1), length 84, bad cksum 0 (->652)!) 192.168.0.6 > static.16.53.9.5.clients.your-server.de: ICMP echo request, id 61918, seq 6, length 64 ^C 7 packets captured 1047 packets received by filter 0 packets dropped by kernel OSX Lion (cannot connect) while running - ping semaphoreapp.com # wireless ~ $ sudo tcpdump -v -i en1 dst semaphoreapp.com Password: tcpdump: listening on en1, link-type EN10MB (Ethernet), capture size 65535 bytes ^C 0 packets captured 262 packets received by filter 0 packets dropped by kernel and # wired ~ $ sudo tcpdump -v -i en0 dst semaphoreapp.com tcpdump: listening on en0, link-type EN10MB (Ethernet), capture size 65535 bytes ^C 0 packets captured 219 packets received by filter 0 packets dropped by kernel above output after Request timeout for icmp_seq 25 or 30 times from ping. I don't know much about tcpdump, but to me it doesn't seem like the ping requests are leaving my machine?

    Read the article

< Previous Page | 67 68 69 70 71 72 73 74 75 76 77 78  | Next Page >