Search Results

Search found 4498 results on 180 pages for 'expression'.

Page 72/180 | < Previous Page | 68 69 70 71 72 73 74 75 76 77 78 79  | Next Page >

  • XPath and XML: Multiple namespaces

    - by emragins
    So I have a document that looks like <a xmlns="uri1" xmlns:pre2="uri2"> <b xmlns:pre3="uri3"> <pre3:c> <stuff></stuff> <goes></goes> <here></here> </pre3:c> <pre3:d xmlns="uri4"> <under></under> <the></the> <tree></tree> </pre3:d> </b> </a> I want an xpath expression that will get me <under>. This has a namespaceURI of uri4. Right now my expression looks like: //ns:a/ns:b/pre3:d/pre4:under I have the namespace manager add 'ns' for the default namespace (uri1 in this case) and I have it defined with pre2, pre3, and pre4 for uri2, uri3, and uri4 respectively. I get the error "Expression must evaluate to a node-set." I know that the node exists. I know that everything up until the pre4:under in my xpath works fine as I use it in the rest of the document with no issues. It's the additional pre4:under that causes the error, and I'm not sure why. Any ideas? Thanks.

    Read the article

  • Using DisplayFor inside a display template

    - by Oenotria
    I've created a htmlhelper extension to reduce the amount of repetitive markup when creating forms: public static MvcHtmlString RenderField<TModel, TValue>(this HtmlHelper<TModel> htmlHelper, Expression<Func<TModel, TValue>> expression) { return htmlHelper.DisplayFor(expression, "formfield"); } The idea being that inside my views I can just write @Html.RenderField(x=>x.MyFieldName) and it will print the label and the field's content with the appropriate div tags in place already. Inside the displaytemplates folder I have created formfield.cshtml containing the following: <div class="display-group"> <div class="display-label"> @Html.LabelFor(x => x) </div> <div class="display-field"> @Html.DisplayFor(x => x) </div> </div> Unfortunately it doesn't appear that it is possible to nest DisplayFor inside a display template (it doesn't render anything). I don't want to just using @Model because then I won't get checkboxes for boolean values, calendar controls for dates etc. Is there a good way around this?

    Read the article

  • JavaScript: why `null == 0` is false?

    - by lemonedo
    I had to write a routine that increments the value of a variable by 1 if it is a number, or assigns 0 to the variable if it is not a number. The variable can be incremented by the expression, or be assigned null. No other write access to the variable is allowed. So, the variable can be in three states: it is 0, a positive integer, or null. My first implementation was: v >= 0 ? v += 1 : v = 0 (Yes, I admit that v === null ? v = 0 : v += 1 is the exact solution, but I wanted to be concise then.) It failed since null >= 0 is true. I was confused, since if a value is not a number, an numeric expression involving it must be false always. Then I found that null is like 0, since null + 1 == 1, 1 / null == Infinity, Math.pow(2.718281828, null) == 1, ... Strangely enough, however, null == 0 is evaluated to false. I guess null is the only value that makes the following expression false: (v == 0) === (v >= 0 && v <= 0) So why null is so special in JavaScript?

    Read the article

  • Nested bind expressions

    - by user328543
    This is a followup question to my previous question. #include <functional> int foo(void) {return 2;} class bar { public: int operator() (void) {return 3;}; int something(int a) {return a;}; }; template <class C> auto func(C&& c) -> decltype(c()) { return c(); } template <class C> int doit(C&& c) { return c();} template <class C> void func_wrapper(C&& c) { func( std::bind(doit<C>, std::forward<C>(c)) ); } int main(int argc, char* argv[]) { // call with a function pointer func(foo); func_wrapper(foo); // error // call with a member function bar b; func(b); func_wrapper(b); // call with a bind expression func(std::bind(&bar::something, b, 42)); func_wrapper(std::bind(&bar::something, b, 42)); // error // call with a lambda expression func( [](void)->int {return 42;} ); func_wrapper( [](void)->int {return 42;} ); return 0; } I'm getting a compile errors deep in the C++ headers: functional:1137: error: invalid initialization of reference of type ‘int (&)()’ from expression of type ‘int (*)()’ functional:1137: error: conversion from ‘int’ to non-scalar type ‘std::_Bind(bar, int)’ requested func_wrapper(foo) is supposed to execute func(doit(foo)). In the real code it packages the function for a thread to execute. func would the function executed by the other thread, doit sits in between to check for unhandled exceptions and to clean up. But the additional bind in func_wrapper messes things up...

    Read the article

  • Checked and Unchecked operators don't seem to be working when...

    - by flockofcode
    1) Is UNCHECKED operator in effect only when expression inside UNCHECKED context uses an explicit cast ( such as byte b1=unchecked((byte)2000); ) and when conversion to particular type can happen implicitly? I’m assuming this since the following expression throws a compile time error: byte b1=unchecked(2000); //compile time error 2) a) Do CHECKED and UNCHECKED operators work only when resulting value of an expression or conversion is of an integer type? I’m assuming this since in the first example ( where double type is being converted to integer type ) CHECKED operator works as expected: double m = double.MaxValue; b=checked((byte)m); // reports an exception , while in second example ( where double type is being converted to a float type ) CHECKED operator doesn’t seem to be working. since it doesn't throw an exception: double m = double.MaxValue; float f = checked((float)m); // no exception thrown b) Why don’t the two operators also work with expressions where type of a resulting value is of floating-point type? 2) Next quote is from Microsoft’s site: The unchecked keyword is used to control the overflow-checking context for integral-type arithmetic operations and conversions I’m not sure I understand what exactly have expressions and conversions such as unchecked((byte)(100+200)); in common with integrals? Thank you

    Read the article

  • GetLocalValueEnumerator() Not Returning All Properties

    - by a_hardin
    I am trying to perform validation in my WPF application using the solution in Detecting WPF Validation Errors. public static bool IsValid(DependencyObject parent) { // Validate all the bindings on the parent bool valid = true; LocalValueEnumerator localValues = parent.GetLocalValueEnumerator(); while (localValues.MoveNext()) { LocalValueEntry entry = localValues.Current; if (BindingOperations.IsDataBound(parent, entry.Property)) { Binding binding = BindingOperations.GetBinding(parent, entry.Property); foreach (ValidationRule rule in binding.ValidationRules) { ValidationResult result = rule.Validate(parent.GetValue(entry.Property), null); if (!result.IsValid) { BindingExpression expression = BindingOperations.GetBindingExpression(parent, entry.Property); System.Windows.Controls.Validation.MarkInvalid(expression, new ValidationError(rule, expression, result.ErrorContent, null)); valid = false; } } } } // Validate all the bindings on the children for (int i = 0; i != VisualTreeHelper.GetChildrenCount(parent); ++i) { DependencyObject child = VisualTreeHelper.GetChild(parent, i); if (!IsValid(child)) { valid = false; } } return valid; } The problem I am running into is that when I step through the code for a TextBox, I'm not getting the Text property. The only properties I get are "PageHeight", "Instance", and "UndoManagerInstance". Therefore, I can not Validate the rules for the binding on the TextBox. Does anyone have any idea why I wouldn't be getting the correct properties? Is there another way to force validaton on controls in WPF? I haven't been able to find anyone else who has had this problem. Update: The TextBoxes I am trying to validate are within a DataTemplate. I found that if I copy one of the TextBoxes and place it directly in the Window, I am able to get the data. Using Woodstock, I saw that the data source for the TextBoxes in the template is "ParentTemplate", but it's "Local" for the TextBox outside of the template. So, the question now is, how can I get the DependencyProperties for controls inside a DataTemplate?

    Read the article

  • jqgrid questions

    - by user508518
    Hi All- I recently posted a question on SO on freezing columns in jqgrid(http://stackoverflow.com/questions/4586924/jqgrid-freeze-columns). I got the following solution to be working in IE8, but its not all perfect: I set to use two css classes, one for header and other one for the rows like below: .jqgridbodyLock{ position:relative; left: expression(parentNode.parentNode.parentNode.parentNode.parentNode.scrollLeft); z-index: 10; } .jqgridheaderLocked{ position:relative; left: expression(parentNode.parentNode.parentNode.parentNode.parentNode.scrollLeft); /* IE5+ only */ z-index:30; } Then in colModel, I used the property classes {name:'column1', width:100, index:'column1', sorttype:"string", classes:'jqgridbodyLock'},//lock the body row and to lock the respective header I used code as below: $("#grid").setLabel("column1","column1","jqgridheaderLocked"); Though the solution works, I have the following problems: 1) The header values shake a lot when scrolling to the right though they remain frozen 2) The body values of the frozen column disappear when the cursor is taken out of the grid. 3) How to lock a normal table in firefox. I see that 'expression' is exclusive only to IE browser Thanks a lot

    Read the article

  • Skinny controller in ASP.NET MVC 4

    - by thangchung
    Rails community are always inspire a lot of best ideas. I really love this community by the time. One of these is "Fat models and skinny controllers". I have spent a lot of time on ASP.NET MVC, and really I did some miss-takes, because I made the controller so fat. That make controller is really dirty and very hard to maintain in the future. It is violate seriously SRP principle and KISS as well. But how can we achieve that in ASP.NET MVC? That question is really clear after I read "Manning ASP.NET MVC 4 in Action". It is simple that we can separate it into ActionResult, and try to implementing logic and persistence data inside this. In last 2 years, I have read this from Jimmy Bogard blog, but in that time I never had a consideration about it. That's enough for talking now. I just published a sample on ASP.NET MVC 4, implemented on Visual Studio 2012 RC at here. I used EF framework at here for implementing persistence layer, and also use 2 free templates from internet to make the UI for this sample. In this sample, I try to implementing the simple magazine website that managing all articles, categories and news. It is not finished at all in this time, but no problems, because I just show you about how can we make the controller skinny. And I wanna hear more about your ideas. The first thing, I am abstract the base ActionResult class like this:    public abstract class MyActionResult : ActionResult, IEnsureNotNull     {         public abstract void EnsureAllInjectInstanceNotNull();     }     public abstract class ActionResultBase<TController> : MyActionResult where TController : Controller     {         protected readonly Expression<Func<TController, ActionResult>> ViewNameExpression;         protected readonly IExConfigurationManager ConfigurationManager;         protected ActionResultBase (Expression<Func<TController, ActionResult>> expr)             : this(DependencyResolver.Current.GetService<IExConfigurationManager>(), expr)         {         }         protected ActionResultBase(             IExConfigurationManager configurationManager,             Expression<Func<TController, ActionResult>> expr)         {             Guard.ArgumentNotNull(expr, "ViewNameExpression");             Guard.ArgumentNotNull(configurationManager, "ConfigurationManager");             ViewNameExpression = expr;             ConfigurationManager = configurationManager;         }         protected ViewResult GetViewResult<TViewModel>(TViewModel viewModel)         {             var m = (MethodCallExpression)ViewNameExpression.Body;             if (m.Method.ReturnType != typeof(ActionResult))             {                 throw new ArgumentException("ControllerAction method '" + m.Method.Name + "' does not return type ActionResult");             }             var result = new ViewResult             {                 ViewName = m.Method.Name             };             result.ViewData.Model = viewModel;             return result;         }         public override void ExecuteResult(ControllerContext context)         {             EnsureAllInjectInstanceNotNull();         }     } I also have an interface for validation all inject objects. This interface make sure all inject objects that I inject using Autofac container are not null. The implementation of this as below public interface IEnsureNotNull     {         void EnsureAllInjectInstanceNotNull();     } Afterwards, I am just simple implementing the HomePageViewModelActionResult class like this public class HomePageViewModelActionResult<TController> : ActionResultBase<TController> where TController : Controller     {         #region variables & ctors         private readonly ICategoryRepository _categoryRepository;         private readonly IItemRepository _itemRepository;         private readonly int _numOfPage;         public HomePageViewModelActionResult(Expression<Func<TController, ActionResult>> viewNameExpression)             : this(viewNameExpression,                    DependencyResolver.Current.GetService<ICategoryRepository>(),                    DependencyResolver.Current.GetService<IItemRepository>())         {         }         public HomePageViewModelActionResult(             Expression<Func<TController, ActionResult>> viewNameExpression,             ICategoryRepository categoryRepository,             IItemRepository itemRepository)             : base(viewNameExpression)         {             _categoryRepository = categoryRepository;             _itemRepository = itemRepository;             _numOfPage = ConfigurationManager.GetAppConfigBy("NumOfPage").ToInteger();         }         #endregion         #region implementation         public override void ExecuteResult(ControllerContext context)         {             base.ExecuteResult(context);             var cats = _categoryRepository.GetCategories();             var mainViewModel = new HomePageViewModel();             var headerViewModel = new HeaderViewModel();             var footerViewModel = new FooterViewModel();             var mainPageViewModel = new MainPageViewModel();             headerViewModel.SiteTitle = "Magazine Website";             if (cats != null && cats.Any())             {                 headerViewModel.Categories = cats.ToList();                 footerViewModel.Categories = cats.ToList();             }             mainPageViewModel.LeftColumn = BindingDataForMainPageLeftColumnViewModel();             mainPageViewModel.RightColumn = BindingDataForMainPageRightColumnViewModel();             mainViewModel.Header = headerViewModel;             mainViewModel.DashBoard = new DashboardViewModel();             mainViewModel.Footer = footerViewModel;             mainViewModel.MainPage = mainPageViewModel;             GetViewResult(mainViewModel).ExecuteResult(context);         }         public override void EnsureAllInjectInstanceNotNull()         {             Guard.ArgumentNotNull(_categoryRepository, "CategoryRepository");             Guard.ArgumentNotNull(_itemRepository, "ItemRepository");             Guard.ArgumentMustMoreThanZero(_numOfPage, "NumOfPage");         }         #endregion         #region private functions         private MainPageRightColumnViewModel BindingDataForMainPageRightColumnViewModel()         {             var mainPageRightCol = new MainPageRightColumnViewModel();             mainPageRightCol.LatestNews = _itemRepository.GetNewestItem(_numOfPage).ToList();             mainPageRightCol.MostViews = _itemRepository.GetMostViews(_numOfPage).ToList();             return mainPageRightCol;         }         private MainPageLeftColumnViewModel BindingDataForMainPageLeftColumnViewModel()         {             var mainPageLeftCol = new MainPageLeftColumnViewModel();             var items = _itemRepository.GetNewestItem(_numOfPage);             if (items != null && items.Any())             {                 var firstItem = items.First();                 if (firstItem == null)                     throw new NoNullAllowedException("First Item".ToNotNullErrorMessage());                 if (firstItem.ItemContent == null)                     throw new NoNullAllowedException("First ItemContent".ToNotNullErrorMessage());                 mainPageLeftCol.FirstItem = firstItem;                 if (items.Count() > 1)                 {                     mainPageLeftCol.RemainItems = items.Where(x => x.ItemContent != null && x.Id != mainPageLeftCol.FirstItem.Id).ToList();                 }             }             return mainPageLeftCol;         }         #endregion     }  Final step, I get into HomeController and add some line of codes like this [Authorize]     public class HomeController : BaseController     {         [AllowAnonymous]         public ActionResult Index()         {             return new HomePageViewModelActionResult<HomeController>(x=>x.Index());         }         [AllowAnonymous]         public ActionResult Details(int id)         {             return new DetailsViewModelActionResult<HomeController>(x => x.Details(id), id);         }         [AllowAnonymous]         public ActionResult Category(int id)         {             return new CategoryViewModelActionResult<HomeController>(x => x.Category(id), id);         }     } As you see, the code in controller is really skinny, and all the logic I move to the custom ActionResult class. Some people said, it just move the code out of controller and put it to another class, so it is still hard to maintain. Look like it just move the complicate codes from one place to another place. But if you have a look and think it in details, you have to find out if you have code for processing all logic that related to HttpContext or something like this. You can do it on Controller, and try to delegating another logic  (such as processing business requirement, persistence data,...) to custom ActionResult class. Tell me more your thinking, I am really willing to hear all of its from you guys. All source codes can be find out at here. Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="http://weblogs.asp.net//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs");

    Read the article

  • Search files for text matching format of a Unix directory

    - by BrandonKowalski
    I am attempting to search through all the files in a directory for text matching the pattern of any arbitrary directory. The output of this I hope to use to make a list of all directories referenced in the files (this part I think I can figure out on my own). I have looked at various regex resources and made my own expression that seems to work in the browser based tool but not with grep in the command line. /\w+[(/\w+)]+ My understanding so far is the above expression will look for the beginning / of a directory then look for an indeterminate number of characters before looking for a repeating block of the same thing. Any guidance would be greatly appreciated.

    Read the article

  • Redirect URL using Mac OS X Server Lion

    - by pheedsta
    I have just set up a Mac Mini with OS X Lion Server to host my own website. I have registered multiple domain names, but I would like the user to be automatically redirected to my main domain name if they type in one of the others (i.e. if the user types in www.myotherdomain.com the URL will be forwarded instantly to www.mymaindomain.com). In the Web settings of Server.app, you can easily add additional domains (which works) but it does not change the URL in the browser to www.mymaindomain.com. It keeps www.myotherdomain.com whilst still displaying the correct pages. Does the redirects or alias options do what I want? I can't seem to work out how to use them (there seems to be no documentation that I can find). In Redirects, you need to enter: 'Redirect Type' (Exact Match or Regular Expression) 'Redirect Path' 'Destination URL' 'Redirect Status' (Original was permanently moved, etc) In Alias, you need to enter: 'Alias Type' (Exact Match or Regular Expression) 'Alias Path' 'Destination Folder' Any help would be great.

    Read the article

  • Two-state script monitor not auto-resolving in SCOM

    - by DeliriumTremens
    This script runs, and if it returns 'erro' an alert is generated in SCOM. The alert is set to resolve when the monitor returns to healthy state. I have tested the script with cscript and it returns the correct values in each state. I'm baffled as to why it generates an alert on 'erro' but will not auto-resolve on 'ok': Option Explicit On Error Resume Next Dim objFSO Dim TargetFile Dim objFile Dim oAPI, oBag Dim StateDataType Dim FileSize Set oAPI = CreateObject("MOM.ScriptAPI") Set oBag = oAPI.CreatePropertyBag() TargetFile = "\\server\share\file.zip" Set objFSO = CreateObject("scripting.filesystemobject") Set objFile = objFSO.GetFile(TargetFile) FileSize = objFile.Size / 1024 If FileSize < 140000 Then Call oBag.AddValue("State", "erro") Else Call oBag.AddValue("State", "ok") End If Call oAPI.AddItem(oBag) Call oAPI.Return(oBag) Unhealthy expression: Property[@Name='State'] Equals erro Health expression: Property[@Name='State'] Equals ok If anyone can shed some light onto what I might be missing, that would be great!

    Read the article

  • Smart auto detect and replace URLs with anchor tags

    - by Robert Koritnik
    I've written a regular expression that automatically detects URLs in free text that users enter. This is not such a simple task as it may seem at first. Jeff Atwood writes about it in his post. His regular expression works, but needs extra code after detection is done. I've managed to write a regular expression that does everything in a single go. This is how it looks like (I've broken it down into separate lines to make it more understandable what it does): 1 (?<outer>\()? 2 (?<scheme>http(?<secure>s)?://)? 3 (?<url> 4 (?(scheme) 5 (?:www\.)? 6 | 7 www\. 8 ) 9 [a-z0-9] 10 (?(outer) 11 [-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+(?=\)) 12 | 13 [-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+ 14 ) 15 ) 16 (?<ending>(?(outer)\))) As you may see, I'm using named capture groups (used later in Regex.Replace()) and I've also included some local characters (cšžcd), that allow our localised URL to be parsed as well. You can easily omit them if you'd like. Anyway. Here's what it does (referring to line numbers): 1 - detects if URL starts with open braces (is contained inside braces) and stores it in "outer" named capture group 2 - checks if it starts with URL scheme also detecting whether scheme is SSL or not 3 - starts parsing URL itself (will store it in "url" named capture group) 4-8 - if statement that says: if "sheme" was present then www. part is optional, otherwise mandatory for a string to be a link (so this regular expression detects all strings that start with either http or www) 9 - first character after http:// or www. should be either a letter or a number (this can be extended if you would like to cover even more links, but I've decided to omit other characters because I can't remember a link that would start with some other character 10-14 - if statement that says: if "outer" (braces) was present capture everything up to the last closing braces otherwise capture all 15 - closes the named capture group for URL 16 - if open braces was present, capture closing braces as well and store it in "ending" named capture group First and last line used to have \s* in them as well, so user could also write open braces and put a space inside before pasting link. Anyway. My code that does link replacement with actual anchor HTML elements looks exactly like this: value = Regex.Replace( value, @"(?<outer>\()?(?<scheme>http(?<secure>s)?://)?(?<url>(?(scheme)(?:www\.)?|www\.)[a-z0-9](?(outer)[-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+(?=\))|[-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+))(?<ending>(?(outer)\)))", "${outer}<a href=\"http${secure}://${url}\">http${secure}://${url}</a>${ending}", RegexOptions.Compiled | RegexOptions.CultureInvariant | RegexOptions.IgnoreCase); As you can see I'm using named capture groups to replace link with an Anchor tag: ${outer}<a href=\"http${secure}://${url}\">http${secure}://${url}</a>${ending} I could as well omit the http(s) part in anchor display to make links look friendlier, but for now I decided not to. Question I would like for my links to be replaced with shortenings as well. So when user copies a very long links (for instance if they would copy a link from google maps that usually generates long links I would like to shorten the visible part of the anchor tag. Link would work, but visible part of an anchor tag would be shortened to some number of characters. Does the replace string support notations like that so I can stil use a singe Regex.Replace() call?

    Read the article

  • Can a conforming C implementation #define NULL to be something wacky

    - by janks
    I'm asking because of the discussion that's been provoked in this thread: http://stackoverflow.com/questions/2597142/when-was-the-null-macro-not-0/2597232 Trying to have a serious back-and-forth discussion using comments under other people's replies is not easy or fun. So I'd like to hear what our C experts think without being restricted to 500 characters at a time. The C standard has precious few words to say about NULL and null pointer constants. There's only two relevant sections that I can find. First: 3.2.2.3 Pointers An integral constant expression with the value 0, or such an expression cast to type void * , is called a null pointer constant. If a null pointer constant is assigned to or compared for equality to a pointer, the constant is converted to a pointer of that type. Such a pointer, called a null pointer, is guaranteed to compare unequal to a pointer to any object or function. and second: 4.1.5 Common definitions <stddef.h> The macros are NULL which expands to an implementation-defined null pointer constant; The question is, can NULL expand to an implementation-defined null pointer constant that is different from the ones enumerated in 3.2.2.3? In particular, could it be defined as: #define NULL __builtin_magic_null_pointer Or even: #define NULL ((void*)-1) My reading of 3.2.2.3 is that it specifies that an integral constant expression of 0, and an integral constant expression of 0 cast to type void* must be among the forms of null pointer constant that the implementation recognizes, but that it isn't meant to be an exhaustive list. I believe that the implementation is free to recognize other source constructs as null pointer constants, so long as no other rules are broken. So for example, it is provable that #define NULL (-1) is not a legal definition, because in if (NULL) do_stuff(); do_stuff() must not be called, whereas with if (-1) do_stuff(); do_stuff() must be called; since they are equivalent, this cannot be a legal definition of NULL. But the standard says that integer-to-pointer conversions (and vice-versa) are implementation-defined, therefore it could define the conversion of -1 to a pointer as a conversion that produces a null pointer. In which case if ((void*)-1) would evaluate to false, and all would be well. So what do other people think? I'd ask for everybody to especially keep in mind the "as-if" rule described in 2.1.2.3 Program execution. It's huge and somewhat roundabout, so I won't paste it here, but it essentially says that an implementation merely has to produce the same observable side-effects as are required of the abstract machine described by the standard. It says that any optimizations, transformations, or whatever else the compiler wants to do to your program are perfectly legal so long as the observable side-effects of the program aren't changed by them. So if you are looking to prove that a particular definition of NULL cannot be legal, you'll need to come up with a program that can prove it. Either one like mine that blatantly breaks other clauses in the standard, or one that can legally detect whatever magic the compiler has to do to make the strange NULL definition work. Steve Jessop found an example of way for a program to detect that NULL isn't defined to be one of the two forms of null pointer constants in 3.2.2.3, which is to stringize the constant: #define stringize_helper(x) #x #define stringize(x) stringize_helper(x) Using this macro, one could puts(stringize(NULL)); and "detect" that NULL does not expand to one of the forms in 3.2.2.3. Is that enough to render other definitions illegal? I just don't know. Thanks!

    Read the article

  • Advanced Regex: Smart auto detect and replace URLs with anchor tags

    - by Robert Koritnik
    I've written a regular expression that automatically detects URLs in free text that users enter. This is not such a simple task as it may seem at first. Jeff Atwood writes about it in his post. His regular expression works, but needs extra code after detection is done. I've managed to write a regular expression that does everything in a single go. This is how it looks like (I've broken it down into separate lines to make it more understandable what it does): 1 (?<outer>\()? 2 (?<scheme>http(?<secure>s)?://)? 3 (?<url> 4 (?(scheme) 5 (?:www\.)? 6 | 7 www\. 8 ) 9 [a-z0-9] 10 (?(outer) 11 [-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+(?=\)) 12 | 13 [-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+ 14 ) 15 ) 16 (?<ending>(?(outer)\))) As you may see, I'm using named capture groups (used later in Regex.Replace()) and I've also included some local characters (cšžcd), that allow our localised URLs to be parsed as well. You can easily omit them if you'd like. Anyway. Here's what it does (referring to line numbers): 1 - detects if URL starts with open braces (is contained inside braces) and stores it in "outer" named capture group 2 - checks if it starts with URL scheme also detecting whether scheme is SSL or not 3 - start parsing URL itself (will store it in "url" named capture group) 4-8 - if statement that says: if "sheme" was present then www. part is optional, otherwise mandatory for a string to be a link (so this regular expression detects all strings that start with either http or www) 9 - first character after http:// or www. should be either a letter or a number (this can be extended if you'd like to cover even more links, but I've decided not to because I can't think of a link that would start with some obscure character) 10-14 - if statement that says: if "outer" (braces) was present capture everything up to the last closing braces otherwise capture all 15 - closes the named capture group for URL 16 - if open braces were present, capture closing braces as well and store it in "ending" named capture group First and last line used to have \s* in them as well, so user could also write open braces and put a space inside before pasting link. Anyway. My code that does link replacement with actual anchor HTML elements looks exactly like this: value = Regex.Replace( value, @"(?<outer>\()?(?<scheme>http(?<secure>s)?://)?(?<url>(?(scheme)(?:www\.)?|www\.)[a-z0-9](?(outer)[-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+(?=\))|[-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+))(?<ending>(?(outer)\)))", "${outer}<a href=\"http${secure}://${url}\">http${secure}://${url}</a>${ending}", RegexOptions.Compiled | RegexOptions.CultureInvariant | RegexOptions.IgnoreCase); As you can see I'm using named capture groups to replace link with an Anchor tag: "${outer}<a href=\"http${secure}://${url}\">http${secure}://${url}</a>${ending}" I could as well omit the http(s) part in anchor display to make links look friendlier, but for now I decided not to. Question I would like my links to be replaced with shortenings as well. So when user copies a very long link (for instance if they would copy a link from google maps that usually generates long links) I would like to shorten the visible part of the anchor tag. Link would work, but visible part of an anchor tag would be shortened to some number of characters. I could as well append ellipsis at the end of at all possible (and make things even more perfect). Does Regex.Replace() method support replacement notations so that I can still use a single call? Something similar as string.Format() method does when you'd like to format values in string format (decimals, dates etc...).

    Read the article

  • Long string insertion with sed

    - by Luis Varca
    I am trying to use this expression to insert the contents of one text file into another after a give string. This is a simple bash script: TEXT=`cat file1.txt` sed -i "/teststring/a \ $TEXT" file2.txt This returns an error, "sed: -e expression #1, char 37: unknown command: `M'" The issue is in the fact that the contents of file1.txt are actually a private certificate so it's a large amount of text and unusual characters which seems to be causing an issue. If I replace $TEXT with a simple ASCII value it works but when it reads the large content of file1.txt it fails with that error. Is there some way to carry out this action? Is my syntax off with sed or my quote placement wrong?

    Read the article

  • trie reg exp parse step over char and continue

    - by forest.peterson
    Setup: 1) a string trie database formed from linked nodes and a vector array linking to the next node terminating in a leaf, 2) a recursive regular expression function that if A) char '*' continues down all paths until string length limit is reached, then continues down remaining string paths if valid, and B) char '?' continues down all paths for 1 char and then continues down remaining string paths if valid. 3) after reg expression the candidate strings are measured for edit distance against the 'try' string. Problem: the reg expression works fine for adding chars or swapping ? for a char but if the remaining string has an error then there is not a valid path to a terminating leaf; making the matching function redundant. I tried adding a 'step-over' ? char if the end of the node vector was reached and then followed every path of that node - allowing this step-over only once; resulted in a memory exception; I cannot find logically why it is accessing the vector out of range - bactracking? Questions: 1) how can the regular expression step over an invalid char and continue with the path? 2) why is swapping the 'sticking' char for '?' resulting in an overflow? Function: void Ontology::matchRegExpHelper(nodeT *w, string inWild, Set<string> &matchSet, string out, int level, int pos, int stepover) { if (inWild=="") { matchSet.add(out); } else { if (w->alpha.size() == pos) { int testLength = out.length() + inWild.length(); if (stepover == 0 && matchSet.size() == 0 && out.length() > 8 && testLength == tokenLength) {//candidate generator inWild[0] = '?'; matchRegExpHelper(w, inWild, matchSet, out, level, 0, stepover+1); } else return; //giveup on this path } if (inWild[0] == '?' || (inWild[0] == '*' && (out.length() + inWild.length() ) == level ) ) { //wild matchRegExpHelper(w->alpha[pos].next, inWild.substr(1), matchSet, out+w->alpha[pos].letter, level, 0, stepover);//follow path -> if ontology is full, treat '*' like a '?' } else if (inWild[0] == '*') matchRegExpHelper(w->alpha[pos].next, '*'+inWild.substr(1), matchSet, out+w->alpha[pos].letter, level, 0, stepover); //keep adding chars if (inWild[0] == w->alpha[pos].letter) //follow self matchRegExpHelper(w->alpha[pos].next, inWild.substr(1), matchSet, out+w->alpha[pos].letter, level, 0, stepover); //follow char matchRegExpHelper(w, inWild, matchSet, out, level, pos+1, stepover);//check next path } } Error Message: +str "Attempt to access index 1 in a vector of size 1." std::basic_string<char,std::char_traits<char>,std::allocator<char> > +err {msg="Attempt to access index 1 in a vector of size 1." } ErrorException Note: this function works fine for hundreds of test strings with '*' wilds if the extra stepover gate is not used Semi-Solved: I place a pos < w->alpha.size() condition on each path that calls w->alpha[pos]... - this prevented the backtrack calls from attempting to access the vector with an out of bounds index value. Still have other issues to work out - it loops infinitely adding the ? and backtracking to remove it, then repeat. But, moving forward now. Revised question: why during backtracking is the position index accumulating and/or not deincrementing - so at somepoint it calls w->alpha[pos]... with an invalid position that is either remaining from the next node or somehow incremented pos+1 when passing upward?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • How to specify Multiple Secure Webpages with .htaccess RewriteCond

    - by Patrick Ndille
    I have 3 pages that I want to make secure on my website using .htaccess -login.php -checkout.php -account.php I know how to make just one work page at a time using .htaccess RewriteEngine On RewriteCond %{HTTPS} off RewriteCond %{REQUEST_URI} /login.php RewriteRule (.*) https://%{HTTP_HOST}%{REQUEST_URI} [L] I and trying to figure out how to include the other 2 specific pages to make them also secure and used the expression below but it didn't work RewriteEngine On RewriteCond %{HTTPS} off RewriteCond %{REQUEST_URI} /login.php RewriteCond %{REQUEST_URI} /checkout.php RewriteCond %{REQUEST_URI} /account.php RewriteRule (.*) https://%{HTTP_HOST}%{REQUEST_URI} [L] Can someone help me the right expression that will work with multiple pages? The second part of the code is that, if https is already on and a user move to a page that Is not any of the pages i specified about, I want that it should get back to http. how should I write the statement for it to redirect back to http if its not any of the pages above? I have my statement like this but its not working RewriteCond %{HTTPS} on RewriteRule !(checkout|login|account|payment)\.php http://%{HTTP_HOST}%{REQUEST_URI} [L,R] Any thoughts?

    Read the article

  • Can someone help me compare using F# over C# in this specific example (IP Address expressions)?

    - by Phobis
    So, I am writing code to parse and IP Address expression and turn it into a regular expression that could be run against and IP Address string and return a boolean response. I wrote the code in C# (OO) and it was 110 lines of code. I am trying to compare the amount of code and the expressiveness of C# to F# (I am a C# programmer and a noob at F#). I don't want to post both the C# and F#, just because I don't want to clutter the post. If needed, I will do so. Anyway, I will give an example. Here is an expression: 192.168.0.250,244-248,108,51,7;127.0.0.1 I would like to take that and turn it into this regular expression: ((192.168.0.(250|244|245|246|247|248|108|51|7))|(127.0.0.1)) Here are some steps I am following: Operations: Break by ";" 192.168.0.250,244-248,108,51,7 127.0.0.1 Break by "." 192 168 0 250,244-248,108,51,7 Break by "," 250 244-248 108 51 7 Break by "-" 244 248 I came up with F# that produces the output. I am trying to forward-pipe through my operations listed above, as I think that would be more expressive. Can anyone make this code better? Teach me something :) open System let createItemArray (group:bool) (y:char) (items:string[]) = [| let indexes = items.Length - 1 let group = indexes > 0 && group if group then yield "(" for i in 0 .. indexes do yield items.[i].ToString() if i < indexes then yield y.ToString() if group then yield ")" |] let breakBy (group:bool) (x:string) (y:char): string[] = x.Split(y) |> createItemArray group y let breakItem (x:string) (y:char): string[] = breakBy false x y let breakGroup (x:string) (y:char): string[] = breakBy true x y let AddressExpression address:string = let builder = new System.Text.StringBuilder "(" breakGroup address ';' |> Array.collect (fun octet -> breakItem octet '.') |> Array.collect (fun options -> breakGroup options ',') |> Array.collect (fun (ranges : string) -> match (breakGroup ranges '-') with | x when x.Length > 3 -> match (Int32.TryParse(x.[1]), Int32.TryParse(x.[3])) with | ((true, a) ,(true, b)) -> [|a .. b|] |> Array.map (int >> string) |> createItemArray false '-' | _ -> [|ranges|] | _ -> [|ranges|] ) |> Array.iter (fun item -> match item with | ";" -> builder.Append ")|(" | "." -> builder.Append "\." | "," | "-" -> builder.Append "|" | _ -> builder.Append item |> ignore ) builder.Append(")").ToString() let address = "192.168.0.250,244-248,108,51,7;127.0.0.1" AddressExpression address

    Read the article

  • ASP.NET MVC Paging/Sorting/Filtering a list using ModelMetadata

    - by rajbk
    This post looks at how to control paging, sorting and filtering when displaying a list of data by specifying attributes in your Model using the ASP.NET MVC framework and the excellent MVCContrib library. It also shows how to hide/show columns and control the formatting of data using attributes.  This uses the Northwind database. A sample project is attached at the end of this post. Let’s start by looking at a class called ProductViewModel. The properties in the class are decorated with attributes. The OrderBy attribute tells the system that the Model can be sorted using that property. The SearchFilter attribute tells the system that filtering is allowed on that property. Filtering type is set by the  FilterType enum which currently supports Equals and Contains. The ScaffoldColumn property specifies if a column is hidden or not The DisplayFormat specifies how the data is formatted. public class ProductViewModel { [OrderBy(IsDefault = true)] [ScaffoldColumn(false)] public int? ProductID { get; set; }   [SearchFilter(FilterType.Contains)] [OrderBy] [DisplayName("Product Name")] public string ProductName { get; set; }   [OrderBy] [DisplayName("Unit Price")] [DisplayFormat(DataFormatString = "{0:c}")] public System.Nullable<decimal> UnitPrice { get; set; }   [DisplayName("Category Name")] public string CategoryName { get; set; }   [SearchFilter] [ScaffoldColumn(false)] public int? CategoryID { get; set; }   [SearchFilter] [ScaffoldColumn(false)] public int? SupplierID { get; set; }   [OrderBy] public bool Discontinued { get; set; } } Before we explore the code further, lets look at the UI.  The UI has a section for filtering the data. The column headers with links are sortable. Paging is also supported with the help of a pager row. The pager is rendered using the MVCContrib Pager component. The data is displayed using a customized version of the MVCContrib Grid component. The customization was done in order for the Grid to be aware of the attributes mentioned above. Now, let’s look at what happens when we perform actions on this page. The diagram below shows the process: The form on the page has its method set to “GET” therefore we see all the parameters in the query string. The query string is shown in blue above. This query gets routed to an action called Index with parameters of type ProductViewModel and PageSortOptions. The parameters in the query string get mapped to the input parameters using model binding. The ProductView object created has the information needed to filter data while the PageAndSorting object is used for paging and sorting the data. The last block in the figure above shows how the filtered and paged list is created. We receive a product list from our product repository (which is of type IQueryable) and first filter it by calliing the AsFiltered extension method passing in the productFilters object and then call the AsPagination extension method passing in the pageSort object. The AsFiltered extension method looks at the type of the filter instance passed in. It skips properties in the instance that do not have the SearchFilter attribute. For properties that have the SearchFilter attribute, it adds filter expression trees to filter against the IQueryable data. The AsPagination extension method looks at the type of the IQueryable and ensures that the column being sorted on has the OrderBy attribute. If it does not find one, it looks for the default sort field [OrderBy(IsDefault = true)]. It is required that at least one attribute in your model has the [OrderBy(IsDefault = true)]. This because a person could be performing paging without specifying an order by column. As you may recall the LINQ Skip method now requires that you call an OrderBy method before it. Therefore we need a default order by column to perform paging. The extension method adds a order expressoin tree to the IQueryable and calls the MVCContrib AsPagination extension method to page the data. Implementation Notes Auto Postback The search filter region auto performs a get request anytime the dropdown selection is changed. This is implemented using the following jQuery snippet $(document).ready(function () { $("#productSearch").change(function () { this.submit(); }); }); Strongly Typed View The code used in the Action method is shown below: public ActionResult Index(ProductViewModel productFilters, PageSortOptions pageSortOptions) { var productPagedList = productRepository.GetProductsProjected().AsFiltered(productFilters).AsPagination(pageSortOptions);   var productViewFilterContainer = new ProductViewFilterContainer(); productViewFilterContainer.Fill(productFilters.CategoryID, productFilters.SupplierID, productFilters.ProductName);   var gridSortOptions = new GridSortOptions { Column = pageSortOptions.Column, Direction = pageSortOptions.Direction };   var productListContainer = new ProductListContainerModel { ProductPagedList = productPagedList, ProductViewFilterContainer = productViewFilterContainer, GridSortOptions = gridSortOptions };   return View(productListContainer); } As you see above, the object that is returned to the view is of type ProductListContainerModel. This contains all the information need for the view to render the Search filter section (including dropdowns),  the Html.Pager (MVCContrib) and the Html.Grid (from MVCContrib). It also stores the state of the search filters so that they can recreate themselves when the page reloads (Viewstate, I miss you! :0)  The class diagram for the container class is shown below.   Custom MVCContrib Grid The MVCContrib grid default behavior was overridden so that it would auto generate the columns and format the columns based on the metadata and also make it aware of our custom attributes (see MetaDataGridModel in the sample code). The Grid ensures that the ShowForDisplay on the column is set to true This can also be set by the ScaffoldColumn attribute ref: http://bradwilson.typepad.com/blog/2009/10/aspnet-mvc-2-templates-part-2-modelmetadata.html) Column headers are set using the DisplayName attribute Column sorting is set using the OrderBy attribute. The data is formatted using the DisplayFormat attribute. Generic Extension methods for Sorting and Filtering The extension method AsFiltered takes in an IQueryable<T> and uses expression trees to query against the IQueryable data. The query is constructed using the Model metadata and the properties of the T filter (productFilters in our case). Properties in the Model that do not have the SearchFilter attribute are skipped when creating the filter expression tree.  It returns an IQueryable<T>. The extension method AsPagination takes in an IQuerable<T> and first ensures that the column being sorted on has the OrderBy attribute. If not, we look for the default OrderBy column ([OrderBy(IsDefault = true)]). We then build an expression tree to sort on this column. We finally hand off the call to the MVCContrib AsPagination which returns an IPagination<T>. This type as you can see in the class diagram above is passed to the view and used by the MVCContrib Grid and Pager components. Custom Provider To get the system to recognize our custom attributes, we create our MetadataProvider as mentioned in this article (http://bradwilson.typepad.com/blog/2010/01/why-you-dont-need-modelmetadataattributes.html) protected override ModelMetadata CreateMetadata(IEnumerable<Attribute> attributes, Type containerType, Func<object> modelAccessor, Type modelType, string propertyName) { ModelMetadata metadata = base.CreateMetadata(attributes, containerType, modelAccessor, modelType, propertyName);   SearchFilterAttribute searchFilterAttribute = attributes.OfType<SearchFilterAttribute>().FirstOrDefault(); if (searchFilterAttribute != null) { metadata.AdditionalValues.Add(Globals.SearchFilterAttributeKey, searchFilterAttribute); }   OrderByAttribute orderByAttribute = attributes.OfType<OrderByAttribute>().FirstOrDefault(); if (orderByAttribute != null) { metadata.AdditionalValues.Add(Globals.OrderByAttributeKey, orderByAttribute); }   return metadata; } We register our MetadataProvider in Global.asax.cs. protected void Application_Start() { AreaRegistration.RegisterAllAreas();   RegisterRoutes(RouteTable.Routes);   ModelMetadataProviders.Current = new MvcFlan.QueryModelMetaDataProvider(); } Bugs, Comments and Suggestions are welcome! You can download the sample code below. This code is purely experimental. Use at your own risk. Download Sample Code (VS 2010 RTM) MVCNorthwindSales.zip

    Read the article

  • HTML5 Form Validation

    - by Stephen.Walther
    The latest versions of Google Chrome (16+), Mozilla Firefox (8+), and Internet Explorer (10+) all support HTML5 client-side validation. It is time to take HTML5 validation seriously. The purpose of the blog post is to describe how you can take advantage of HTML5 client-side validation regardless of the type of application that you are building. You learn how to use the HTML5 validation attributes, how to perform custom validation using the JavaScript validation constraint API, and how to simulate HTML5 validation on older browsers by taking advantage of a jQuery plugin. Finally, we discuss the security issues related to using client-side validation. Using Client-Side Validation Attributes The HTML5 specification discusses several attributes which you can use with INPUT elements to perform client-side validation including the required, pattern, min, max, step, and maxlength attributes. For example, you use the required attribute to require a user to enter a value for an INPUT element. The following form demonstrates how you can make the firstName and lastName form fields required: <!DOCTYPE html> <html > <head> <title>Required Demo</title> </head> <body> <form> <label> First Name: <input required title="First Name is Required!" /> </label> <label> Last Name: <input required title="Last Name is Required!" /> </label> <button>Register</button> </form> </body> </html> If you attempt to submit this form without entering a value for firstName or lastName then you get the validation error message: Notice that the value of the title attribute is used to display the validation error message “First Name is Required!”. The title attribute does not work this way with the current version of Firefox. If you want to display a custom validation error message with Firefox then you need to include an x-moz-errormessage attribute like this: <input required title="First Name is Required!" x-moz-errormessage="First Name is Required!" /> The pattern attribute enables you to validate the value of an INPUT element against a regular expression. For example, the following form includes a social security number field which includes a pattern attribute: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Pattern</title> </head> <body> <form> <label> Social Security Number: <input required pattern="^d{3}-d{2}-d{4}$" title="###-##-####" /> </label> <button>Register</button> </form> </body> </html> The regular expression in the form above requires the social security number to match the pattern ###-##-####: Notice that the input field includes both a pattern and a required validation attribute. If you don’t enter a value then the regular expression is never triggered. You need to include the required attribute to force a user to enter a value and cause the value to be validated against the regular expression. Custom Validation You can take advantage of the HTML5 constraint validation API to perform custom validation. You can perform any custom validation that you need. The only requirement is that you write a JavaScript function. For example, when booking a hotel room, you might want to validate that the Arrival Date is in the future instead of the past: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Constraint Validation API</title> </head> <body> <form> <label> Arrival Date: <input id="arrivalDate" type="date" required /> </label> <button>Submit Reservation</button> </form> <script type="text/javascript"> var arrivalDate = document.getElementById("arrivalDate"); arrivalDate.addEventListener("input", function() { var value = new Date(arrivalDate.value); if (value < new Date()) { arrivalDate.setCustomValidity("Arrival date must be after now!"); } else { arrivalDate.setCustomValidity(""); } }); </script> </body> </html> The form above contains an input field named arrivalDate. Entering a value into the arrivalDate field triggers the input event. The JavaScript code adds an event listener for the input event and checks whether the date entered is greater than the current date. If validation fails then the validation error message “Arrival date must be after now!” is assigned to the arrivalDate input field by calling the setCustomValidity() method of the validation constraint API. Otherwise, the validation error message is cleared by calling setCustomValidity() with an empty string. HTML5 Validation and Older Browsers But what about older browsers? For example, what about Apple Safari and versions of Microsoft Internet Explorer older than Internet Explorer 10? What the world really needs is a jQuery plugin which provides backwards compatibility for the HTML5 validation attributes. If a browser supports the HTML5 validation attributes then the plugin would do nothing. Otherwise, the plugin would add support for the attributes. Unfortunately, as far as I know, this plugin does not exist. I have not been able to find any plugin which supports both the required and pattern attributes for older browsers, but does not get in the way of these attributes in the case of newer browsers. There are several jQuery plugins which provide partial support for the HTML5 validation attributes including: · jQuery Validation — http://docs.jquery.com/Plugins/Validation · html5Form — http://www.matiasmancini.com.ar/jquery-plugin-ajax-form-validation-html5.html · h5Validate — http://ericleads.com/h5validate/ The jQuery Validation plugin – the most popular JavaScript validation library – supports the HTML5 required attribute, but it does not support the HTML5 pattern attribute. Likewise, the html5Form plugin does not support the pattern attribute. The h5Validate plugin provides the best support for the HTML5 validation attributes. The following page illustrates how this plugin supports both the required and pattern attributes: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>h5Validate</title> <style type="text/css"> .validationError { border: solid 2px red; } .validationValid { border: solid 2px green; } </style> </head> <body> <form id="customerForm"> <label> First Name: <input id="firstName" required /> </label> <label> Social Security Number: <input id="ssn" required pattern="^d{3}-d{2}-d{4}$" title="Expected pattern is ###-##-####" /> </label> <input type="submit" /> </form> <script type="text/javascript" src="Scripts/jquery-1.4.4.min.js"></script> <script type="text/javascript" src="Scripts/jquery.h5validate.js"></script> <script type="text/javascript"> // Enable h5Validate plugin $("#customerForm").h5Validate({ errorClass: "validationError", validClass: "validationValid" }); // Prevent form submission when errors $("#customerForm").submit(function (evt) { if ($("#customerForm").h5Validate("allValid") === false) { evt.preventDefault(); } }); </script> </body> </html> When an input field fails validation, the validationError CSS class is applied to the field and the field appears with a red border. When an input field passes validation, the validationValid CSS class is applied to the field and the field appears with a green border. From the perspective of HTML5 validation, the h5Validate plugin is the best of the plugins. It adds support for the required and pattern attributes to browsers which do not natively support these attributes such as IE9. However, this plugin does not include everything in my wish list for a perfect HTML5 validation plugin. Here’s my wish list for the perfect back compat HTML5 validation plugin: 1. The plugin would disable itself when used with a browser which natively supports HTML5 validation attributes. The plugin should not be too greedy – it should not handle validation when a browser could do the work itself. 2. The plugin should simulate the same user interface for displaying validation error messages as the user interface displayed by browsers which natively support HTML5 validation. Chrome, Firefox, and Internet Explorer all display validation errors in a popup. The perfect plugin would also display a popup. 3. Finally, the plugin would add support for the setCustomValidity() method and the other methods of the HTML5 validation constraint API. That way, you could implement custom validation in a standards compatible way and you would know that it worked across all browsers both old and new. Security It would be irresponsible of me to end this blog post without mentioning the issue of security. It is important to remember that any client-side validation — including HTML5 validation — can be bypassed. You should use client-side validation with the intention to create a better user experience. Client validation is great for providing a user with immediate feedback when the user is in the process of completing a form. However, client-side validation cannot prevent an evil hacker from submitting unexpected form data to your web server. You should always enforce your validation rules on the server. The only way to ensure that a required field has a value is to verify that the required field has a value on the server. The HTML5 required attribute does not guarantee anything. Summary The goal of this blog post was to describe the support for validation contained in the HTML5 standard. You learned how to use both the required and the pattern attributes in an HTML5 form. We also discussed how you can implement custom validation by taking advantage of the setCustomValidity() method. Finally, I discussed the available jQuery plugins for adding support for the HTM5 validation attributes to older browsers. Unfortunately, I am unaware of any jQuery plugin which provides a perfect solution to the problem of backwards compatibility.

    Read the article

  • Looking for good Regex book

    - by Cyberherbalist
    I've been trying to get a good grounding with Regular Expressions, and am looking for a single book to do so. I've been going through Amazon.com's listings on this subject, and I've identified a few possibilities, but am unsure which would be best for a C# developer who can write very simple Regexs, but wants to learn more. On a scale of 0-9 where 0 is knowing how to spell "Regex" but nothing else, and 9 where I could write a book on the subject out of my own head, I would place myself at 2. Which of the following would be your choice: Mastering Regular Expressions by Jeffrey E F Friedl Regular Expressions Cookbook by Jan Goyvaerts and Steven Levithan Sams Teach Yourself Regular Expressions in 10 Minutes by Ben Forta Beginning Regular Expressions (Programmer to Programmer) by Andrew Watt Regular Expression Recipes for Windows Developers: A Problem-Solution Approach by Nathan A. Good Regular Expression Recipes: A Problem-Solution Approach by Nathan A. Good Now, according to Amazon, "Regular Expressions Cookbook" (REC) above is rated the highest according to user ratings, but only based on 20 reviews. The first one, "Mastering Regular Expressions" (MRE) is rated second based on 140 reviews. This alone suggests that MRE might be by far the best one. But is it best for a relative beginner? Would I perhaps be better getting "Beginning Regular Expressions" (BRE) instead, to start with? Please help me resolve my confusion!

    Read the article

  • Optimize SUMMARIZE with ADDCOLUMNS in Dax #ssas #tabular #dax #powerpivot

    - by Marco Russo (SQLBI)
    If you started using DAX as a query language, you might have encountered some performance issues by using SUMMARIZE. The problem is related to the calculation you put in the SUMMARIZE, by adding what are called extension columns, which compute their value within a filter context defined by the rows considered in the group that the SUMMARIZE uses to produce each row in the output. Most of the time, for simple table expressions used in the first parameter of SUMMARIZE, you can optimize performance by removing the extended columns from the SUMMARIZE and adding them by using an ADDCOLUMNS function. In practice, instead of writing SUMMARIZE( <table>, <group_by_column>, <column_name>, <expression> ) you can write: ADDCOLUMNS(     SUMMARIZE( <table>, <group by column> ),     <column_name>, CALCULATE( <expression> ) ) The performance difference might be huge (orders of magnitude) but this optimization might produce a different semantic and in these cases it should not be used. A longer discussion of this topic is included in my Best Practices Using SUMMARIZE and ADDCOLUMNS article on SQLBI, which also include several details about the DAX syntax with extended columns. For example, did you know that you can create an extended column in SUMMARIZE and ADDCOLUMNS with the same name of existing measures? It is *not* a good thing to do, and by reading the article you will discover why. Enjoy DAX!

    Read the article

  • Unable to uninstall maas completely

    - by user210844
    I'm not able to uninstall MAAS sudo apt-get purge maas ; sudo apt-get autoremove Reading package lists... Done Building dependency tree Reading state information... Done Package 'maas' is not installed, so not removed 0 upgraded, 0 newly installed, 0 to remove and 2 not upgraded. 2 not fully installed or removed. After this operation, 0 B of additional disk space will be used. Setting up maas-region-controller (1.2+bzr1373+dfsg-0ubuntu1) ... Considering dependency proxy for proxy_http: Module proxy already enabled Module proxy_http already enabled Module expires already enabled Module wsgi already enabled sed: -e expression #1, char 91: unterminated `s' command dpkg: error processing maas-region-controller (--configure): subprocess installed post-installation script returned error exit status 1 No apport report written because MaxReports is reached already dpkg: dependency problems prevent configuration of maas-dns: maas-dns depends on maas-region-controller (= 1.2+bzr1373+dfsg-0ubuntu1); however: Package maas-region-controller is not configured yet. dpkg: error processing maas-dns (--configure): dependency problems - leaving unconfigured No apport report written because MaxReports is reached already Errors were encountered while processing: maas-region-controller maas-dns E: Sub-process /usr/bin/dpkg returned an error code (1) Reading package lists... Done Building dependency tree Reading state information... Done 0 upgraded, 0 newly installed, 0 to remove and 2 not upgraded. 2 not fully installed or removed. After this operation, 0 B of additional disk space will be used. Setting up maas-region-controller (1.2+bzr1373+dfsg-0ubuntu1) ... Considering dependency proxy for proxy_http: Module proxy already enabled Module proxy_http already enabled Module expires already enabled Module wsgi already enabled sed: -e expression #1, char 91: unterminated `s' command dpkg: error processing maas-region-controller (--configure): subprocess installed post-installation script returned error exit status 1 No apport report written because MaxReports is reached already dpkg: dependency problems prevent configuration of maas-dns: maas-dns depends on maas-region-controller (= 1.2+bzr1373+dfsg-0ubuntu1); however: Package maas-region-controller is not configured yet. dpkg: error processing maas-dns (--configure): dependency problems - leaving unconfigured No apport report written because MaxReports is reached already Errors were encountered while processing: maas-region-controller maas-dns E: Sub-process /usr/bin/dpkg returned an error code (1)

    Read the article

  • What do you think of this generator syntax?

    - by ChaosPandion
    I've been working on an ECMAScript dialect for quite some time now and have reached a point where I am comfortable adding new language features. I would love to hear some thoughts and suggestions on the syntax. Example generator { yield 1; yield 2; yield 3; if (true) { yield break; } yield continue generator { yield 4; yield 5; yield 6; }; } Syntax GeneratorExpression:     generator  {  GeneratorBody  } GeneratorBody:     GeneratorStatementsopt GeneratorStatements:     StatementListopt GeneratorStatement GeneratorStatementsopt GeneratorStatement:     YieldStatement     YieldBreakStatement     YieldContinueStatement YieldStatement:     yield  Expression  ; YieldBreakStatement:     yield  break  ; YieldContinueStatement:     yield  continue  Expression  ; Semantics The YieldBreakStatement allows you to end iteration early. This helps avoid deeply indented code. You'll be able to write something like this: generator { yield something1(); if (condition1 && condition2) yield break; yield something2(); if (condition3 && condition4) yield break; yield something3(); } instead of: generator { yield something1(); if (!condition1 && !condition2) { yield something2(); if (!condition3 && !condition4) { yield something3(); } } } The YieldContinueStatement allows you to combine generators: function generateNumbers(start) { return generator { yield 1 + start; yield 2 + start; yield 3 + start; if (start < 100) { yield continue generateNumbers(start + 1); } }; }

    Read the article

< Previous Page | 68 69 70 71 72 73 74 75 76 77 78 79  | Next Page >