Search Results

Search found 75614 results on 3025 pages for 'file location'.

Page 749/3025 | < Previous Page | 745 746 747 748 749 750 751 752 753 754 755 756  | Next Page >

  • Apache and Active Directory authentication

    - by synapse
    I'm having trouble with LDAP authentication in Apache 2.2. Here's the excerpt from httpd.conf <Location /folder> AuthType Basic AuthName "Project" AuthBasicProvider ldap AuthLDAPBindDN "user@domain" AuthLDAPBindPassword "my_password" AuthLDAPURL "ldap://my_domain_controller/?samAccountName?sub?(objectClass=user)" Require valid-user </Location> I keep getting "ldap_search_ext_s() for user failed" in error.log. I tried using my quoted DN as AuthLDAPBindDN but results were the same. What could be the problem?

    Read the article

  • IT merger - self-sufficient site with domain controller VS thin clients outpost with access to termi

    - by imagodei
    SITUATION: A larger company acquires a smaller one. IT infrastructure has to be merged. There are no immediate plans to change the current size or role of the smaller company - the offices and production remain. It has a Win 2003 SBS domain server, Win 2000 file server, linux server for SVN and internal Wikipedia, 2 or 3 production machines, LTO backup solution. The servers are approx. 5 years old. Cisco network equippment (switches, wireless, ASA). Mail solution is a hosted Exchange. There are approx. 35 desktops and laptops in the company. IT infrastructure unification: There are 2 IT merging proposals. 1.) Replacing old servers, installing Win Server 2008 domain controller, and setting up either subdomain or domain trust to a larger company. File server and other servers remain local and synchronization should be set up to a centralized location in larger company. Similary with the backup - it remains local and if needed it should be replicated to a centralized location. Licensing is managed by smaller company. 2.) All servers are moved to a centralized location in larger company. As many desktop machines as possible are replaced by thin clients. The actual machines are virtualized and hosted by Terminal server at the same central location. Citrix solutions will be used. Only router and site-2-site VPN connection remain at the smaller company. Backup internet line to insure near 100% availability is needed. Licensing is mainly managed by larger company. Only specialized software for PCs that will not be virtualized is managed by smaller company. I'd like to ask you to discuss both solutions a bit. In your opinion, which is better from the operational point of view? Which is more reliable, cheaper in the long run? Easier to manage from the system administrator's point of view? Easier on the budget and easier to maintain from IT department's point of view? Does anybody have any experience with the second option and how does it perform in production environment? Pros and cons of both? Your input will be of great significance to me. Thank you very much!

    Read the article

  • How can I retrieve statistics from my ghost cast server?

    - by Foxtrot
    I have a GhostCast server running for deploying images. I would like to have each ghost cast session to write to a file ( can be multiple text files or append to one file already there ) statistics. I know this is possible based on the options GhostCast software provides for writing to a log file, but I would like this automated for every image being backed up and restored. I don't want to have my employees click write to a new file every time. Is this possible?

    Read the article

  • Why Photoshop CS5's photomerge's result immediately disappear?

    - by koiyu
    I have a bunch of JPG-files which I want to stitch together with Photoshop's Photomerge function. I choose File → Automate → Photomerge... and browse for the files. Photoshop opens the files and starts analyzing. I see the process bar filling and different phases are mentioned on the process bar. Nothing weird there. When the merging is done (and if I don't blink my eyes), I can see layers-palette is populated with the chosen files and, by quickly judging from the layer thumbnails, they're properly aligned. Sometimes the image window itself can be seen, but not always. Problem is that the layers and the image disappear in a flash. There is no error message. Everything is like prior starting the photomerge. No file has been changed. I could continue to use Photoshop normally. This is what I've tried so far: Loaded folder which has 38 JPG images, 4272 x 2848 and ˜ 5 megabytes per file Loaded the same files, but chose Use Files instead of Use Folder in the photomerge's window Loaded 19 JPG images, 4272 x 2848 and ˜ 5 megabytes per file Loaded 10 JPG images, ⇑ see above Loaded 5 JPG images, see above Loaded 3 JPG images, see above Scaled the images to 2256 x 1504 and ˜< 1 megabytes per file Loaded in a set of 38, 19, 10, 5, 3 Following steps are tested with these smaller files and with a set of 5 images Read Adobe's forums and reduced the amount of RAM Photoshop uses gradually from ˜ 80 % to 50 % (though I didn't understand the logic behind this) Would've reduced cache tile size to 128K, but it was set so already Disabled OpenGL Scaled the images to 800 x 533 and ˜ 100 kilobytes per file, loaded a set of 5 Read more unanswered threads around the internet In between each test I closed and reopened Photoshop. This is the first time I've even tried using photomerge. Am I doing something wrong? How can I locate what is the problem? How do I fix this? Photoshop is 64 bit Extended CS5 version. I'm on a mid-2010 quad-core (i5) iMac with up-to-date Mac OS X 10.6.6. Edit: Weird. First loading the images into one file via File → Scripts → Load Files into Stack… and then using Edit → Auto-Align Layers…, which, effectively, is the same as photomerge (even the dialog looks kind of the same), works! Even with the original JPGs without any issues. This doesn't fix photomerge, though.

    Read the article

  • NGINX SSL Certificate Not Working

    - by LeSamAdmin
    I've been working on SSL stuff and getting nowhere from like 4 tutorials... I've bought an SSL for pingrglobe.com, and now trying to apply it to my servers. Here's my nginx code: http { server { listen 80; server_name pingrglobe.com; rewrite ^(.*) http://www.pingrglobe.com$1 permanent; } server { listen 443; ssl on; ssl_certificate /etc/nginx/ssl/pingrglobe.crt; ssl_certificate_key /etc/nginx/ssl/pingrglobe.key; #enables SSLv3/TLSv1, but not SSLv2 which is weak and should no longer be used. ssl_protocols SSLv3 TLSv1; #Disables all weak ciphers ssl_ciphers ALL:!aNULL:!ADH:!eNULL:!LOW:!EXP:RC4+RSA:+HIGH:+MEDIUM; server_name www.pingrglobe.com; root /var/www/pingrglobe.com; index index.html index.php; location / { try_files $uri $uri/ @extensionless-php; add_header Access-Control-Allow-Origin *; } rewrite ^/blog/blogpost/(.+)$ /blog/blogpost?post=$1 last; rewrite ^/viewticket/(.+)/(.*)$ /viewticket?tid=$1&$2 last; rewrite ^/vemail/(.+)$ /vemail?eid=$1 last; rewrite ^/serversettings/(.+)$ /serversettings?srvid=$1 last; rewrite ^/notification/(.+)$ /notification?id=$1 last; rewrite ^/viewreport/(.+)$ /viewreport?srvid=$1 last; rewrite ^/removeserver/(.+)$ /removeserver?srvid=$1 last; rewrite ^/staffviewticket/(.+)/(.*)$ /staffviewticket?tid=$1&$2 last; rewrite ^/activate/(.*)/(.*)/(.*)$ /activate?user=$1&code=$2&email=$3 last; rewrite ^/activate2/(.*)/(.*)/(.*)$ /activate2?user=$1&code=$2&email=$3 last; rewrite ^/passwordtoken/(.+)/(.*)/(.*)$ /passwordtoken?user=$1&token=$2&email=$3 last; location ~ \.php$ { try_files $uri =404; fastcgi_pass unix:/var/run/php5-fpm.sock; fastcgi_param SCRIPT_FILENAME $document_root$fastcgi_script_name; include fastcgi_params; } location @extensionless-php { rewrite ^(.*)$ $1.php last; } location ~ /\. { deny all; } } } SSL doesn't work as you see here: https://www.pingrglobe.com

    Read the article

  • MS Publisher 2003 - hangs when saving to desktop

    - by Chris
    We have a win 7 home prem pc, amd cpu, 8G ram, plenty of free disk space. Whenever user is working in publisher 20003, and tries to save a publisher 2003 document to the desktop, the save as dialog hangs and takes 2-3 minutes to display the desktop save location. I've tested excel 2003, it has no problems immediately displaying the desktop save as location and saving the file.

    Read the article

  • Nginx SSL redirect for one specific page only

    - by jjiceman
    I read and followed this question in order to configure nginx to force SSL for one page (admin.php for XenForo), and it is working well for a few of the site administrators but is not for myself. I was wondering if anyone has any advice on how to improve this configuration: ... ssl_certificate example.net.crt; ssl_certificate_key example.key; server { listen 80 default; listen 443 ssl; server_name www.example.net example.net; access_log /srv/www/example.net/logs/access.log; error_log /srv/www/example.net/logs/error.log; root /srv/www/example.net/public_html; index index.php index.html; location / { if ( $scheme = https ){ rewrite ^ http://example.net$request_uri? permanent; } try_files $uri $uri/ /index.php?$uri&$args; index index.php index.html; } location ^~ /admin.php { if ( $scheme = http ) { rewrite ^ https://example.net$request_uri? permanent; } try_files $uri /index.php; include fastcgi_params; fastcgi_pass 127.0.0.1:9000; fastcgi_param SCRIPT_FILENAME $document_root$fastcgi_script_name; fastcgi_param HTTPS on; } location ~ \.php$ { try_files $uri /index.php; include fastcgi_params; fastcgi_pass 127.0.0.1:9000; fastcgi_param SCRIPT_FILENAME $document_root$fastcgi_script_name; fastcgi_param HTTPS off; } } ... It seems that the extra information in the location ^~ /admin.php block is unecessary, does anyone know of an easy way to avoid duplicate code? Without it it skips the php block and just returns the php files. Currently it applies https correctly in Firefox when I navigate to admin.php. In Chrome, it downloads the admin.php page. When returning to the non-https website in Firefox, it does not correctly return to http but stays as SSL. Like I said earlier, this only happens for me, the other admins can go back and forth without a problem. Is this an issue on my end that I can fix? And does anyone know of any ways I could reduce duplicate configuration options in the configuration? Thanks in advance! EDIT: Clearing the cache / cookies seemed to work. Is this the right way to do http/https redirection? I sort of made it up as I went along.

    Read the article

  • Convert Chinese character .wav song into .mp3 or .wma on English OS

    - by Jack
    I have bunch of Chinese .wav files on my hard disk that I'm trying to convert into .mp3 with Audacity but it appear that Audacity can not read Chinese character songs but the .wav file display correctly on my 32 bits Win7 Ultimate(English) pc. I have to rename these Chinese character songs into English file name in order to convert them. Does anyone know if there is any software (prefer open source) that will take Chinese character file name(.wav) and convert it into .mp3 without renaming the file?

    Read the article

  • Override my ISP's "domain not found" page?

    - by Amanda
    If I screw up typing a URL, my ISP shoots me over to their branded search page. So if I type "superuser" in my location bar I end up at http://domainnotfound.optimum.net/cablevassist/dnsassist/main/?domain=superuser I'd like my browser to leave the location the way it was and just say "nothing doing," rather than redirecting me to a search. Can I override that in my own /etc/hosts or at my router?

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • Is there a way to detect which port on an ethernet switch a device is connected to?

    - by banno
    Since the wall jack is typically always connected to the same port on the switch I would like to be able to know which device is connected at a specific location. In my case I am talking about printers. I have code to go out on the network and find the IP Address of all of my printers, but would like to be able to update a server based on a printer being swapped out of a location for maintenance or repair. Is there a method for determining a port connection?

    Read the article

  • FTP permissions problem

    - by John Isaacks
    I have vsftpd installed on ubuntu. I added a new created a new user and set the users home path to /var/www so I can ftp with that user directly to that location. And that all works, I can now FTP with the user I created directly to that location. However I whenever I ftp, I have no permissions to change anything. How can I change that? Thanks!!

    Read the article

  • Unable to identify the path of VC++

    - by khan
    I have downloaded the microsoft visual C++,In control panel I can see the software download but unable to find the location it got installed I uninstalled it many ways and default also I set the location but I see there are no files in it. I installed that software from the following link. http://www.microsoft.com/en-us/download/details.aspx?id=8279 Microsoft Visual C++ 2010 My system configurations Windows 7 64 bit

    Read the article

  • Automatic picture size adjustment

    - by CChriss
    Does anyone know of a free utility that allows you to paste into it a graphics file (any type would work for me, jpg, bmp, png, etc) and it will size the file to within a preset size boundary? For instance, if I preset it to resize files to be a maximum of 400 wide by 300 tall, and I paste in a file 500x500, it would shrink the file to fit within the 300 tall limit. Thanks.

    Read the article

  • Exclude all hidden directories in UNIX find

    - by xRickerlx
    I'm doing a word search using the following command: find . -exec grep -q [some_word] '{}' \; -print -o -name .svn -prune -o -name .ssh -prune -o -name .boneyard -o -name log -prune -prune -o -name tmp -prune Is it possible to use a regex to exclude all hidden directories? Note: The current command traverses the entire tree from the current location and exclude those being pruned. The exclusion needs to work for any hidden directory regardless off location.

    Read the article

  • How to send Content-Disposition headers in apache for ALL files?

    - by user37900
    I have seen similar questions, but the answers currently posted do not work for me. I am trying to get all files to prompt user to download but .html and .jpg files are still being displayed. here is what I have in my httpd.conf <Location /testfiles> SetEnvIf Request_URI "^.*/([^/]*)$" FILENAME=$1 Header set "Content-disposition" "attachment; filename=%{FILENAME}e" UnsetEnv FILENAME </Location> What am i doing wrong ? Many thanks

    Read the article

  • How can I unzip a .tar.gz in one step (using 7-Zip)?

    - by quickcel
    I am using 7-Zip on Windows XP and whenever I download a .tar.gz file it takes me two steps to completely extract the file(s). I right-click on the example.tar.gz file and choose 7-Zip -- Extract Here from the context menu. I then take the resulting example.tar file and the right-click again and choose 7-Zip -- Extract Here from the context menu. Is there a way through the context menu to do this in one step?

    Read the article

  • User Input That Involves A ' ' Causes A Substring Out Of Range Error

    - by Greenhouse Gases
    Hi Stackoverflow people. You have already helped me quite a bit but near the end of writing this program I have somewhat of a bug. You see in order to read in city names with a space in from a text file I use a '/' that is then replaced by the program for a ' ' (and when the serializer runs the opposite happens for next time the program is run). The problem is when a user inputs a name too add, search for, or delete that contains a space, for instance 'New York' I get a Debug Assertion Error with a substring out of range expression. I have a feeling it's to do with my correctCase function, or setElementsNull that looks at the string until it experiences a null element in the array, however ' ' is not null so I'm not sure how to fix this and I'm going a bit insane. Any help would be much appreciated. Here is my code: // U08221.cpp : main project file. #include "stdafx.h" #include <_iostream> #include <_string> #include <_fstream> #include <_cmath> using namespace std; class locationNode { public: string nodeCityName; double nodeLati; double nodeLongi; locationNode* Next; locationNode(string nameOf, double lat, double lon) { this->nodeCityName = nameOf; this->nodeLati = lat; this->nodeLongi = lon; this->Next = NULL; } locationNode() // NULL constructor { } void swapProps(locationNode *node2) { locationNode place; place.nodeCityName = this->nodeCityName; place.nodeLati = this->nodeLati; place.nodeLongi = this->nodeLongi; this->nodeCityName = node2->nodeCityName; this->nodeLati = node2->nodeLati; this->nodeLongi = node2->nodeLongi; node2->nodeCityName = place.nodeCityName; node2->nodeLati = place.nodeLati; node2->nodeLongi = place.nodeLongi; } void modify(string name) { this->nodeCityName = name; } void modify(double latlon, int mod) { switch(mod) { case 2: this->nodeLati = latlon; break; case 3: this->nodeLongi = latlon; break; } } void correctCase() // Correct upper and lower case letters of input { int MAX_SIZE = 35; int firstLetVal = this->nodeCityName[0], letVal; int n = 1; // variable for name index from second letter onwards if((this->nodeCityName[0] >90) && (this->nodeCityName[0] < 123)) // First letter is lower case { firstLetVal = firstLetVal - 32; // Capitalise first letter this->nodeCityName[0] = firstLetVal; } while(this->nodeCityName[n] != NULL) { if((this->nodeCityName[n] >= 65) && (this->nodeCityName[n] <= 90)) { if(this->nodeCityName[n - 1] != 32) { letVal = this->nodeCityName[n] + 32; this->nodeCityName[n] = letVal; } } n++; } } }; Here is the main part of the program: // U08221.cpp : main project file. #include "stdafx.h" #include "Locations2.h" #include <_iostream> #include <_string> #include <_fstream> #include <_cmath> using namespace std; #define pi 3.14159265358979323846264338327950288 #define radius 6371 #define gig 1073741824 //size of a gigabyte in bytes int n = 0,x, locationCount = 0, MAX_SIZE = 35 , g = 0, i = 0, modKey = 0, xx; string cityNameInput, alter; char targetCity[35], skipKey = ' '; double lat1, lon1, lat2, lon2, dist, dummy, modVal, result; bool acceptedInput = false, match = false, nodeExists = false;// note: addLocation(), set to true to enable user input as opposed to txt file locationNode *temp, *temp2, *example, *seek, *bridge, *start_ptr = NULL; class Menu { int junction; public: /* Convert decimal degrees to radians */ public: void setElementsNull(char cityParam[]) { int y=0; while(cityParam[y] != NULL) { y++; } while(y < MAX_SIZE) { cityParam[y] = NULL; y++; } } void correctCase(string name) // Correct upper and lower case letters of input { int MAX_SIZE = 35; int firstLetVal = name[0], letVal; int n = 1; // variable for name index from second letter onwards if((name[0] >90) && (name[0] < 123)) // First letter is lower case { firstLetVal = firstLetVal - 32; // Capitalise first letter name[0] = firstLetVal; } while(name[n] != NULL) { if((name[n] >= 65) && (name[n] <= 90)) { letVal = name[n] + 32; name[n] = letVal; } n++; } for(n = 0; targetCity[n] != NULL; n++) { targetCity[n] = name[n]; } } bool nodeExistTest(char targetCity[]) // see if entry is present in the database { match = false; seek = start_ptr; int letters = 0, letters2 = 0, x = 0, y = 0; while(targetCity[y] != NULL) { letters2++; y++; } while(x <= locationCount) // locationCount is number of entries currently in list { y=0, letters = 0; while(seek->nodeCityName[y] != NULL) // count letters in the current name { letters++; y++; } if(letters == letters2) // same amount of letters in the name { y = 0; while(y <= letters) // compare each letter against one another { if(targetCity[y] == seek->nodeCityName[y]) { match = true; y++; } else { match = false; y = letters + 1; // no match, terminate comparison } } } if(match) { x = locationCount + 1; //found match so terminate loop } else{ if(seek->Next != NULL) { bridge = seek; seek = seek->Next; x++; } else { x = locationCount + 1; // end of list so terminate loop } } } return match; } double deg2rad(double deg) { return (deg * pi / 180); } /* Convert radians to decimal degrees */ double rad2deg(double rad) { return (rad * 180 / pi); } /* Do the calculation */ double distance(double lat1, double lon1, double lat2, double lon2, double dist) { dist = sin(deg2rad(lat1)) * sin(deg2rad(lat2)) + cos(deg2rad(lat1)) * cos(deg2rad(lat2)) * cos(deg2rad(lon1 - lon2)); dist = acos(dist); dist = rad2deg(dist); dist = (radius * pi * dist) / 180; return dist; } void serialise() { // Serialize to format that can be written to text file fstream outfile; outfile.open("locations.txt",ios::out); temp = start_ptr; do { for(xx = 0; temp->nodeCityName[xx] != NULL; xx++) { if(temp->nodeCityName[xx] == 32) { temp->nodeCityName[xx] = 47; } } outfile << endl << temp->nodeCityName<< " "; outfile<<temp->nodeLati<< " "; outfile<<temp->nodeLongi; temp = temp->Next; }while(temp != NULL); outfile.close(); } void sortList() // do this { int changes = 1; locationNode *node1, *node2; while(changes > 0) // while changes are still being made to the list execute { node1 = start_ptr; node2 = node1->Next; changes = 0; do { xx = 1; if(node1->nodeCityName[0] > node2->nodeCityName[0]) //compare first letter of name with next in list { node1->swapProps(node2); // should come after the next in the list changes++; } else if(node1->nodeCityName[0] == node2->nodeCityName[0]) // if same first letter { while(node1->nodeCityName[xx] == node2->nodeCityName[xx]) // check next letter of name { if((node1->nodeCityName[xx + 1] != NULL) && (node2->nodeCityName[xx + 1] != NULL)) // check next letter until not the same { xx++; } else break; } if(node1->nodeCityName[xx] > node2->nodeCityName[xx]) { node1->swapProps(node2); // should come after the next in the list changes++; } } node1 = node2; node2 = node2->Next; // move to next pair in list } while(node2 != NULL); } } void initialise() { cout << "Populating List..."; ifstream inputFile; inputFile.open ("locations.txt", ios::in); char inputName[35] = " "; double inputLati = 0, inputLongi = 0; //temp = new locationNode(inputName, inputLati, inputLongi); do { inputFile.get(inputName, 35, ' '); inputFile >> inputLati; inputFile >> inputLongi; if(inputName[0] == 10 || 13) //remove linefeed from input { for(int i = 0; inputName[i] != NULL; i++) { inputName[i] = inputName[i + 1]; } } for(xx = 0; inputName[xx] != NULL; xx++) { if(inputName[xx] == 47) // if it is a '/' { inputName[xx] = 32; // replace it for a space } } temp = new locationNode(inputName, inputLati, inputLongi); if(start_ptr == NULL){ // if list is currently empty, start_ptr will point to this node start_ptr = temp; } else { temp2 = start_ptr; // We know this is not NULL - list not empty! while (temp2->Next != NULL) { temp2 = temp2->Next; // Move to next link in chain until reach end of list } temp2->Next = temp; } ++locationCount; // increment counter for number of records in list } while(!inputFile.eof()); cout << "Successful!" << endl << "List contains: " << locationCount << " entries" << endl; inputFile.close(); cout << endl << "*******************************************************************" << endl << "DISTANCE CALCULATOR v2.0\tAuthors: Darius Hodaei, Joe Clifton" << endl; } void menuInput() { char menuChoice = ' '; while(menuChoice != 'Q') { // Menu if(skipKey != 'X') // This is set by case 'S' below if a searched term does not exist but wants to be added { cout << endl << "*******************************************************************" << endl; cout << "Please enter a choice for the menu..." << endl << endl; cout << "(P) To print out the list" << endl << "(O) To order the list alphabetically" << endl << "(A) To add a location" << endl << "(D) To delete a record" << endl << "(C) To calculate distance between two points" << endl << "(S) To search for a location in the list" << endl << "(M) To check memory usage" << endl << "(U) To update a record" << endl << "(Q) To quit" << endl; cout << endl << "*******************************************************************" << endl; cin >> menuChoice; if(menuChoice >= 97) { menuChoice = menuChoice - 32; // Turn the lower case letter into an upper case letter } } skipKey = ' '; //Reset skipKey so that it does not skip the menu switch(menuChoice) { case 'P': temp = start_ptr; // set temp to the start of the list do { if (temp == NULL) { cout << "You have reached the end of the database" << endl; } else { // Display details for what temp points to at that stage cout << "Location : " << temp->nodeCityName << endl; cout << "Latitude : " << temp->nodeLati << endl; cout << "Longitude : " << temp->nodeLongi << endl; cout << endl; // Move on to next locationNode if one exists temp = temp->Next; } } while (temp != NULL); break; case 'O': { sortList(); // pass by reference??? cout << "List reordered alphabetically" << endl; } break; case 'A': char cityName[35]; double lati, longi; cout << endl << "Enter the name of the location: "; cin >> cityName; for(xx = 0; cityName[xx] != NULL; xx++) { if(cityName[xx] == 47) // if it is a '/' { cityName[xx] = 32; // replace it for a space } } if(!nodeExistTest(cityName)) { cout << endl << "Please enter the latitude value for this location: "; cin >> lati; cout << endl << "Please enter the longitude value for this location: "; cin >> longi; cout << endl; temp = new locationNode(cityName, lati, longi); temp->correctCase(); //start_ptr allignment if(start_ptr == NULL){ // if list is currently empty, start_ptr will point to this node start_ptr = temp; } else { temp2 = start_ptr; // We know this is not NULL - list not empty! while (temp2->Next != NULL) { temp2 = temp2->Next; // Move to next link in chain until reach end of list } temp2->Next = temp; } ++locationCount; // increment counter for number of records in list cout << "Location sucessfully added to the database! There are " << locationCount << " location(s) stored" << endl; } else { cout << "Node is already present in the list and so cannot be added again" << endl; } break; case 'D': { junction = 0; locationNode *place; cout << "Enter the name of the city you wish to remove" << endl; cin >> targetCity; setElementsNull(targetCity); correctCase(targetCity); for(xx = 0; targetCity[xx] != NULL; xx++) { if(targetCity[xx] == 47) { targetCity[xx] = 32; } } if(nodeExistTest(targetCity)) //if this node does exist { if(seek == start_ptr) // if it is the first in the list { junction = 1; } if(seek->Next == NULL) // if it is last in the list { junction = 2; } switch(junction) // will alter list accordingly dependant on where the searched for link is { case 1: start_ptr = start_ptr->Next; delete seek; --locationCount; break; case 2: place = seek; seek = bridge; seek->Next = NULL; delete place; --locationCount; break; default: bridge->Next = seek->Next; delete seek; --locationCount; break; } cout << endl << "Link deleted. There are now " << locationCount << " locations." << endl; } else { cout << "That entry does not currently exist" << endl << endl << endl; } } break; case 'C': { char city1[35], city2[35]; cout << "Enter the first city name" << endl; cin >> city1; setElementsNull(city1); correctCase(targetCity); if(nodeExistTest(city1)) { lat1 = seek->nodeLati; lon1 = seek->nodeLongi; cout << "Lati = " << seek->nodeLati << endl << "Longi = " << seek->nodeLongi << endl << endl; } cout << "Enter the second city name" << endl; cin >> city2; setElementsNull(city2); correctCase(targetCity); if(nodeExistTest(city2)) { lat2 = seek->nodeLati; lon2 = seek->nodeLongi; cout << "Lati = " << seek->nodeLati << endl << "Longi = " << seek->nodeLongi << endl << endl; } result = distance (lat1, lon1, lat2, lon2, dist); cout << "The distance between these two locations is " << result << " kilometres." << endl; } break; case 'S': { char choice; cout << "Enter search term..." << endl; cin >> targetCity; setElementsNull(targetCity); correctCase(targetCity); if(nodeExistTest(targetCity)) { cout << "Latitude: " << seek->nodeLati << endl << "Longitude: " << seek->nodeLongi << endl; } else { cout << "Sorry, that city is not currently present in the list." << endl << "Would you like to add this city now Y/N?" << endl; cin >> choice; /*while(choice != ('Y' || 'N')) { cout << "Please enter a valid choice..." << endl; cin >> choice; }*/ switch(choice) { case 'Y': skipKey = 'X'; menuChoice = 'A'; break; case 'N': break; default : cout << "Invalid choice" << endl; break; } } break; } case 'M': { cout << "Locations currently stored: " << locationCount << endl << "Memory used for this: " << (sizeof(start_ptr) * locationCount) << " bytes" << endl << endl << "You can store " << ((gig - (sizeof(start_ptr) * locationCount)) / sizeof(start_ptr)) << " more locations" << endl ; break; } case 'U': { cout << "Enter the name of the Location you would like to update: "; cin >> targetCity; setElementsNull(targetCity); correctCase(targetCity); if(nodeExistTest(targetCity)) { cout << "Select (1) to alter City Name, (2) to alter Longitude, (3) to alter Latitude" << endl; cin >> modKey; switch(modKey) { case 1: cout << "Enter the new name: "; cin >> alter; cout << endl; seek->modify(alter); break; case 2: cout << "Enter the new latitude: "; cin >> modVal; cout << endl; seek->modify(modVal, modKey); break; case 3: cout << "Enter the new longitude: "; cin >> modVal; cout << endl; seek->modify(modVal, modKey); break; default: break; } } else cout << "Location not found" << endl; break; } } } } }; int main(array<System::String ^> ^args) { Menu mm; //mm.initialise(); mm.menuInput(); mm.serialise(); }

    Read the article

  • 256 Windows Azure Worker Roles, Windows Kinect and a 90's Text-Based Ray-Tracer

    - by Alan Smith
    For a couple of years I have been demoing a simple render farm hosted in Windows Azure using worker roles and the Azure Storage service. At the start of the presentation I deploy an Azure application that uses 16 worker roles to render a 1,500 frame 3D ray-traced animation. At the end of the presentation, when the animation was complete, I would play the animation delete the Azure deployment. The standing joke with the audience was that it was that it was a “$2 demo”, as the compute charges for running the 16 instances for an hour was $1.92, factor in the bandwidth charges and it’s a couple of dollars. The point of the demo is that it highlights one of the great benefits of cloud computing, you pay for what you use, and if you need massive compute power for a short period of time using Windows Azure can work out very cost effective. The “$2 demo” was great for presenting at user groups and conferences in that it could be deployed to Azure, used to render an animation, and then removed in a one hour session. I have always had the idea of doing something a bit more impressive with the demo, and scaling it from a “$2 demo” to a “$30 demo”. The challenge was to create a visually appealing animation in high definition format and keep the demo time down to one hour.  This article will take a run through how I achieved this. Ray Tracing Ray tracing, a technique for generating high quality photorealistic images, gained popularity in the 90’s with companies like Pixar creating feature length computer animations, and also the emergence of shareware text-based ray tracers that could run on a home PC. In order to render a ray traced image, the ray of light that would pass from the view point must be tracked until it intersects with an object. At the intersection, the color, reflectiveness, transparency, and refractive index of the object are used to calculate if the ray will be reflected or refracted. Each pixel may require thousands of calculations to determine what color it will be in the rendered image. Pin-Board Toys Having very little artistic talent and a basic understanding of maths I decided to focus on an animation that could be modeled fairly easily and would look visually impressive. I’ve always liked the pin-board desktop toys that become popular in the 80’s and when I was working as a 3D animator back in the 90’s I always had the idea of creating a 3D ray-traced animation of a pin-board, but never found the energy to do it. Even if I had a go at it, the render time to produce an animation that would look respectable on a 486 would have been measured in months. PolyRay Back in 1995 I landed my first real job, after spending three years being a beach-ski-climbing-paragliding-bum, and was employed to create 3D ray-traced animations for a CD-ROM that school kids would use to learn physics. I had got into the strange and wonderful world of text-based ray tracing, and was using a shareware ray-tracer called PolyRay. PolyRay takes a text file describing a scene as input and, after a few hours processing on a 486, produced a high quality ray-traced image. The following is an example of a basic PolyRay scene file. background Midnight_Blue   static define matte surface { ambient 0.1 diffuse 0.7 } define matte_white texture { matte { color white } } define matte_black texture { matte { color dark_slate_gray } } define position_cylindrical 3 define lookup_sawtooth 1 define light_wood <0.6, 0.24, 0.1> define median_wood <0.3, 0.12, 0.03> define dark_wood <0.05, 0.01, 0.005>     define wooden texture { noise surface { ambient 0.2  diffuse 0.7  specular white, 0.5 microfacet Reitz 10 position_fn position_cylindrical position_scale 1  lookup_fn lookup_sawtooth octaves 1 turbulence 1 color_map( [0.0, 0.2, light_wood, light_wood] [0.2, 0.3, light_wood, median_wood] [0.3, 0.4, median_wood, light_wood] [0.4, 0.7, light_wood, light_wood] [0.7, 0.8, light_wood, median_wood] [0.8, 0.9, median_wood, light_wood] [0.9, 1.0, light_wood, dark_wood]) } } define glass texture { surface { ambient 0 diffuse 0 specular 0.2 reflection white, 0.1 transmission white, 1, 1.5 }} define shiny surface { ambient 0.1 diffuse 0.6 specular white, 0.6 microfacet Phong 7  } define steely_blue texture { shiny { color black } } define chrome texture { surface { color white ambient 0.0 diffuse 0.2 specular 0.4 microfacet Phong 10 reflection 0.8 } }   viewpoint {     from <4.000, -1.000, 1.000> at <0.000, 0.000, 0.000> up <0, 1, 0> angle 60     resolution 640, 480 aspect 1.6 image_format 0 }       light <-10, 30, 20> light <-10, 30, -20>   object { disc <0, -2, 0>, <0, 1, 0>, 30 wooden }   object { sphere <0.000, 0.000, 0.000>, 1.00 chrome } object { cylinder <0.000, 0.000, 0.000>, <0.000, 0.000, -4.000>, 0.50 chrome }   After setting up the background and defining colors and textures, the viewpoint is specified. The “camera” is located at a point in 3D space, and it looks towards another point. The angle, image resolution, and aspect ratio are specified. Two lights are present in the image at defined coordinates. The three objects in the image are a wooden disc to represent a table top, and a sphere and cylinder that intersect to form a pin that will be used for the pin board toy in the final animation. When the image is rendered, the following image is produced. The pins are modeled with a chrome surface, so they reflect the environment around them. Note that the scale of the pin shaft is not correct, this will be fixed later. Modeling the Pin Board The frame of the pin-board is made up of three boxes, and six cylinders, the front box is modeled using a clear, slightly reflective solid, with the same refractive index of glass. The other shapes are modeled as metal. object { box <-5.5, -1.5, 1>, <5.5, 5.5, 1.2> glass } object { box <-5.5, -1.5, -0.04>, <5.5, 5.5, -0.09> steely_blue } object { box <-5.5, -1.5, -0.52>, <5.5, 5.5, -0.59> steely_blue } object { cylinder <-5.2, -1.2, 1.4>, <-5.2, -1.2, -0.74>, 0.2 steely_blue } object { cylinder <5.2, -1.2, 1.4>, <5.2, -1.2, -0.74>, 0.2 steely_blue } object { cylinder <-5.2, 5.2, 1.4>, <-5.2, 5.2, -0.74>, 0.2 steely_blue } object { cylinder <5.2, 5.2, 1.4>, <5.2, 5.2, -0.74>, 0.2 steely_blue } object { cylinder <0, -1.2, 1.4>, <0, -1.2, -0.74>, 0.2 steely_blue } object { cylinder <0, 5.2, 1.4>, <0, 5.2, -0.74>, 0.2 steely_blue }   In order to create the matrix of pins that make up the pin board I used a basic console application with a few nested loops to create two intersecting matrixes of pins, which models the layout used in the pin boards. The resulting image is shown below. The pin board contains 11,481 pins, with the scene file containing 23,709 lines of code. For the complete animation 2,000 scene files will be created, which is over 47 million lines of code. Each pin in the pin-board will slide out a specific distance when an object is pressed into the back of the board. This is easily modeled by setting the Z coordinate of the pin to a specific value. In order to set all of the pins in the pin-board to the correct position, a bitmap image can be used. The position of the pin can be set based on the color of the pixel at the appropriate position in the image. When the Windows Azure logo is used to set the Z coordinate of the pins, the following image is generated. The challenge now was to make a cool animation. The Azure Logo is fine, but it is static. Using a normal video to animate the pins would not work; the colors in the video would not be the same as the depth of the objects from the camera. In order to simulate the pin board accurately a series of frames from a depth camera could be used. Windows Kinect The Kenect controllers for the X-Box 360 and Windows feature a depth camera. The Kinect SDK for Windows provides a programming interface for Kenect, providing easy access for .NET developers to the Kinect sensors. The Kinect Explorer provided with the Kinect SDK is a great starting point for exploring Kinect from a developers perspective. Both the X-Box 360 Kinect and the Windows Kinect will work with the Kinect SDK, the Windows Kinect is required for commercial applications, but the X-Box Kinect can be used for hobby projects. The Windows Kinect has the advantage of providing a mode to allow depth capture with objects closer to the camera, which makes for a more accurate depth image for setting the pin positions. Creating a Depth Field Animation The depth field animation used to set the positions of the pin in the pin board was created using a modified version of the Kinect Explorer sample application. In order to simulate the pin board accurately, a small section of the depth range from the depth sensor will be used. Any part of the object in front of the depth range will result in a white pixel; anything behind the depth range will be black. Within the depth range the pixels in the image will be set to RGB values from 0,0,0 to 255,255,255. A screen shot of the modified Kinect Explorer application is shown below. The Kinect Explorer sample application was modified to include slider controls that are used to set the depth range that forms the image from the depth stream. This allows the fine tuning of the depth image that is required for simulating the position of the pins in the pin board. The Kinect Explorer was also modified to record a series of images from the depth camera and save them as a sequence JPEG files that will be used to animate the pins in the animation the Start and Stop buttons are used to start and stop the image recording. En example of one of the depth images is shown below. Once a series of 2,000 depth images has been captured, the task of creating the animation can begin. Rendering a Test Frame In order to test the creation of frames and get an approximation of the time required to render each frame a test frame was rendered on-premise using PolyRay. The output of the rendering process is shown below. The test frame contained 23,629 primitive shapes, most of which are the spheres and cylinders that are used for the 11,800 or so pins in the pin board. The 1280x720 image contains 921,600 pixels, but as anti-aliasing was used the number of rays that were calculated was 4,235,777, with 3,478,754,073 object boundaries checked. The test frame of the pin board with the depth field image applied is shown below. The tracing time for the test frame was 4 minutes 27 seconds, which means rendering the2,000 frames in the animation would take over 148 hours, or a little over 6 days. Although this is much faster that an old 486, waiting almost a week to see the results of an animation would make it challenging for animators to create, view, and refine their animations. It would be much better if the animation could be rendered in less than one hour. Windows Azure Worker Roles The cost of creating an on-premise render farm to render animations increases in proportion to the number of servers. The table below shows the cost of servers for creating a render farm, assuming a cost of $500 per server. Number of Servers Cost 1 $500 16 $8,000 256 $128,000   As well as the cost of the servers, there would be additional costs for networking, racks etc. Hosting an environment of 256 servers on-premise would require a server room with cooling, and some pretty hefty power cabling. The Windows Azure compute services provide worker roles, which are ideal for performing processor intensive compute tasks. With the scalability available in Windows Azure a job that takes 256 hours to complete could be perfumed using different numbers of worker roles. The time and cost of using 1, 16 or 256 worker roles is shown below. Number of Worker Roles Render Time Cost 1 256 hours $30.72 16 16 hours $30.72 256 1 hour $30.72   Using worker roles in Windows Azure provides the same cost for the 256 hour job, irrespective of the number of worker roles used. Provided the compute task can be broken down into many small units, and the worker role compute power can be used effectively, it makes sense to scale the application so that the task is completed quickly, making the results available in a timely fashion. The task of rendering 2,000 frames in an animation is one that can easily be broken down into 2,000 individual pieces, which can be performed by a number of worker roles. Creating a Render Farm in Windows Azure The architecture of the render farm is shown in the following diagram. The render farm is a hybrid application with the following components: ·         On-Premise o   Windows Kinect – Used combined with the Kinect Explorer to create a stream of depth images. o   Animation Creator – This application uses the depth images from the Kinect sensor to create scene description files for PolyRay. These files are then uploaded to the jobs blob container, and job messages added to the jobs queue. o   Process Monitor – This application queries the role instance lifecycle table and displays statistics about the render farm environment and render process. o   Image Downloader – This application polls the image queue and downloads the rendered animation files once they are complete. ·         Windows Azure o   Azure Storage – Queues and blobs are used for the scene description files and completed frames. A table is used to store the statistics about the rendering environment.   The architecture of each worker role is shown below.   The worker role is configured to use local storage, which provides file storage on the worker role instance that can be use by the applications to render the image and transform the format of the image. The service definition for the worker role with the local storage configuration highlighted is shown below. <?xml version="1.0" encoding="utf-8"?> <ServiceDefinition name="CloudRay" >   <WorkerRole name="CloudRayWorkerRole" vmsize="Small">     <Imports>     </Imports>     <ConfigurationSettings>       <Setting name="DataConnectionString" />     </ConfigurationSettings>     <LocalResources>       <LocalStorage name="RayFolder" cleanOnRoleRecycle="true" />     </LocalResources>   </WorkerRole> </ServiceDefinition>     The two executable programs, PolyRay.exe and DTA.exe are included in the Azure project, with Copy Always set as the property. PolyRay will take the scene description file and render it to a Truevision TGA file. As the TGA format has not seen much use since the mid 90’s it is converted to a JPG image using Dave's Targa Animator, another shareware application from the 90’s. Each worker roll will use the following process to render the animation frames. 1.       The worker process polls the job queue, if a job is available the scene description file is downloaded from blob storage to local storage. 2.       PolyRay.exe is started in a process with the appropriate command line arguments to render the image as a TGA file. 3.       DTA.exe is started in a process with the appropriate command line arguments convert the TGA file to a JPG file. 4.       The JPG file is uploaded from local storage to the images blob container. 5.       A message is placed on the images queue to indicate a new image is available for download. 6.       The job message is deleted from the job queue. 7.       The role instance lifecycle table is updated with statistics on the number of frames rendered by the worker role instance, and the CPU time used. The code for this is shown below. public override void Run() {     // Set environment variables     string polyRayPath = Path.Combine(Environment.GetEnvironmentVariable("RoleRoot"), PolyRayLocation);     string dtaPath = Path.Combine(Environment.GetEnvironmentVariable("RoleRoot"), DTALocation);       LocalResource rayStorage = RoleEnvironment.GetLocalResource("RayFolder");     string localStorageRootPath = rayStorage.RootPath;       JobQueue jobQueue = new JobQueue("renderjobs");     JobQueue downloadQueue = new JobQueue("renderimagedownloadjobs");     CloudRayBlob sceneBlob = new CloudRayBlob("scenes");     CloudRayBlob imageBlob = new CloudRayBlob("images");     RoleLifecycleDataSource roleLifecycleDataSource = new RoleLifecycleDataSource();       Frames = 0;       while (true)     {         // Get the render job from the queue         CloudQueueMessage jobMsg = jobQueue.Get();           if (jobMsg != null)         {             // Get the file details             string sceneFile = jobMsg.AsString;             string tgaFile = sceneFile.Replace(".pi", ".tga");             string jpgFile = sceneFile.Replace(".pi", ".jpg");               string sceneFilePath = Path.Combine(localStorageRootPath, sceneFile);             string tgaFilePath = Path.Combine(localStorageRootPath, tgaFile);             string jpgFilePath = Path.Combine(localStorageRootPath, jpgFile);               // Copy the scene file to local storage             sceneBlob.DownloadFile(sceneFilePath);               // Run the ray tracer.             string polyrayArguments =                 string.Format("\"{0}\" -o \"{1}\" -a 2", sceneFilePath, tgaFilePath);             Process polyRayProcess = new Process();             polyRayProcess.StartInfo.FileName =                 Path.Combine(Environment.GetEnvironmentVariable("RoleRoot"), polyRayPath);             polyRayProcess.StartInfo.Arguments = polyrayArguments;             polyRayProcess.Start();             polyRayProcess.WaitForExit();               // Convert the image             string dtaArguments =                 string.Format(" {0} /FJ /P{1}", tgaFilePath, Path.GetDirectoryName (jpgFilePath));             Process dtaProcess = new Process();             dtaProcess.StartInfo.FileName =                 Path.Combine(Environment.GetEnvironmentVariable("RoleRoot"), dtaPath);             dtaProcess.StartInfo.Arguments = dtaArguments;             dtaProcess.Start();             dtaProcess.WaitForExit();               // Upload the image to blob storage             imageBlob.UploadFile(jpgFilePath);               // Add a download job.             downloadQueue.Add(jpgFile);               // Delete the render job message             jobQueue.Delete(jobMsg);               Frames++;         }         else         {             Thread.Sleep(1000);         }           // Log the worker role activity.         roleLifecycleDataSource.Alive             ("CloudRayWorker", RoleLifecycleDataSource.RoleLifecycleId, Frames);     } }     Monitoring Worker Role Instance Lifecycle In order to get more accurate statistics about the lifecycle of the worker role instances used to render the animation data was tracked in an Azure storage table. The following class was used to track the worker role lifecycles in Azure storage.   public class RoleLifecycle : TableServiceEntity {     public string ServerName { get; set; }     public string Status { get; set; }     public DateTime StartTime { get; set; }     public DateTime EndTime { get; set; }     public long SecondsRunning { get; set; }     public DateTime LastActiveTime { get; set; }     public int Frames { get; set; }     public string Comment { get; set; }       public RoleLifecycle()     {     }       public RoleLifecycle(string roleName)     {         PartitionKey = roleName;         RowKey = Utils.GetAscendingRowKey();         Status = "Started";         StartTime = DateTime.UtcNow;         LastActiveTime = StartTime;         EndTime = StartTime;         SecondsRunning = 0;         Frames = 0;     } }     A new instance of this class is created and added to the storage table when the role starts. It is then updated each time the worker renders a frame to record the total number of frames rendered and the total processing time. These statistics are used be the monitoring application to determine the effectiveness of use of resources in the render farm. Rendering the Animation The Azure solution was deployed to Windows Azure with the service configuration set to 16 worker role instances. This allows for the application to be tested in the cloud environment, and the performance of the application determined. When I demo the application at conferences and user groups I often start with 16 instances, and then scale up the application to the full 256 instances. The configuration to run 16 instances is shown below. <?xml version="1.0" encoding="utf-8"?> <ServiceConfiguration serviceName="CloudRay" xmlns="http://schemas.microsoft.com/ServiceHosting/2008/10/ServiceConfiguration" osFamily="1" osVersion="*">   <Role name="CloudRayWorkerRole">     <Instances count="16" />     <ConfigurationSettings>       <Setting name="DataConnectionString"         value="DefaultEndpointsProtocol=https;AccountName=cloudraydata;AccountKey=..." />     </ConfigurationSettings>   </Role> </ServiceConfiguration>     About six minutes after deploying the application the first worker roles become active and start to render the first frames of the animation. The CloudRay Monitor application displays an icon for each worker role instance, with a number indicating the number of frames that the worker role has rendered. The statistics on the left show the number of active worker roles and statistics about the render process. The render time is the time since the first worker role became active; the CPU time is the total amount of processing time used by all worker role instances to render the frames.   Five minutes after the first worker role became active the last of the 16 worker roles activated. By this time the first seven worker roles had each rendered one frame of the animation.   With 16 worker roles u and running it can be seen that one hour and 45 minutes CPU time has been used to render 32 frames with a render time of just under 10 minutes.     At this rate it would take over 10 hours to render the 2,000 frames of the full animation. In order to complete the animation in under an hour more processing power will be required. Scaling the render farm from 16 instances to 256 instances is easy using the new management portal. The slider is set to 256 instances, and the configuration saved. We do not need to re-deploy the application, and the 16 instances that are up and running will not be affected. Alternatively, the configuration file for the Azure service could be modified to specify 256 instances.   <?xml version="1.0" encoding="utf-8"?> <ServiceConfiguration serviceName="CloudRay" xmlns="http://schemas.microsoft.com/ServiceHosting/2008/10/ServiceConfiguration" osFamily="1" osVersion="*">   <Role name="CloudRayWorkerRole">     <Instances count="256" />     <ConfigurationSettings>       <Setting name="DataConnectionString"         value="DefaultEndpointsProtocol=https;AccountName=cloudraydata;AccountKey=..." />     </ConfigurationSettings>   </Role> </ServiceConfiguration>     Six minutes after the new configuration has been applied 75 new worker roles have activated and are processing their first frames.   Five minutes later the full configuration of 256 worker roles is up and running. We can see that the average rate of frame rendering has increased from 3 to 12 frames per minute, and that over 17 hours of CPU time has been utilized in 23 minutes. In this test the time to provision 140 worker roles was about 11 minutes, which works out at about one every five seconds.   We are now half way through the rendering, with 1,000 frames complete. This has utilized just under three days of CPU time in a little over 35 minutes.   The animation is now complete, with 2,000 frames rendered in a little over 52 minutes. The CPU time used by the 256 worker roles is 6 days, 7 hours and 22 minutes with an average frame rate of 38 frames per minute. The rendering of the last 1,000 frames took 16 minutes 27 seconds, which works out at a rendering rate of 60 frames per minute. The frame counts in the server instances indicate that the use of a queue to distribute the workload has been very effective in distributing the load across the 256 worker role instances. The first 16 instances that were deployed first have rendered between 11 and 13 frames each, whilst the 240 instances that were added when the application was scaled have rendered between 6 and 9 frames each.   Completed Animation I’ve uploaded the completed animation to YouTube, a low resolution preview is shown below. Pin Board Animation Created using Windows Kinect and 256 Windows Azure Worker Roles   The animation can be viewed in 1280x720 resolution at the following link: http://www.youtube.com/watch?v=n5jy6bvSxWc Effective Use of Resources According to the CloudRay monitor statistics the animation took 6 days, 7 hours and 22 minutes CPU to render, this works out at 152 hours of compute time, rounded up to the nearest hour. As the usage for the worker role instances are billed for the full hour, it may have been possible to render the animation using fewer than 256 worker roles. When deciding the optimal usage of resources, the time required to provision and start the worker roles must also be considered. In the demo I started with 16 worker roles, and then scaled the application to 256 worker roles. It would have been more optimal to start the application with maybe 200 worker roles, and utilized the full hour that I was being billed for. This would, however, have prevented showing the ease of scalability of the application. The new management portal displays the CPU usage across the worker roles in the deployment. The average CPU usage across all instances is 93.27%, with over 99% used when all the instances are up and running. This shows that the worker role resources are being used very effectively. Grid Computing Scenarios Although I am using this scenario for a hobby project, there are many scenarios where a large amount of compute power is required for a short period of time. Windows Azure provides a great platform for developing these types of grid computing applications, and can work out very cost effective. ·         Windows Azure can provide massive compute power, on demand, in a matter of minutes. ·         The use of queues to manage the load balancing of jobs between role instances is a simple and effective solution. ·         Using a cloud-computing platform like Windows Azure allows proof-of-concept scenarios to be tested and evaluated on a very low budget. ·         No charges for inbound data transfer makes the uploading of large data sets to Windows Azure Storage services cost effective. (Transaction charges still apply.) Tips for using Windows Azure for Grid Computing Scenarios I found the implementation of a render farm using Windows Azure a fairly simple scenario to implement. I was impressed by ease of scalability that Azure provides, and by the short time that the application took to scale from 16 to 256 worker role instances. In this case it was around 13 minutes, in other tests it took between 10 and 20 minutes. The following tips may be useful when implementing a grid computing project in Windows Azure. ·         Using an Azure Storage queue to load-balance the units of work across multiple worker roles is simple and very effective. The design I have used in this scenario could easily scale to many thousands of worker role instances. ·         Windows Azure accounts are typically limited to 20 cores. If you need to use more than this, a call to support and a credit card check will be required. ·         Be aware of how the billing model works. You will be charged for worker role instances for the full clock our in which the instance is deployed. Schedule the workload to start just after the clock hour has started. ·         Monitor the utilization of the resources you are provisioning, ensure that you are not paying for worker roles that are idle. ·         If you are deploying third party applications to worker roles, you may well run into licensing issues. Purchasing software licenses on a per-processor basis when using hundreds of processors for a short time period would not be cost effective. ·         Third party software may also require installation onto the worker roles, which can be accomplished using start-up tasks. Bear in mind that adding a startup task and possible re-boot will add to the time required for the worker role instance to start and activate. An alternative may be to use a prepared VM and use VM roles. ·         Consider using the Windows Azure Autoscaling Application Block (WASABi) to autoscale the worker roles in your application. When using a large number of worker roles, the utilization must be carefully monitored, if the scaling algorithms are not optimal it could get very expensive!

    Read the article

  • Bing maps silverlight control custom pushpin

    - by Razvi
    I tried to make a custom pushpin for the Bing Maps silverlight control, but I can only add 1 pushpin. At the second pushpin I get the following error: System.ArgumentException: Value does not fall within the expected range. at MS.Internal.XcpImports.CheckHResult(UInt32 hr) at MS.Internal.XcpImports.Collection_AddValue[T](PresentationFrameworkCollection`1 collection, CValue value) at MS.Internal.XcpImports.Collection_AddDependencyObject[T](PresentationFrameworkCollection`1 collection, DependencyObject value) at System.Windows.PresentationFrameworkCollection`1.AddDependencyObject(DependencyObject value) at System.Windows.Controls.UIElementCollection.AddInternal(UIElement value) at System.Windows.PresentationFrameworkCollection`1.Add(T value) at MapInfo.Silverlight.CitiesControl.MainPage.c_GetCitiesCompleted(Object sender, GetCitiesCompletedEventArgs e) Does anyone know what I might be doing wrong? I am setting the following properties before adding it to the map: public Location Location { get { return this.GetValue(MapLayer.PositionProperty) as Location; } set { this.SetValue(MapLayer.PositionProperty, value); } } this.SetValue(MapLayer.PositionOriginProperty, PositionOrigin.BottomLeft);

    Read the article

  • pre-commit hook in svn: could not be translated from the native locale to UTF-8

    - by Alexandre Moraes
    Hi everybody, I have a problem with my pre-commit hook. This hook test if a file is locked when the user commits. When a bad condition happens, it should output that the another user is locking this file or if nobody is locking, it should show "you are not locking this file message (file´s name)". The error happens when the file´s name has some latin character like "ç" and tortoise show me this in the output. Commit failed (details follow): Commit blocked by pre-commit hook (exit code 1) with output: [Erro output could not be translated from the native locale to UTF-8.] Do you know how can I solve this? Thanks, Alexandre My shell script is here: #!/bin/sh REPOS="$1" TXN="$2" export LANG="en_US.UTF-8" /app/svn/hooks/ensure-has-need-lock.pl "$REPOS" "$TXN" if [ $? -ne 0 ]; then exit 1; fi exit 0 And my perl is here: !/usr/bin/env perl #Turn on warnings the best way depending on the Perl version. BEGIN { if ( $] >= 5.006_000) { require warnings; import warnings; } else { $^W = 1; } } use strict; use Carp; &usage unless @ARGV == 2; my $repos = shift; my $txn = shift; my $svnlook = "/usr/local/bin/svnlook"; my $user; my $ok = 1; foreach my $program ($svnlook) { if (-e $program) { unless (-x $program) { warn "$0: required program $program' is not executable, ", "edit $0.\n"; $ok = 0; } } else { warn "$0: required program $program' does not exist, edit $0.\n"; $ok = 0; } } exit 1 unless $ok; unless (-e $repos){ &usage("$0: repository directory $repos' does not exist."); } unless (-d $repos){ &usage("$0: repository directory $repos' is not a directory."); } foreach my $user_tmp (&read_from_process($svnlook, 'author', $repos, '-t', $txn)) { $user = $user_tmp; } my @errors; foreach my $transaction (&read_from_process($svnlook, 'changed', $repos, '-t', $txn)){ if ($transaction =~ /^U. (.*[^\/])$/){ my $file = $1; my $err = 0; foreach my $locks (&read_from_process($svnlook, 'lock', $repos, $file)){ $err = 1; if($locks=~ /Owner: (.*)/){ if($1 != $user){ push @errors, "$file : You are not locking this file!"; } } } if($err==0){ push @errors, "$file : You are not locking this file!"; } } elsif($transaction =~ /^D. (.*[^\/])$/){ my $file = $1; my $tchan = &read_from_process($svnlook, 'lock', $repos, $file); foreach my $locks (&read_from_process($svnlook, 'lock', $repos, $file)){ push @errors, "$1 : cannot delete locked Files"; } } elsif($transaction =~ /^A. (.*[^\/])$/){ my $needs_lock; my $path = $1; foreach my $prop (&read_from_process($svnlook, 'proplist', $repos, '-t', $txn, '--verbose', $path)){ if ($prop =~ /^\s*svn:needs-lock : (\S+)/){ $needs_lock = $1; } } if (not $needs_lock){ push @errors, "$path : svn:needs-lock is not set. Pleas ask TCC for support."; } } } if (@errors) { warn "$0:\n\n", join("\n", @errors), "\n\n"; exit 1; } else { exit 0; } sub usage { warn "@_\n" if @_; die "usage: $0 REPOS TXN-NAME\n"; } sub safe_read_from_pipe { unless (@_) { croak "$0: safe_read_from_pipe passed no arguments.\n"; } print "Running @_\n"; my $pid = open(SAFE_READ, '-|'); unless (defined $pid) { die "$0: cannot fork: $!\n"; } unless ($pid) { open(STDERR, ">&STDOUT") or die "$0: cannot dup STDOUT: $!\n"; exec(@_) or die "$0: cannot exec @_': $!\n"; } my @output; while (<SAFE_READ>) { chomp; push(@output, $_); } close(SAFE_READ); my $result = $?; my $exit = $result >> 8; my $signal = $result & 127; my $cd = $result & 128 ? "with core dump" : ""; if ($signal or $cd) { warn "$0: pipe from @_' failed $cd: exit=$exit signal=$signal\n"; } if (wantarray) { return ($result, @output); } else { return $result; } } sub read_from_process { unless (@_) { croak "$0: read_from_process passed no arguments.\n"; } my ($status, @output) = &safe_read_from_pipe(@_); if ($status) { if (@output) { die "$0: @_' failed with this output:\n", join("\n", @output), "\n"; } else { die "$0: @_' failed with no output.\n"; } } else { return @output; } }

    Read the article

  • Silverlight Ftp Upload

    - by Curtis
    Hi I'm working on trying to ftp a file to the server through a silverlight application. Where the location to upload the file on server file system, exists outside the sandbox area for the web server. In this case the web server root exists at "C:\test\www\" and the location to upload the file will exist at "C:\User\Uploads". In this scenerio i'm not sure if Http POST will work (doesn't that use the web server root). I just need to upload the file selected by the user to a different location that may exist outside the sandbox. With silverlight i'm thinking sockets are my last option based on the limited port range for silverlight being 4502-4532. Can i do this using WebClient and Http POST? Can i make an ftp connection through silverlight or javascript?

    Read the article

  • Unable to resolve class in build.gradle using Android Studio 0.60/Gradle 0.11

    - by saywhatnow
    Established app working fine using Android Studio 0.5.9/ Gradle 0.9 but upgrading to Android Studio 0.6.0/ Gradle 0.11 causes the error below. Somehow Studio seems to have lost the ability to resolve the android tools import at the top of the build.gradle file. Anyone got any ideas on how to solve this? build file 'Users/[me]/Repositories/[project]/[module]/build.gradle': 1: unable to resolve class com.android.builder.DefaultManifestParser @ line 1, column 1. import com.android.builder.DefaultManifestParser 1 error at org.codehaus.groovy.control.ErrorCollector.failIfErrors(ErrorCollector.java:302) at org.codehaus.groovy.control.CompilationUnit.applyToSourceUnits(CompilationUnit.java:858) at org.codehaus.groovy.control.CompilationUnit.doPhaseOperation(CompilationUnit.java:548) at org.codehaus.groovy.control.CompilationUnit.compile(CompilationUnit.java:497) at groovy.lang.GroovyClassLoader.doParseClass(GroovyClassLoader.java:306) at groovy.lang.GroovyClassLoader.parseClass(GroovyClassLoader.java:287) at org.gradle.groovy.scripts.internal.DefaultScriptCompilationHandler.compileScript(DefaultScriptCompilationHandler.java:115) ... 77 more 2014-06-09 10:15:28,537 [ 92905] INFO - .BaseProjectImportErrorHandler - Failed to import Gradle project at '/Users/[me]/Repositories/[project]' org.gradle.tooling.BuildException: Could not run build action using Gradle distribution 'http://services.gradle.org/distributions/gradle-1.12-all.zip'. at org.gradle.tooling.internal.consumer.ResultHandlerAdapter.onFailure(ResultHandlerAdapter.java:53) at org.gradle.tooling.internal.consumer.async.DefaultAsyncConsumerActionExecutor$1$1.run(DefaultAsyncConsumerActionExecutor.java:57) at org.gradle.internal.concurrent.DefaultExecutorFactory$StoppableExecutorImpl$1.run(DefaultExecutorFactory.java:64) [project]/[module]/build.gradle import com.android.builder.DefaultManifestParser apply plugin: 'android-sdk-manager' apply plugin: 'android' android { sourceSets { main { manifest.srcFile 'src/main/AndroidManifest.xml' res.srcDirs = ['src/main/res'] } debug { res.srcDirs = ['src/debug/res'] } release { res.srcDirs = ['src/release/res'] } } compileSdkVersion 19 buildToolsVersion '19.0.0' defaultConfig { minSdkVersion 14 targetSdkVersion 19 } signingConfigs { release } buildTypes { release { runProguard false proguardFiles getDefaultProguardFile('proguard-android.txt'), 'proguard-rules.txt' signingConfig signingConfigs.release applicationVariants.all { variant -> def file = variant.outputFile def manifestParser = new DefaultManifestParser() def wmgVersionCode = manifestParser.getVersionCode(android.sourceSets.main.manifest.srcFile) println wmgVersionCode variant.outputFile = new File(file.parent, file.name.replace("-release.apk", "_" + wmgVersionCode + ".apk")) } } } packagingOptions { exclude 'META-INF/LICENSE.txt' exclude 'META-INF/NOTICE.txt' } } def Properties props = new Properties() def propFile = file('signing.properties') if (propFile.canRead()){ props.load(new FileInputStream(propFile)) if (props!=null && props.containsKey('STORE_FILE') && props.containsKey('STORE_PASSWORD') && props.containsKey('KEY_ALIAS') && props.containsKey('KEY_PASSWORD')) { println 'RELEASE BUILD SIGNING' android.signingConfigs.release.storeFile = file(props['STORE_FILE']) android.signingConfigs.release.storePassword = props['STORE_PASSWORD'] android.signingConfigs.release.keyAlias = props['KEY_ALIAS'] android.signingConfigs.release.keyPassword = props['KEY_PASSWORD'] } else { println 'RELEASE BUILD NOT FOUND SIGNING PROPERTIES' android.buildTypes.release.signingConfig = null } }else { println 'RELEASE BUILD NOT FOUND SIGNING FILE' android.buildTypes.release.signingConfig = null } repositories { maven { url 'https://repo.commonsware.com.s3.amazonaws.com' } maven { url 'https://oss.sonatype.org/content/repositories/snapshots/' } } dependencies { compile 'com.github.gabrielemariotti.changeloglib:library:1.4.+' compile 'com.google.code.gson:gson:2.2.4' compile 'com.google.android.gms:play-services:+' compile 'com.android.support:appcompat-v7:+' compile 'com.squareup.okhttp:okhttp:1.5.+' compile 'com.octo.android.robospice:robospice:1.4.11' compile 'com.octo.android.robospice:robospice-cache:1.4.11' compile 'com.octo.android.robospice:robospice-retrofit:1.4.11' compile 'com.commonsware.cwac:security:0.1.+' compile 'com.readystatesoftware.sqliteasset:sqliteassethelper:+' compile 'com.android.support:support-v4:19.+' compile 'uk.co.androidalliance:edgeeffectoverride:1.0.1+' compile 'de.greenrobot:eventbus:2.2.1+' compile project(':captureActivity') compile ('de.keyboardsurfer.android.widget:crouton:1.8.+') { exclude group: 'com.google.android', module: 'support-v4' } compile files('libs/CWAC-LoaderEx.jar') }

    Read the article

  • WiX unresolved reference error

    - by David
    I'm using Wix version 3.0.5419.0. I have two .wxs files, one which is a fragment, and another which uses the fragment to create the .msi file. Here is the file which uses the fragment (DaisyFarmer.wxs): <?xml version='1.0' encoding='windows-1252'?> <Wix xmlns='http://schemas.microsoft.com/wix/2006/wi' xmlns:iis='http://schemas.microsoft.com/wix/IIsExtension'> <Product Name='Daisy Web Site 1.0' Id='BB7FBBE4-0A25-4cc7-A39C-AC916B665220' UpgradeCode='8A5311DE-A125-418f-B0E1-5A30B9C667BD' Language='1033' Codepage='1252' Version='1.0.0' Manufacturer='the man'> <Package Id='5F341544-4F95-4e01-A2F8-EF74448C0D6D' Keywords='Installer' Description="desc" Manufacturer='the man' InstallerVersion='100' Languages='1033' Compressed='yes' SummaryCodepage='1252' /> <Media Id='1' Cabinet='Sample.cab' EmbedCab='yes' DiskPrompt="CD-ROM #1" /> <Property Id='DiskPrompt' Value="the man" /> <PropertyRef Id="NETFRAMEWORK35"/> <Condition Message='This setup requires the .NET Framework 3.5.'> <![CDATA[Installed OR (NETFRAMEWORK35)]]> </Condition> <Feature Id='DaisyFarmer' Title='DaisyFarmer' Level='1'> <ComponentRef Id='SchedulerComponent' /> </Feature> </Product> </Wix> The fragment I'm referencing is (Scheduler.wxs): <?xml version="1.0" encoding="utf-8"?> <Wix xmlns="http://schemas.microsoft.com/wix/2006/wi"> <Fragment> <DirectoryRef Id="TARGETDIR"> <Directory Id="dir2787390E4B7313EB8005DE08108EFEA4" Name="scheduler"> <Component Id="SchedulerComponent" Guid="{9254F7E1-DE41-4EE5-BC0F-BA668AF051CB}"> <File Id="fil9A013D0BFB837BAC71FED09C59C5501B" KeyPath="yes" Source="SourceDir\DTBookMonitor.exe" /> <File Id="fil4F0D8D05F53E6AFBDB498E7C75C2D98F" KeyPath="no" Source="SourceDir\DTBookMonitor.exe.config" /> <File Id="filF02F4686267D027CB416E044E8C8C2FA" KeyPath="no" Source="SourceDir\monitor.bat" /> <File Id="fil05B8FF38A3C85FE6C4A58CD6FDFCD2FB" KeyPath="no" Source="SourceDir\output.txt" /> <File Id="fil397F04E2527DCFDF7E8AC1DD92E48264" KeyPath="no" Source="SourceDir\pipelineOutput.txt" /> <File Id="fil83DFACFE7F661A9FF89AA17428474929" KeyPath="no" Source="SourceDir\process.bat" /> <File Id="fil2809039236E0072642C52C6A52AD6F2F" KeyPath="no" Source="SourceDir\README.txt" /> </Component> </Directory> </DirectoryRef> </Fragment> </Wix> I then run the following commands: candle -ext WixUtilExtension -ext WiXNetFxExtension DaisyFarmer.wxs Scheduler.wxs light -sice:ICE20 -ext WixUtilExtension -ext WiXNetFxExtension Scheduler.wixobj DaisyFarmer.wixobj -out DaisyFarmer.msi I'm getting an error when I run light.exe which says "DaisyFarmer.wxs(20) : error LGHT0094 : Unresolved reference to symbol 'Component:SchedulerComponent' in section 'Product:{BB7FBBE4-0A25-4CC7-A39C-AC916B665220}'." What am I missing?

    Read the article

  • Seriously, what's the deal with InheritInChildApplications? Does this work for anyone??

    - by mare
    I've tried wrapping my <system.web> with <location path="." InheritInChildApplications="false"> like this <location path="." InheritInChildApplications="false"> <system.web>...</system.web> </location> But VS 2010 Web Developer Express keeps saying "The 'InheritInChildApplications' attribute is not allowed" and when I run my web app there's an error: "HTTP Error 500.19 - Internal Server Error The requested page cannot be accessed because the related configuration data for the page is invalid." Config Error Unrecognized attribute 'InheritInChildApplications'. I've seen some smartguys all over the Internet discussing this and how it is working for them but there's much larger number of people here at SO and other places that did not get this to work. My configuration: ASP.NET 4.0 RTM, VS 2010, IIS 7.5

    Read the article

< Previous Page | 745 746 747 748 749 750 751 752 753 754 755 756  | Next Page >