Search Results

Search found 7855 results on 315 pages for 'keyzo it solutions'.

Page 78/315 | < Previous Page | 74 75 76 77 78 79 80 81 82 83 84 85  | Next Page >

  • How to prevent dual booted OSes from damaging each other?

    - by user1252434
    For better compatibility and performance in games I'm thinking about installing Windows additionally to Linux. I have security concerns about this, though. Note: "Windows" in the remaining text includes not only the OS but also any software running on it. Regardless of whether it comes included or is additionally installed, whether it is started intentionally or unintentionally (virus, malware). Is there an easy way to achieve the following requirements: Windows MUST NOT be able to kill my linux partition or my data disk neither single files (virus infection) nor overwriting the whole disk Windows MUST NOT be able to read data disk (- extra protection against spyware) Linux may or may not have access to the windows partition both Linux and Windows should have full access to the graphics card this rules out desktop VM solutions for gaming I want the manufacturer's windows graphics card driver Regarding Windows to be unable to destroy my linux install: this is not just the usual paranoia, that has happened to me in the past. So I don't accept "no ext4 driver" as an argument. Once bitten, twice shy. And even if destruction targeted at specific (linux) files is nearly impossible, there should be no way to shred the whole partition. I may accept the risk of malware breaking out of a barrier (e.g. VM) around the whole windows box, though. Currently I have a system disk (SSD) and a data disk (HDD), both SATA. I expect I have to add another disk. If i don't: even better. My CPU is a Intel Core i5, with VT-x and VT-d available, though untested. Ideas I've had so far: deactivate or hide other HDs until reboot at low level possible? can the boot loader (grub) do this for me? tiny VM layer: load windows in a VM that provides access to almost all hardware, except the HDs any ready made software solution for this? Preferably free. as I said: the main problem seems to be to provide full access to the graphics card hardware switch to cut power to disks commercial products expensive and lots of warnings against cheap home built solutions preferably all three hard disks with one switch (one push) mobile racks - won't wear of daily swapping be a problem?

    Read the article

  • Userscript to add website screenshot for each google search result?

    - by naxa
    Before the "preview pane" for google web search results came out from their labs, there already were userscripts to have a visual snapshot for each and every website in a web search query result. Now with the default preview, one needs to hover over the preview button for each site and gets a big (and slower) preview. The older, user-made solutions put the screenshot there for each result element. How could I achieve to get a screenshot statically for every item in the search result nowadays?

    Read the article

  • Cant send email attachment from with Excel or Word 2003

    - by redknight
    I have a problem when I am trying to send the excel sheet or document I am working on as an email attachement. The message I am getting is General Mail Failure. Quit Microsoft Excel,restart the mail system.try again. I have checked, all possible solutions, but no luck. Any suggestions on how to solve this problem?

    Read the article

  • How can virtualization be efficient?

    - by pestaa
    As I understand, the virtual machine and the guest OS doubles the amount of abstraction layers (that are computationally relevant) between the user interface and the pure power of the hardware. Some of the said abstraction layers are (emulated) hardware, drivers, IO interfaces, etc. Top-notch virtualization solutions like Xen probably eliminate a few of these complexities, but I still wonder how efficiency is achieved in these environments; and whether manageable cloud servers are really worth the performance price.

    Read the article

  • Take a screenshot of an entire webpage in Opera

    - by robertc
    Is there some tool within Opera, or possibly an add-on, which will let me take a screenshot of an entire web page? I usually use Screengrab to do this with Firefox, but in this situation I want a screenshot of the page as Opera renders it (because I want to show the page as rendered with HTML5 form controls like date and time). I am currently using Opera 10.60 x86_64 on Fedora 12, so solutions that work in browser would be preferable rather than external programs.

    Read the article

  • WebDav uploads fail on files with certain characters on Apache

    - by bnferguson
    Have webdav uploads working great on one our boxes but anytime there is a ; # or * (and maybe a few others) the upload fails. That is expected since they're restricted characters but I'm curious if there's a way to rewrite/rename those files on their way through. We don't care what the name is really it just has to make it up to the server. Started looking at mod_rewrite solutions but my rewrite fu is rather weak.

    Read the article

  • How do you protect your <appid>.appspot.com domain from DDOS attack?

    - by jacob
    If I want to use CloudFlare to help protect my GAE app via it's custom domain, I still am vulnerable to attacks directly on the .appspot.com domain. How do I mitigate that? I could force redirect appspot.com host requests, such as discussed here: http://stackoverflow.com/questions/1364733/block-requests-from-appspot-com-and-force-custom-domain-in-google-app-engine/ But I would still suffer the load of processing the redirect in my app. Are there any other solutions?

    Read the article

  • In-Page RSS Reader (Flash? Javascript?)

    - by Jonathan Sampson
    Has anybody ever seen any (no-installs-necessary) solutions to listing any RSS feed on any page of a website? Ideally it would consist of HTML (javascript if necessary) and require no downloads or installs. I am thinking of twitter-style apps that you load up in an iframe or via Javascript and in turn they show your latest tweets on the page - same concept, different content. Just looking for a shiny gadget, not able to write my own solution for this particular project.

    Read the article

  • Virtual session on windows xp

    - by dotnet-practitioner
    What is the easiest way to install , setup, and run virtual session on my fresh install on my windows xp computer? I want to be able to browse , install a new software in a new virtual session instead of machine itself. What is available out there? What kind of software it would take and are there any free solutions out there? Easiest solution would be very helpful for me.

    Read the article

  • Hardware for multipurpose home server

    - by Michael Dmitry Azarkevich
    Hi guys, I'm looking to set up a multipurpose home server and hoped you could help me with the hardware selection. First of all, the services it will provide: Hosting a MySQL database (for training and testing purposes) FTP server Personal Mail Server Home media server So with this in mind I've done some research, and found some viable solutions: A standard PC with the appropriate software (Either second hand or new) A non-solid state mini-ITX system A solid state, fanless mini-ITX system I've also noted the pros and cons of each system: A standard second hand PC with old hardware would be the cheapest option. It could also have lacking processing power, not enough RAM and generally faulty hardware. Also, huge power consumption heat generation and noise levels. A standard new PC would have top-notch hardware and will stay that way for quite some time, so it's a good investment. But again, the main problem is power consumption, heat generation and noise levels. A non-solid state mini-ITX system would have the advantages of lower power consumption, lower cost (as far as I can see) and long lasting hardware. But it will generate noise and heat which will be even worse because of the size. A solid state, fanless mini-ITX system would have all the advantages of a non-solid state mini-ITX but with minimal noise and heat. The main disadvantage is the read\write problems of flash memory. All in all I'm leaning towards a non-solid state mini-ITX because of the read\write issues of flash memory. So, after this overview of what I do know, my questions are: Are all these services even providable from a single server? To my best understanding they are, but then again, I might be wrong. Is any of these solutions viable? If yes, which one is the best for my purposes? If not, what would you suggest? Also, on a more software oriented note: OS wise, I'm planning to run Linux. I'm currently thinking of four options I've been recommended: CentOS, Gentoo, DSL (Damn Small Linux) and LFS (Linux From Scratch). Any thoughts on this? Any other distro you would recomend? Regarding FTP services, I've herd good things about FileZila. Anyone has any experience with that? Do you recommend it? Do you recommend something else? Regarding the Mail service, I know nothing about this except that it exists. Any software you recommend for this task? Home media, same as mail service. Any recommended software? Thank you very much.

    Read the article

  • Website & Forum sharing the same login credentials ?

    - by Brian
    I am going to be running a small site (100 hits a week maybe) and I am looking for a quick and easy way to share login information between the main website, a control panel (webmin, cpanel, or something), and the forum. One login needed to access any of the three. The website won't have use for the login, per say. But it will display "logged in" when you are on the website. Any custom solutions, any thoughts, logic, examples?

    Read the article

  • Recommendations for remote server management software, similar to Puppet or Canonical Landscape?

    - by rmh
    We currently have five Ubuntu 10.04 LTS servers, and keeping them all up-to-date is starting to be a pain. I've been looking into solutions like Puppet and Canonical Landscape. Out of the two I prefer Puppet -- it would be useful to be able to ensure the permissions of various directories on the machines, and define groups and users on the server which are then propagated to clients. Is there any other software in this vein that I should be taking a look at?

    Read the article

  • How do you monitor and react when some scheduled job fails? - general question

    - by Dzida
    Hi, In many projects my team faced problems with 'silent fails' of some important components. There are lot of tasks executed behind the scenes and if somethings fails (either by errors in logic or hardware problems) in most cases responsible person is not notified (or not notified instantly). I know about heavy-weight monitoring tools that could solve some of that problems but there over-complicated and too expensive for our team. I am interested what are your solutions for such problems.

    Read the article

  • Blocking IP addresses Load Balanced Cluster

    - by Dom
    Hi We're using HAproxy as a front end load balancer / proxy and are looking for solutions to block random IP addresses from jamming the cluster. Is anyone familiar with a conf for HAProxy that can block requests if they exceed a certain threshold from a single IP within a defined period of time. Or can anyone suggest a software solution which could be placed in front of HAProxy to handle this kind of blocking. Thanks Dom--

    Read the article

  • unable to type in web browser ubuntu 64bit

    - by mononym
    Hi Guys, I upgraded to 64bit ubuntu and every now and again (quite often though) i am unable to to type into the search box for google in chrome and firefox, i havent tried other browsers as these are the 2 i primarily use. Has anyone else experienced this? any solutions? also i'm unable to drag the slider in youtube (in firefox) to scan through videos.

    Read the article

  • Free web gallery installation that can use existing directory hierarchy in filesystem?

    - by user1338062
    There are several different free software gallery projects (Gallery, Coppermine, etc), but as far as I know each of those creates a copy of imported images in their internal storage, be it directory structure or database). Is there any gallery software that would allow keeping existing directory hierarchy of media files (images, videos), as-is, and just store the meta-data of them in a database? I guess at least various NAS solutions ship with software like this.

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • Circumvent proxy filter that disables the download of EXE files

    - by elgrego
    Do you know of a way to download exe files although the web proxy has a filter in place not to allow this? I have searched for a feature web site that does automatic file renaming. That should certainly make it possible. The solution would take a URL and then change the extension so that it would look to my proxy as I was downloading a .dat file (or similar). There are perhaps other solutions to this problem.

    Read the article

  • Any way to Sync Google Bookmarks to iPhone OTA?

    - by BenA
    Does anybody know if its possible to sync Google Bookmarks over the air to my iPhone? Either natively or with an App? Googling it only seems to yield solutions involving importing my bookmarks to IE, and then syncing through iTunes. I'd like to skip both of these middlemen if thats at all possible.

    Read the article

  • How can I make vim show the current class and method I'm editing

    - by dcrosta
    Does anyone know if it's possible (or know of an existing vim script or plugin) that can create a "status bar" that shows the name of the current class and method (or function) I'm editing? I'm imagining that it would plug into the syntax parser for the filetype of the current buffer, and display a breadcrumb trail to show you what you're currently editing. I don't know vimscript well enough to suggest any more than that, but if there aren't any good solutions already, I may begin to hack on one, so suggestions as to where to start are welcome, too!

    Read the article

< Previous Page | 74 75 76 77 78 79 80 81 82 83 84 85  | Next Page >