Search Results

Search found 6715 results on 269 pages for 'preg match'.

Page 8/269 | < Previous Page | 4 5 6 7 8 9 10 11 12 13 14 15  | Next Page >

  • VIM autocompletion: Making ^X^U expand to longest match

    - by Sarah
    I'm using eclim to bring some eclipse functionality to VIM, however the code completion functions seem to work less than ideal. When I press ctrl+x ctrl+u after, for instance, System.out. with the curser right after the last dot, I get the completion popup-menu. This menu is really rather cumbersome to use, and the functionality that I would ideally want is something like: ctrl+x ctrl+u (expands to longest match) fill in more characters (expand to longest match). Is this possible somehow? I've tried fiddling with the completeopts settings, but they don't seem to do what I want.

    Read the article

  • Nginx location to match query parameters

    - by Dave
    Is it possible in nginx to have a location {} block that matches query parameters. For example I want to pick up that "preview=true" in this url and then instruct it to do several different things, all possible in a location block. http://192.158.0.1/web/test.php?hello=test&preview=true&another=var The problem I'm having is that my test stuff doesn't seem to match, it seems like I can only match the URL itself? E.g. location ~ ^(.*)(preview)(.*)$ Or something aloong those lines?

    Read the article

  • match patterns update output file uncomment when desired

    - by user2692634
    Need suggestion for following. Have two files myfile and responsefile. First file myfile.txt user=myname user_1=yourname group=mygroup group_1=yourgroup second file responsefile.txt #Please fill details user= #user_1= #user_2= #Please fill details group= #group_1= #group_2= Based on myfile.txt data update responsefile.txt as below and the file responsefile.txt is lenghty of about 604L, 16481C. Result output responsefile.txt #Please fill details user=myname user_1=yourname #user_2= #Please fill details group=mygroup group_1=yourgroup #group_2= If you observe myfile above, I want to match user= in responsefile, then update as user=myname, same applies for group=. Then match user_1= and group_1= which is hashed or commented in responsefile, update as user_1=yourname and group_1=yourgroup. Should not remove hash or uncomment for others in file. I tried this awk -F= 'NR==FNR{a[$1]=$0;next}$1 in a{$0=a[$1]}1' myfile.txt responsefile.txt Please suggest thanks in advance.

    Read the article

  • API numbers don't match on compiled PHP extension

    - by tixrus
    I'm trying to get GD into my PHP. I recently installed PHP5.3.0 on my system running Mac Leopard using mac ports. It did not come with the gd module. So I downloaded gd, compiled it as an extension module as per http://www.kenior.ch/macintosh/adding-gd-library-for-mac-os-x-leopard, made php.ini point to it, restarted apache etc. But no GD. So in apache error log it says PHP Warning: PHP Startup: gd: Unable to initialize module\nModule compiled with module API=20060613\nPHP compiled with module API=20090115\nThese options need to match\n in Unknown on line 0 So a bit of googling says I should not use the phpize I have before configuring and making these. I should use a new one called phpize5. I surely don't have any such thing. Unless its packed up inside something else in my php5.3. distro. Where do you get it. In Ubuntu I could just run sudo apt-get install php-dev, (apparently) and it would just appear by magic. At least that's what the webpage said. Unfortunately I am running MacOSX version Leopard. How can I build this GD module on Leopard so that it will match the API number in my PHP?

    Read the article

  • NFS4 permission denied when userid does not match (even though idmap is working)

    - by SystemParadox
    I have NFS4 setup with idmapd working correctly. ls -l from the client shows the correct user names, even though the user ids differ between the machines. However, when the user ids do not match, I get 'permission denied' errors trying access files, even though ls -l shows the correct username. When the user ids do happen to match by coincidence, everything works fine. sudo sysctl -w sunrpc.nfsd_debug=1023 gives the following output in the server syslog for the failed file access: nfsd_dispatch: vers 4 proc 1 nfsv4 compound op #1/3: 22 (OP_PUTFH) nfsd: fh_verify(28: 00070001 015c0001 00000000 9853d400 2a4892a5 4918a0ba) nfsv4 compound op ffff88003d0f5078 opcnt 3 #1: 22: status 0 nfsv4 compound op #2/3: 3 (OP_ACCESS) nfsd: fh_verify(28: 00070001 015c0001 00000000 9853d400 2a4892a5 4918a0ba) nfsd: fh_verify - just checking nfsv4 compound op ffff88003d0f5078 opcnt 3 #2: 3: status 0 nfsv4 compound op #3/3: 9 (OP_GETATTR) nfsd: fh_verify(28: 00070001 015c0001 00000000 9853d400 2a4892a5 4918a0ba) nfsd: fh_verify - just checking nfsv4 compound op ffff88003d0f5078 opcnt 3 #3: 9: status 0 nfsv4 compound returned 0 nfsd_dispatch: vers 4 proc 1 nfsv4 compound op #1/7: 22 (OP_PUTFH) nfsd: fh_verify(28: 00070001 015c0001 00000000 9853d400 2a4892a5 4918a0ba) nfsv4 compound op ffff88003d0f5078 opcnt 7 #1: 22: status 0 nfsv4 compound op #2/7: 32 (OP_SAVEFH) nfsv4 compound op ffff88003d0f5078 opcnt 7 #2: 32: status 0 nfsv4 compound op #3/7: 18 (OP_OPEN) NFSD: nfsd4_open filename dom_file op_stateowner (null) renewing client (clientid 4f96587d/0000000e) nfsd: nfsd_lookup(fh 28: 00070001 015c0001 00000000 9853d400 2a4892a5 4918a0ba, dom_file) nfsd: fh_verify(28: 00070001 015c0001 00000000 9853d400 2a4892a5 4918a0ba) nfsd: fh_verify - just checking nfsd: fh_lock(28: 00070001 015c0001 00000000 9853d400 2a4892a5 4918a0ba) locked = 0 nfsd: fh_compose(exp 08:01/22806529 srv/dom_file, ino=22809724) nfsd: fh_verify(36: 01070001 015c0001 00000000 9853d400 2a4892a5 4918a0ba) nfsd: fh_verify - just checking fh_verify: srv/dom_file permission failure, acc=804, error=13 nfsv4 compound op ffff88003d0f5078 opcnt 7 #3: 18: status 13 nfsv4 compound returned 13 Is that useful to anyone? Any hints on to debug this would be greatly appreciated. Server kernel: 2.6.32-40-server (Ubuntu 10.04) Client kernel: 3.2.0-27-generic (Ubuntu 12.04) Same problem with my new server running 3.2.0-27-generic (Ubuntu 12.04). Thanks.

    Read the article

  • postfix smtpd rejecting mail from outside network match_list_match: no match

    - by Loopo
    My postfix (V: 2.5.5-1.1) running on ubuntu server (9.04) started to reject mail arriving in from outside about 2 weeks ago. Doing a "manual" session via telnet shows that the connection is always closed after the MAIL FROM: [email protected] line is input, with the message "Connection closed by foreign host." Doing the same from another client inside the LAN works fine. In the log files I get the line "lost connection after MAIL from xxxxx.tld[xxx.xxx.xxx.xxx]" This is after some lines like: match_hostaddr: XXX.XXX.XXX.XXX ~? [::1]/128 match_hostname: XXXX.tld ~? 192.168.1.0/24 ... match_list_match: xxx.xxx.xxx.xxx: no match which seem to suggest some kind of filter which checks for allowed addresses. I have been unable to locate where this filter lives, or how to turn it off. I'm not even sure if that's what's causing my problem. Connections from inside the LAN don't get disconnected even though they also show a "match_list_match: ... no match" line. I didn't change any configuration files recently, below is my main.cf as it currently stands. I don't really know what all the parameters do and how they interact. I just set it up initially and it worked fine (up to recently). smtpd_banner = $myhostname ESMTP $mail_name (GNU) biff = no readme_directory = no # TLS parameters smtpd_tls_cert_file=/etc/ssl/certs/server.crt smtpd_tls_key_file=/etc/ssl/private/server.key #smtpd_use_tls=yes smtpd_tls_session_cache_database = btree:${data_directory}/smtpd_scache smtp_tls_session_cache_database = btree:${data_directory}/smtp_scache smtp_sasl_auth_enable = no smtp_use_tls=no smtp_sasl_password_maps = hash:/etc/postfix/smtp_auth myhostname = XXXXXXX.com alias_maps = hash:/etc/aliases alias_database = hash:/etc/aliases myorigin = /etc/mailname mydestination = XXXX.XXXX.com, XXXX.com, localhost.XXXXX.com, localhost relayhost = XXX.XXX.XXX.XXX mynetworks = 127.0.0.0/8 [::ffff:127.0.0.0]/104 [::1]/128 192.168.1.0/24 mailbox_command = procmail -a "$EXTENSION" mailbox_size_limit = 0 recipient_delimiter = + inet_interfaces = all smtpd_sasl_local_domain = #smtpd_sasl_auth_enable = yes smtpd_sasl_security_options = noanonymous smtpd_sasl_authenticated_header = yes broken_sasl_auth_clients = yes smtpd_recipient_restrictions = permit_mynetworks,permit_sasl_authenticated,reject_unauth_ when checking the process list, postfix/smtpd runs as smtpd -n smtp -t inet -u -c -o stress -v -v Any clues?

    Read the article

  • PTR and A record must match?

    - by somecallmemike
    RFC 1912 Section 2.1 states the following: Make sure your PTR and A records match. For every IP address, there should be a matching PTR record in the in-addr.arpa domain. If a host is multi-homed, (more than one IP address) make sure that all IP addresses have a corresponding PTR record (not just the first one). Failure to have matching PTR and A records can cause loss of Internet services similar to not being registered in the DNS at all. Also, PTR records must point back to a valid A record, not a alias defined by a CNAME. It is highly recommended that you use some software which automates this checking, or generate your DNS data from a database which automatically creates consistent data. This does not make any sense to me, should an ISP keep matching A records for every PTR record? It seems to me that it's only important if the IP address that the PTR record describes is hosting a service that is sensitive to DNS being mismatched (such as email hosting). In that case the forward zone would be configured under a domain name (examples follow the format 'zone - record'): domain.tld -> mail IN A 1.2.3.4 And the PTR record would be configured to match: 3.2.1.in-addr.arpa -> 4 IN PTR mail.domain.tld. Would there be any reason for the ISP to host a forward lookup for an IP address on their network like this?: ispdomain.tld -> broadband-ip-1 IN A 1.2.3.4

    Read the article

  • rsync --remove-source-files but only those that match a pattern

    - by Daniel
    Is this possible with rsync? Transfer everything from src:path/to/dir to dest:/path/to/other/dir and delete some of the source files in src:path/to/dir that match a pattern (or size limit) but keep all other files. I couldn't find a way to limit --remove-source-files with a regexp or size limit. Update1 (clarification): I'd like all files in src:path/to/dir to be copied to dest:/path/to/other/dir. Once this is done, I'd like to have some files (those that match a regexp or size limit) in src:path/to/dir deleted but don't want to have anything deleted in dest:/path/to/other/dir. Update2 (more clarification): Unfortunately, I can't simply rsync everything and then manually delete the files matching my regexp from src:. The files to be deleted are continuously created. So let's say there are N files of the type I'd like to delete after the transfer in src: when rsync starts. By the time rsync finishes there will be N+M such files there. If I now delete them manually, I'll lose the M files that were created while rsync was running. Hence I'd like to have a solution that guarantees that the only files deleted from src: are those known to be successfully copied over to dest:. I could fetch a file list from dest: after the rsync is complete, and compare that list of files with what I have in src:, and then do the removal manually. But I was wondering if rsync can do this by itself.

    Read the article

  • rsync --remove-source-files but only those that match a pattern

    - by user28146
    Is this possible with rsync? Transfer everything from src:path/to/dir to dest:/path/to/other/dir and delete some of the source files in src:path/to/dir that match a pattern (or size limit) but keep all other files. I couldn't find a way to limit --remove-source-files with a regexp or size limit. Update1 (clarification): I'd like all files in src:path/to/dir to be copied to dest:/path/to/other/dir. Once this is done, I'd like to have some files (those that match a regexp or size limit) in src:path/to/dir deleted but don't want to have anything deleted in dest:/path/to/other/dir. Update2 (more clarification): Unfortunately, I can't simply rsync everything and then manually delete the files matching my regexp from src:. The files to be deleted are continuously created. So let's say there are N files of the type I'd like to delete after the transfer in src: when rsync starts. By the time rsync finishes there will be N+M such files there. If I now delete them manually, I'll lose the M files that were created while rsync was running. Hence I'd like to have a solution that guarantees that the only files deleted from src: are those known to be successfully copied over to dest:. I could fetch a file list from dest: after the rsync is complete, and compare that list of files with what I have in src:, and then do the removal manually. But I was wondering if rsync can do this by itself.

    Read the article

  • Using perl's Regexp::Grammars, how do I make a capture dependent on $MATCH?

    - by Evan Carroll
    I've got a token like such: <delim2=((?{ $MATCH{delim} }))> and what I want to happen is for delim2 to capture and be set to the value of delim. When I run this, delim2 is set, but the capture is never done. I think this is an error in my reasoning: I'm trying to chain this form: <ALIAS= ( PATTERN )> Match pattern, save match in $MATCH{ALIAS} and this form: (?{ MATCH{delim} }) into something like this <ALIAS= ( (?{MATCH{delim}) )> Matches the value of $MATCH{delim} save to $MATCH{delim2} but this simply doesn't seem valid. I can verify my original token works <delim2=((?{ die $MATCH{delim} }))> will die with the value, and, if I hard code it, I get the right capture and everything works <delim2=(')>? So how do I go about achieving sane results, while having a dynamic pattern?

    Read the article

  • Bug in Delphi XE RegularExpressions Unit

    - by Jan Goyvaerts
    Using the new RegularExpressions unit in Delphi XE, you can iterate over all the matches that a regex finds in a string like this: procedure TForm1.Button1Click(Sender: TObject); var RegEx: TRegEx; Match: TMatch; begin RegEx := TRegex.Create('\w+'); Match := RegEx.Match('One two three four'); while Match.Success do begin Memo1.Lines.Add(Match.Value); Match := Match.NextMatch; end end; Or you could save yourself two lines of code by using the static TRegEx.Match call: procedure TForm1.Button2Click(Sender: TObject); var Match: TMatch; begin Match := TRegEx.Match('One two three four', '\w+'); while Match.Success do begin Memo1.Lines.Add(Match.Value); Match := Match.NextMatch; end end; Unfortunately, due to a bug in the RegularExpressions unit, the static call doesn’t work. Depending on your exact code, you may get fewer matches or blank matches than you should, or your application may crash with an access violation. The RegularExpressions unit defines TRegEx and TMatch as records. That way you don’t have to explicitly create and destroy them. Internally, TRegEx uses TPerlRegEx to do the heavy lifting. TPerlRegEx is a class that needs to be created and destroyed like any other class. If you look at the TRegEx source code, you’ll notice that it uses an interface to destroy the TPerlRegEx instance when TRegEx goes out of scope. Interfaces are reference counted in Delphi, making them usable for automatic memory management. The bug is that TMatch and TGroupCollection also need the TPerlRegEx instance to do their work. TRegEx passes its TPerlRegEx instance to TMatch and TGroupCollection, but it does not pass the instance of the interface that is responsible for destroying TPerlRegEx. This is not a problem in our first code sample. TRegEx stays in scope until we’re done with TMatch. The interface is destroyed when Button1Click exits. In the second code sample, the static TRegEx.Match call creates a local variable of type TRegEx. This local variable goes out of scope when TRegEx.Match returns. Thus the reference count on the interface reaches zero and TPerlRegEx is destroyed when TRegEx.Match returns. When we call MatchAgain the TMatch record tries to use a TPerlRegEx instance that has already been destroyed. To fix this bug, delete or rename the two RegularExpressions.dcu files and copy RegularExpressions.pas into your source code folder. Make these changes to both the TMatch and TGroupCollection records in this unit: Declare FNotifier: IInterface; in the private section. Add the parameter ANotifier: IInterface; to the Create constructor. Assign FNotifier := ANotifier; in the constructor’s implementation. You also need to add the ANotifier: IInterface; parameter to the TMatchCollection.Create constructor. Now try to compile some code that uses the RegularExpressions unit. The compiler will flag all calls to TMatch.Create, TGroupCollection.Create and TMatchCollection.Create. Fix them by adding the ANotifier or FNotifier parameter, depending on whether ARegEx or FRegEx is being passed. With these fixes, the TPerlRegEx instance won’t be destroyed until the last TRegEx, TMatch, or TGroupCollection that uses it goes out of scope or is used with a different regular expression.

    Read the article

  • Address Match Key Algorithm

    - by sestocker
    I have a list of addresses in two separate tables that are slightly off that I need to be able to match. For example, the same address can be entered in multiple ways: 110 Test St 110 Test St. 110 Test Street Although simple, you can imagine the situation in more complex scenerios. I am trying to develop a simple algorithm that will be able to match the above addresses as a key. For example. the key might be "11TEST" - first two of 110, first two of Test and first two of street variant. A full match key would also include first 5 of the zipcode as well so in the above example, the full key might look like "11TEST44680". I am looking for ideas for an effective algorithm or resources I can look at for considerations when developing this. Any ideas can be pseudo code or in your language of choice. We are only concerned with US addresses. In fact, we are only looking at addresses from 250 zip codes from Ohio and Michigan. We also do not have access to any postal software although would be open to ideas for cost effective solutions (it would essentially be a one time use). Please be mindful that this is an initial dump of data from a government source so suggestions of how users can clean it are helpful as I build out the application but I would love to have the best initial I possibly can by being able to match addresses as best as possible.

    Read the article

  • C# Regex - Match and replace, Auto Increment

    - by Marc Still
    I have been toiling with a problem and any help would be appreciated. Problem: I have a paragraph and I want to replace a variable which appears several times (Variable = @Variable). This is the easy part, but the portion which I am having difficulty is trying to replace the variable with different values. I need for each occurrence to have a different value. For instance, I have a function that does a calculation for each variable. What I have thus far is below: private string SetVariables(string input, string pattern){ Regex rx = new Regex(pattern); MatchCollection matches = rx.Matches(input); int i = 1; if(matches.Count > 0) { foreach(Match match in matches) { rx.Replace(match.ToString(), getReplacementNumber(i)); i++ } } I am able to replace each variable that I need to with the number returned from getReplacementNumber(i) function, but how to I put it back into my original input with the replaced values, in the same order found in the match collection? Thanks in advance! Marcus

    Read the article

  • Match subpatterns in any order

    - by Yaroslav
    I have long regexp with two complicated subpatters inside. How i can match that subpatterns in any order? Simplified example: /(apple)?\s?(banana)?\s?(orange)?\s?(kiwi)?/ and i want to match both of apple banana orange kiwi apple orange banana kiwi It is very simplified example. In my case banana and orange is long complicated subpatterns and i don't want to do something like /(apple)?\s?((banana)?\s?(orange)?|(orange)?\s?(banana)?)\s?(kiwi)?/ Is it possible to group subpatterns like chars in character class? UPD Real data as requested: 14:24 26,37 Mb 108.53 01:19:02 06.07 24.39 19:39 46:00 my strings much longer, but it is significant part. Here you can see two lines what i need to match. First has two values: length (14 min 24 sec) and size 26.37 Mb. Second one has three values but in different order: size 108.53 Mb, length 01 h 19 m 02 s and date June, 07 Third one has two size and length Fourth has only length There are couple more variations and i need to parse all values. I have a regexp that pretty close except i can't figure out how to match patterns in different order without writing it twice. (?<size>\d{1,3}\[.,]\d{1,2}\s+(?:Mb)?)?\s? (?<length>(?:(?:01:)?\d{1,2}:\d{2}))?\s* (?<date>\d{2}\.\d{2}))? NOTE: that is only part of big regexp that forks fine already.

    Read the article

  • MySQL "OR MATCH" hangs (very slow) on multiple tables

    - by Kerry
    After learning how to do MySQL Full-Text search, the recommended solution for multiple tables was OR MATCH and then do the other database call. You can see that in my query below. When I do this, it just gets stuck in a "busy" state, and I can't access the MySQL database. SELECT a.`product_id`, a.`name`, a.`slug`, a.`description`, b.`list_price`, b.`price`, c.`image`, c.`swatch`, e.`name` AS industry, MATCH( a.`name`, a.`sku`, a.`description` ) AGAINST ( '%s' IN BOOLEAN MODE ) AS relevance FROM `products` AS a LEFT JOIN `website_products` AS b ON (a.`product_id` = b.`product_id`) LEFT JOIN ( SELECT `product_id`, `image`, `swatch` FROM `product_images` WHERE `sequence` = 0) AS c ON (a.`product_id` = c.`product_id`) LEFT JOIN `brands` AS d ON (a.`brand_id` = d.`brand_id`) INNER JOIN `industries` AS e ON (a.`industry_id` = e.`industry_id`) WHERE b.`website_id` = %d AND b.`status` = %d AND b.`active` = %d AND MATCH( a.`name`, a.`sku`, a.`description` ) AGAINST ( '%s' IN BOOLEAN MODE ) OR MATCH ( d.`name` ) AGAINST ( '%s' IN BOOLEAN MODE ) GROUP BY a.`product_id` ORDER BY relevance DESC LIMIT 0, 9 Any help would be greatly appreciated. EDIT All the tables involved are MyISAM, utf8_general_ci. Here's the EXPLAIN SELECT statement: id select_type table type possible_keys key key_len ref rows Extra 1 PRIMARY a ALL NULL NULL NULL NULL 16076 Using temporary; Using filesort 1 PRIMARY b ref product_id product_id 4 database.a.product_id 2 1 PRIMARY e eq_ref PRIMARY PRIMARY 4 database.a.industry_id 1 1 PRIMARY <derived2> ALL NULL NULL NULL NULL 23261 1 PRIMARY d eq_ref PRIMARY PRIMARY 4 database.a.brand_id 1 Using where 2 DERIVED product_images ALL NULL NULL NULL NULL 25933 Using where I don't know how to make that look neater -- sorry about that UPDATE it returns the query after 196 seconds (I think correctly). The query without multiple tables takes about .56 seconds (which I know is really slow, we plan on changing to solr or sphinx soon), but 196 seconds?? If we could add a number to the relevance if it was in the brand name ( d.name ), that would also work

    Read the article

  • xsl:template match doesn't find matches

    - by dmo
    I'm trying to convert some Xaml to HTML using the .NET XslCompiledTransform and am running into difficulties getting the xslt to match Xaml tags. For instance with this Xaml input: <FlowDocument PagePadding="5,0,5,0" AllowDrop="True" NumberSubstitution.CultureSource="User" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation"> <Paragraph>a</Paragraph> </FlowDocument> And this xslt: <?xml version="1.0" encoding="utf-8"?> <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/XSL/Transform" xmlns:msxsl="urn:schemas-microsoft-com:xslt" exclude-result-prefixes="msxsl" > <xsl:output method="html" indent="yes"/> <xsl:template match="/"> <html> <body> <xsl:apply-templates /> </body> </html> </xsl:template> <xsl:template match="FlowDocument"> <xsl:apply-templates /> </xsl:template> <xsl:template match="Paragraph" > <p> <xsl:apply-templates /> </p> </xsl:template> I get this output: <html> <body> a </body> </html> Rather than the expected: <html> <body> <p>a</p> </body> </html> Could this be a problem with the namespace? This is my first attempt at an xsl transform, so I'm at a loss.

    Read the article

  • Match Hard Disk Partition Table?

    - by MA1
    What is the most efficient way to match the partition tables on two different hard disks? I have saved the partition tables using dd command in linux. The partition tables are from a Windows system.

    Read the article

  • Match Hard Dusk Partition Table?

    - by MA1
    Hi All What is the efficient way to match the two different hard disk partition tables? I have save the partition tables using dd command in linux. The partition tables are from Windows system. Regards,

    Read the article

  • Compare 2 sets of data in Excel and returning a value when multiple columns match

    - by Susan C
    I have a data set for employees that contains name and 3 attributes (job function, job grade and location). I then have a data set for open positions that contains the requisition number and 3 attributes (job function, job grade and job location). For every employee, i would like the three attributes associated with them compared to the same three attributes of the open positions and have the cooresponding requisition numbers displayed for each employee where there is a match.

    Read the article

  • Iptables rule creation error: No chain/target/match by that name

    - by MikO
    I'm trying to create my first VPN on a VPS with CentOS 6, following this tutorial. When I have to create an iptables rule to allow proper routing of VPN subnet, with this command: iptables -t nat -A POSTROUTING -s 10.8.0.0/24 -o eth0 -j MASQUERADE It throws this error: iptables: No chain/target/match by that name I was searching and I've found that this error is usually thrown when you misspell something, but as far as I understand, the rule is correct...

    Read the article

  • Is it possible to preg replace unique variables into a string?

    - by Scarface
    What I want to do is use preg replace to replace matches within a string with a varying replacement, and I was wondering if anyone knew if that is possible in php or at least achievable by some means. For example, a string has two matches, then those matches will be replaced with two different variables. What I want are replacements to each be a unique id and I cannot figure out how this could possibly work or if php could even do this. For example if the match is 'a' and there is a sentence, 'put a smile on a person' then one 'a' will be unique id 98aksd00 and the other will be 09alkj08. I am retrieving my comments from a database so the preg replace is happening within while ($row=mysql_fetch_assoc($query)){ //preg replace If anyone could provide any insight into this, I would really appreciate it

    Read the article

  • PHP ssh2_fingerprint() does not match ssh-keygen -lf id_rsa.pub

    - by Justin
    I am using the lib ssh2 module with PHP and calling the function ssh2_fingerprint() to get the keys fingerprint. According to all resources on the internet, I can get the fingerprint of a public key by executing: ssh-keygen -lf id_rsa.pub Which outputs something like: 2048 d4:41:3b:45:00:49:4e:fc:2c:9d:3a:f7:e6:6e:bf:e7 id_rsa.pub (RSA) However, when I call ssh2_fingerprint($connection, SSH2_FINGERPRINT_HEX) in PHP with the same public key I get: dddddba52352e5ab95711c10fdd56f43 Shouldn't they match? What am I missing?

    Read the article

  • How to match against multiple value possiblities in Excel

    - by Henno
    I have list of person names in column A. I want to display "1" in column B for names which end with either "e" or "i" or "n". If there would be only one match to test against, I would write something like: =IF( MID(A1,FIND(" ",B1)-1,1) = "e", "1", "0") In PHP I would solve that like this: echo in_array( $names[$row_number], array('e', 'i', 'n') ) ? '1' : '0'; What formula should I use in column B in Excel?

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

< Previous Page | 4 5 6 7 8 9 10 11 12 13 14 15  | Next Page >