Search Results

Search found 6501 results on 261 pages for 'audio conversion'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 80/261 | < Previous Page | 76 77 78 79 80 81 82 83 84 85 86 87  | Next Page >

  • How to embed word doc as background picture of an Access report using .EMF or equivalent ?

    - by iDevlop
    My company's standard paper has logo, address and all the details in the right margin with a vertical blue line. I have that as a word template. I want to have the same thing as the background of my Invoices report. I managed to do that 5 years ago by saving to EMF format (vector format, prints out nicely) and putting the file as the background of the report. Now my company is moving, and I need to change the address on my invoices, but I can't find out how I did to convert the word doc to EMF. Any suggestion ? By EMF or another process, but I want to avoid BMP, which is huge and does not print nicely. Thanks !

    Read the article

  • Windows 7 Line In Delay Issue [closed]

    - by CheeseConQueso
    Not sure if this question should be posted on a different stack exchange site, so if you find that it should not be posted here, please move it. Either way, if you know the solution, please advise. I'm running Windows 7 Pro 32-bit on my Dell Latitude 2100 netbook and I'm having an issue with the line in device/driver/functionality. The device & driver are stock: Driver Date: 7/13/2009 Driver Version: 6.1.7600.16385 I'm almost sure that the manufacturer of the sound card is RealTek. The problem is that there is a delay (when monitoring input) between the source and the speakers. My setup is bass guitar running through a 12' long instrument cable (1/4") with a 1/4" female to 1/8" male adapter into the line in port on the computer. Then the 15' long headphones/line out cable goes into a standard set of powered speakers. How do I get rid of this delay? Thanks for any help.

    Read the article

  • Sennheiser PC360 Microphone Suddenly Stopped Working

    - by Michaelwm
    Just recently, my Sennheiser PC360's microphone stopped working. Yesterday Night, it was working 100% fine. Muting correctly, un-muting, volume boosting, etc. I woke up this morning, and got into a skype call (After not changing a single setting on my computer), and it wasn't working. I tried mumble, and it didn't work there either. After that, I checked my sound devices and found out it was plugged in, but not responding to my voice. I unplugged the headset, and it correctly showed that it was unplugged. So, a quick run-down: Sennheiser PC360 Headset suddenly stops working after a few hours of sleep. Software is up to date I can hear the mute sound when I raise and lower the microphone arm Windows Sound Device Manager shows that it is plugged in Unplugging the headset correctly shows it is unplugged Windows Sound Device Manager shows that the microphone isn't receiving any input

    Read the article

  • Microphone doesn't work

    - by mandy
    I'm having a trouble with my built in microphone. Even if I use headphone with mic, it doesn't really work. The weird thing is, if I clap the green lines of the speaker icon jumps, but if I speak it doesn't. I have also tried some recordings, but I can not hear myself and adjusting the volume didn't help at all. I tried to restore it, still no change. I have updated it in the device manager, but it said there that it's up to date and the devices are working properly. Until I decided to recover the whole system (wherein I pressed zero and switch on button) to my surprise, the settings became different, most programs were deleted, even my files. It's like it was formatted and I'm so sad that the mic was not fixed. I really don't know what to do now. My laptop model is Toshiba satellite m840. I want to it return to its settings/set up just before I Recover the system and bring back all the programs that we're installed and of course, most of all, to fix my microphone so I can use Skype again and other video calling application.. I hope someone could help me. Thanks a lot!

    Read the article

  • PS3 through line in?

    - by h20
    Hey all. I'm looking for a way to chat through LAN (via PC) while playing PS3. Would it be possible to run my PS3's sound through my desktop's "line in" and somehow (if possible) mixing it with my normal PC sound to produce one output that I could, say, use with headphones? I'll add that I'm currently running to line in (not mic) from the line out on my monitor (Flatron W2453V), where my PS3 is hooked up via HDMI. I tried running femalex2 to male 3.5mm splitter, but it dims my PC sound when PS3 sound is available. Chat would be impossible. Currently running Linux Mint if that's of any concern, but am willing to switch to any flavour of Linux to get this working

    Read the article

  • How can I transfer metadata from several flac files to aac (m4a) files?

    - by abckookooman
    Suppose I have two folders, dir1 and dir2, with deveral files in each of them, and all the files in dir1 are named like "ExampleFileName.flac" and all the files in dir2 are named as "ExampleFileName.m4a" - basically their names are the same except the extension. What I need to do is transfer all of the metadata for each of the files somehow - even though their codecs are different. It would be great if I can do this via command line, but anything is appreciated. Thank you.

    Read the article

  • HP Pavilion dv3 volume control display driver on Windows 7

    - by Farinha
    I've recently bought an HP Pavilion dv3-2150ep and I'm having a hard time getting the volume control display to work as expected. The control is a back-lit touch-sensitive bar above the keyboard. Now the buttons to turn the volume up and down actually do it, but the lightning is not changing at all. The mute button does change color when toggled. I'm not sure if I'm missing any drivers here (I've installed all of those on the HP support page that seem to have something to do with sound and/or display) or if I have to activate this somewhere. Any ideas?

    Read the article

  • Flatten Word document

    - by user126389
    I have a document with some precise formatting, created in Word. This doc was converted to PDF for distribution. Now the original is lost, and reconverting to Word using a PDF to word add-on from Microsoft results in many text boxes in the new DOC file. How can I 'flatten' this to remove the text boxes and retain most of the formatting in order to update the contents? Recreating the original formatting would take a long time.

    Read the article

  • how to know if a video file can be played on a dvd player

    - by user23950
    Is there an application that can emulate a dvd player? I've converted a .mp4 video using allok video converter. And choose the output format to be xVid(.avi)<--that is exactly what is written on the application. I don't want to waste a blank dvd and try if it really can be played. So if you have tried this before please tell me if it works. And I have tried burning .avi files and it works because they are genuine avi files which I did not convert

    Read the article

  • How can I record system sounds (apps) in Audacity?

    - by Alex
    Or another similar program? All I want to do is record the sounds coming from say firefox, or any other app, for use as samples in music. I need to do this in both windows and linux (ubuntu 9.10). I have looked through the preferences of audacity but didn't find anything that let me select the system sound. Perhaps I overlooked it, because I was able to do this with earlier versions of audacity.

    Read the article

  • Annoying sound from microphone in headphone

    - by Paul
    I recently bought a Plantronics bluetooth headset for VOIP in Skype. But I am facing an annoying problem. The microphone is really sensitive and I could hear all the background noises and my sound though the headphone (of blutooth headset). I tried to disable the bluetooth headset in Playback devices and I could hear the amplified background noise through speakers! I checked if there is a microphone boost option enabled, but couldn't find it in the properties of the headset recording device

    Read the article

  • Truecrypt and hidden volumes

    - by user51166
    I would like to know the opinion of some users using (or not) the hidden volume encryption feature of Truecrypt. Personally until now I never used this feature: on Windows I encrypt the system drive as a standard volume, on GNU/Linux I encrypt using LUKS which is Truecrypt's equivalent to standard volume. As for data I use the standard volume approach as well. I read that this feature is nice and all, but it isn't really used by most people. Do you use it or not? Why? Do you only store inside it VERY sensible data or what else? Because technically speaking doing a hidden volume which has (almost) the same size as the outer one doesn't make sense: the outer volume will be encrypted but no data will be on it, which will appear very strange. So not only one has to plan which data store where, but has even to remember each time to mount the outer volume with hidden volume protection (otherwise there'll be a data loss when writing to it). It's a bit messy: hidden OS + outer OS + outer volume + hidden volume = 4 partitions :( Similar question about the hidden operating system (which I don't use [yet]).

    Read the article

  • Convert file from VOC to MP3

    - by Thomas
    I would like to convert a sound file (from a digital voice recorder) with the extension .voc to an .mp3 file or some other common sound files. I am on Windows 7 64 bit. I have tried the program voc2wav but it gives me an error message saying that the program isn't 64 bit. The program has to be free and able to run without installing. (The voice recorder did come with a program that I could install, but I would like to avoid that).

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • How to convert a power point pdf to a pdf that is easy to read on kindle?

    - by SpaceTrucker
    I have several power point presentations as pdfs. I would like to read them on the original kindle in landscape format. When I read the original on the kindle then a single slide won't fit on the kindles display. I thought the easiest way to convert the pdf was to repring it with a pdf printer. However I don't know the paper size to use. I already tried using Calibre as suggested by this question. However the output is not usable because of formatting issues. So what paper size should I use for the pdf printer to reprint them in landscape format or are there any other tools I could use for that task?

    Read the article

  • PowerISO for Mac can't convert .img

    - by None
    I have a bootable .img file that I want to convert to a bootable .iso file. I downloaded poweriso for Mac and used this command: poweriso convert MyOS.img -o MyOS.iso -ot iso which returned this output: PowerISO Copyright(C) 2004-2008 PowerISO Computing, Inc Type poweriso -? for help MyOS.img: The file format is invalid or unsupported. I thought PowerISO could convert .img to .iso. Was I incorrect, or did I use the wrong commands or something like that?

    Read the article

  • Time of splitting and encoding video with ffmpeg increases exponentially

    - by Rnd_d
    I'm trying to split video by subtitles and encode into .mp4(h.264/aac) using ffmpeg, but it takes so much time! First pieces of video are splited and encoded really fast, but for each iteration time increases, and so 40 min video takes all night or more. Small 3 min video takes max 10 mins. cmd for splitting and encoding: ffmpeg -i filename.avi -ss 00:00:0(time of sub start) -t 0:0:3(time of sub duration) -acodec libfaac -vcodec libx264 -bf 0 -f mp4 filename.mp4 ffmpeg version N-34849-g07c7ffc (last, i think) How I can make it faster? Are there, maybe, some magic arguments for ffmpeg or some hacks?

    Read the article

  • creating video from set of images on windows with java language [on hold]

    - by Atif
    I am stuck in making video from set of images, i am using ffmpeg tool on windows platform with java language, for single image it is converting into mp4 but for the set of images it gets failed, i have converted single % to double % with doube quotes but unsuccessful ffmpeg -r 1/5 -i "D:\novoworkspace\MGram\src\biz\novosol\mgram\main\img%%04d.jpg" -c:v libx264 -r 30 -pix_fmt yuv420p D:\novoworkspace\MGram\src\biz\novosol\mgram\main\video.mp4 Above is the exact command i tried from the command line as well from the java language with getRuntime() method. Environment is widows please suggest is it possibe under windows or I have to use some alternative Thanks Atif

    Read the article

  • Importer or converter for ClarisWorks cwk format?

    - by Justin Dearing
    I have several ClarisWorks documents (*.CWK) that I'd like to import into a more modern format like Microsoft Word or Open Office. It seems Star Office can apparently open cwk files, but the product is discontinued and cannot be downloaded any more. There has been a feature request to add a cwk importer to OpenOffice since 2002, so I doubt that OpenOffice will support cwk files any time soon. Are there any utilities that can open a cwk file besides ClarisWorks itself?

    Read the article

  • Is there a good, free way to fix broken/corrupt .wmv files?

    - by chbtn
    I've recovered some files from an hdd that weren't supposed to be deleted in the first place, but they have seeking problems/crash the players. Since they have the right size, I'm thinking it might be a problem of corrupt index/header, so I'm trying to find a way to fix them. It's easy to find examples on how to fix corrupt .avi files with mencoder, but .wmv seems trickier. Also, I realize there might not be a way to fix these files, but I figure I might as well as try. As far as players go, I've tried opening it with vlc/mplayer/windows media player. I can use anything on Windows XP/7 and Ubuntu, as long as it's free. Since the files are 200mb+ and there are quite a few, I don't think trial software would work.

    Read the article

  • Volume lowers sounds automatically

    - by user328421
    the volume from my windows 7 computer lowers automatically. Regarding the several "similar questions" that have been posted to SU.com before, they have never been properly answered. Questions for reference: Windows 7 lowering volume without my consent Windows 7 lowers applications' volume automatically My communications button has already been set to "do nothing". Yet a louder sounding program still insists on lowering down other application's volumes. I fight for the equality of all programs on my PC, help me out please :(

    Read the article

  • Convert video from .mp4 to .ogg

    - by Unknown
    I am using ffmpeg version 0.11.1 Copyright (c) 2000-2012 the FFmpeg developers . I need to convert a file .mp4, to .ogg format. I am on Mac OS X, and I have tried this so far: ffmpeg -i sample_mpeg4.mp4 -acodec vorbis -vcodec libtheora -f ogg output.ogv I am getting: Unknown encoder 'libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec --enable-libtheora output.ogv I am getting: Unknown encoder '--enable-libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec libtheora -f ogv output.ogv I am getting: [NULL @ 0x7f81bb00f800] Requested output format 'ogv' is not a suitable output format output.ogv: Invalid argument ffmpegtheora is not an option as it can not be install on the server.

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 76 77 78 79 80 81 82 83 84 85 86 87  | Next Page >