Search Results

Search found 87514 results on 3501 pages for 'open file'.

Page 845/3501 | < Previous Page | 841 842 843 844 845 846 847 848 849 850 851 852  | Next Page >

  • linux or vmware

    - by bahar
    Hi I don't know if here is the right place to ask this question or not but its vital for me to solve it. I run open suse 10.2 on a vmware and my operating system is vista. yesterday I run my vmware and another program but both couldn't run and I end both tasks to solve it but now I can open vmware without any problem and run another os but not my open suse. the error is: Cannot open the disk 'C:\Users\hamide\Documents\Virtual Machines\SUSE Linux 2\SUSE Linux 2-000003.vmdk' or one of the snapshot disks it depends on. Reason: Failed to lock the file. please help me I don't have any recent back up and It takes too long to do all my project again.:( Bests

    Read the article

  • Why does an ampersand in URL cause failure of some command in Mac OS X Terminal?

    - by congliu
    Why does an ampersand in URL cause failure of the following command? I want to open a web page by running Safari in Terminal, placing the URL as an argument. This works as expected: open -a safari "http://endic.naver.com/search.nhn?sLn=en&searchOption=all&query=good" But once the quotes being removed, it wouldn't work as expected: open -a safari http://endic.naver.com/search.nhn?sLn=en&searchOption=all&query=good Instead, it returns: [3] 5395 [4] 5396 [1] Done open -a safari http://endic.naver.com/search.nhn?sLn=en [2] Done searchOption=all Seems like ampersand in the URL was treated as "running previous command in the background", though there is no space following the ampersand in the URL.

    Read the article

  • Importer or converter for ClarisWorks cwk format?

    - by Justin Dearing
    I have several ClarisWorks documents (*.CWK) that I'd like to import into a more modern format like Microsoft Word or Open Office. It seems Star Office can apparently open cwk files, but the product is discontinued and cannot be downloaded any more. There has been a feature request to add a cwk importer to OpenOffice since 2002, so I doubt that OpenOffice will support cwk files any time soon. Are there any utilities that can open a cwk file besides ClarisWorks itself?

    Read the article

  • Convert Chinese character .wav song into .mp3 or .wma on English OS

    - by Jack
    I have bunch of Chinese .wav files on my hard disk that I'm trying to convert into .mp3 with Audacity but it appear that Audacity can not read Chinese character songs but the .wav file display correctly on my 32 bits Win7 Ultimate(English) pc. I have to rename these Chinese character songs into English file name in order to convert them. Does anyone know if there is any software (prefer open source) that will take Chinese character file name(.wav) and convert it into .mp3 without renaming the file?

    Read the article

  • Google Chrome not using local cache

    - by Steve
    Hi. I've been using Google Chrome as a substitute for Firefox not being able to handle having lots of tabs open at the same time. Unfortunately, it looks like Chrome is having the same problem. Freakin useless. I had to end Chrome as my whole system had slowed to a crawl. When I restarted it, I opted to restore the tabs that were last open. At this stage, every one of the 20+ tabs srated downloading the pages they had previously had open. My question is: why can't they open a locally stored/saved copy of the web page from cache? Does Google Chrome store pages in a cache? Also: after most of the pages had completed their downloading, I clicked on each tab to view the page. Half of them only display a white page, and I have to reload the page manually. What is causing this? Thanks for your help.

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • Send chrome tab from w7 laptop to w7 HTPC? (Like with iPad to AppleTV)

    - by Justin
    For the last couple days I've been trying to figure out how to get open tabs syncing between chrome installs on different computers to no avail. (if it's supposed to work the way I think it should, that is.) I have a laptop that I do all my web browsing on. Once in a while I'll come across some video that's worthy of the big-screen and the surround sound and want to open that tab (or media) on the HTPC. It'd be nice if I could just 'Right click Send to HTPC' and it opens up there with no further hassle. But even opening chrome on the HTPC and finding all my current tabs waiting would be fine. Alas, open tabs syncing doesn't seem to actually open tabs on other devices for me. Has anyone come up with a way to accomplish anything similar? Thanks all!

    Read the article

  • Automatic picture size adjustment

    - by CChriss
    Does anyone know of a free utility that allows you to paste into it a graphics file (any type would work for me, jpg, bmp, png, etc) and it will size the file to within a preset size boundary? For instance, if I preset it to resize files to be a maximum of 400 wide by 300 tall, and I paste in a file 500x500, it would shrink the file to fit within the 300 tall limit. Thanks.

    Read the article

  • How Do I Get To Preferences In FireFox

    - by user123
    I'm currently trying to get to preferences in FireFox in Linux Ubuntu. Because I don't have 10 reputation, I can't post an image (otherwise I would). All I see in the browser is the Address Bar, Downloads and Home. If I right-click (or left click) on any of these, I don't have further options (other than Home, but it only allows me to add items to the toolbar, none of which are Preferences/Options/Etc). I tried vising a website to see if more options would open; nothing. I tried right clicking on the main page and each toolbar item (listed) to see if there was another options like "Preferences" or "Options"; nothing. I tried entering "Preferences" in the address bar, thinking maybe it would open automatically; nothing. I tried right clicking on FireFox on the Linux Menu to see if I could open options without opening the program (and tried this even when the program was open); nothing.

    Read the article

  • Which folder lock application will meet this requirement?

    - by user1540992
    I want any third party(either commercial or Open source) folder lock application that protects file with password without hiding the files. The locked folder should be displayed to user as password protected folder, when user try to open the folder, it should ask password. When the user enters correct password it should open, otherwise it should throw an error. Is there any application with this quality? I searched a lot, but I could not find any.

    Read the article

  • Is there a way to "lock" the viewport in vim?

    - by breadjesus
    I recently started using Vim with NERDTree. The annoying thing is when I close the buffer, NERDTree expands to fill the rest of the screen, and I have to open another file and reopen NERDTree to get it back to the old layout. Is there a way to "lock" NERDTree in place? Ideally, closing a buffer would replace it with another buffer that's hidden, or open a new blank buffer if no other buffers are open. Thanks!

    Read the article

  • How can I unzip a .tar.gz in one step (using 7-Zip)?

    - by quickcel
    I am using 7-Zip on Windows XP and whenever I download a .tar.gz file it takes me two steps to completely extract the file(s). I right-click on the example.tar.gz file and choose 7-Zip -- Extract Here from the context menu. I then take the resulting example.tar file and the right-click again and choose 7-Zip -- Extract Here from the context menu. Is there a way through the context menu to do this in one step?

    Read the article

  • how to recover my xml default icon?

    - by moonway
    My XML files are showing the unknown programs icon, you can see in this picture: i cant revise its icon why? i look it up in the registry i find no error look at the following Windows Registry Editor Version 5.00 [HKEY_CLASSES_ROOT.xml] @="xmlfile" "Content Type"="text/xml" "PerceivedType"="text" [HKEY_CLASSES_ROOT.xml\PersistentHandler] @="{7E9D8D44-6926-426F-AA2B-217A819A5CCE}" Windows Registry Editor Version 5.00 [HKEY_CLASSES_ROOT\xmlfile] @="@C:\Windows\System32\msxml3r.dll,-1" "EditFlags"=hex:00,00,00,00 "FriendlyTypeName"=hex(2):40,00,25,00,53,00,79,00,73,00,74,00,65,00,6d,00,52,\ 00,6f,00,6f,00,74,00,25,00,5c,00,53,00,79,00,73,00,74,00,65,00,6d,00,33,00,\ 32,00,5c,00,6d,00,73,00,78,00,6d,00,6c,00,33,00,72,00,2e,00,64,00,6c,00,6c,\ 00,2c,00,2d,00,31,00,00,00 [HKEY_CLASSES_ROOT\xmlfile\BrowseInPlace] [HKEY_CLASSES_ROOT\xmlfile\CLSID] @="{48123BC4-99D9-11D1-A6B3-00C04FD91555}" [HKEY_CLASSES_ROOT\xmlfile\DefaultIcon] @="C:\Windows\System32\msxml3.dll,0" [HKEY_CLASSES_ROOT\xmlfile\shell] @="open" [HKEY_CLASSES_ROOT\xmlfile\shell\edit] [HKEY_CLASSES_ROOT\xmlfile\shell\edit\command] @="\"C:\Program Files\Common Files\Microsoft Shared\OFFICE11\MSOXMLED.EXE\" /verb edit \"%1\"" [HKEY_CLASSES_ROOT\xmlfile\shell\Open] [HKEY_CLASSES_ROOT\xmlfile\shell\Open\Command] @="\"C:\Program Files\Common Files\Microsoft Shared\OFFICE11\MSOXMLED.EXE\" /verb open \"%1\"" [HKEY_CLASSES_ROOT\xmlfile\shell\Open\ddeexec] @="" [HKEY_CLASSES_ROOT\xmlfile\ShellEx] [HKEY_CLASSES_ROOT\xmlfile\ShellEx\IconHandler] @="{AB968F1E-E20B-403A-9EB8-72EB0EB6797E}" can you find something wrong or you can paste your reg hehe i need default reg about xml which is with default associated exe all right!

    Read the article

  • How to use pipes for nonblocking IPC (UART emulation)

    - by codebauer
    I would like to write some test/emulation code that emulates a serial port connection. The real code looks like this: DUT <- UART - testtool.exe My plan is to use create a test application (CodeUnderTest.out) on linux that forks to launch testool.out with two (read & write) named pipes as arguments. But I cannot figure out how to make all the pipe IO non-blocking! The setup would look like this:. CodeUnderTest.out <- named pipes - testTool.out (lauched from CodeUnderTest.out) I have tried opening the pipes as following: open(wpipe,O_WRONLY|O_NONBLOCK); open(rpipe,O_RDONLY|O_NONBLOCK); But the write blocks until the reader opens the wpipe. Next I tried the following: open(wpipe,O_RDWR|O_NONBLOCK); open(rpipe,O_RDONLY|O_NONBLOCK); But then the reader of the first message never gets any data (doesn't block though) I also tried adding open and close calls around each message, but that didn't work either... Here is some test code: #include <stdio.h> #include <sys/types.h> #include <unistd.h> #include <fcntl.h> pid_t pid; char* rpipe, *wpipe,*x; FILE *rh,*wh; int rfd,wfd; void openrpipe( void ) { rfd = open(rpipe,O_RDONLY|O_NONBLOCK); rh = fdopen(rfd,"rb"); printf("%sopeningr %x\n",x,rh); } void openwpipe( void ) { //Fails when reader not already opened //wfd = open(wpipe,O_WRONLY|O_NONBLOCK); wfd = open(wpipe,O_RDWR|O_NONBLOCK); wh = fdopen(wfd,"wb"); printf("%sopeningw %x\n",x,wh); } void closerpipe( void ) { int i; i = fclose(rh); printf("%sclosingr %d\n",x,i); } void closewpipe( void ) { int i; i = fclose(wh); printf("%sclosingw %d\n",x,i); } void readpipe( char* expect, int len) { char buf[1024]; int i=0; printf("%sreading\n",x); while(i==0) { //printf("."); i = fread(buf,1,len,rh); } printf("%sread (%d) %s\n",x,i,buf); } void writepipe( char* data, int len) { int i,j; printf("%swriting\n",x); i = fwrite(data,1,len,rh); j = fflush(rh); //No help! printf("%sflush %d\n",x,j); printf("%swrite (%d) %s\n",x,i,data); } int main(int argc, char **argv) { rpipe = "readfifo"; wpipe = "writefifo"; x = ""; pid = fork(); if( pid == 0) { wpipe = "readfifo"; rpipe = "writefifo"; x = " "; openrpipe(); openwpipe(); writepipe("paul",4); readpipe("was",3); writepipe("here",4); closerpipe(); closewpipe(); exit(0); } openrpipe(); openwpipe(); readpipe("paul",4); writepipe("was",3); readpipe("here",4); closerpipe(); closewpipe(); return( -1 ); } BTW: To use the testocd above you need to pipes in the cwd: mkfifo ./readfifo mkfifo ./writefifo

    Read the article

  • Windows DD-esque implementation in Qt 5

    - by user1777667
    I'm trying to get into Qt and as a project I want to try and pull a binary image from a hard drive in Windows. This is what I have: QFile dsk("//./PhysicalDrive1"); dsk.open(QIODevice::ReadOnly); QByteArray readBytes = dsk.read(512); dsk.close(); QFile img("C:/out.bin"); img.open(QIODevice::WriteOnly); img.write(readBytes); img.close(); When I run it, it creates the file, but when I view it in a hex editor, it says: ëR.NTFS ..........ø..?.ÿ.€.......€.€.ÿç......UT..............ö.......ì§á.Íá.`....ú3ÀŽÐ¼.|ûhÀ...hf.ˈ...f.>..NTFSu.´A»ªUÍ.r..ûUªu.÷Á..u.éÝ..ƒì.h..´HŠ...‹ô..Í.ŸƒÄ.žX.rá;...uÛ£..Á.....Z3Û¹. +Èfÿ.......ŽÂÿ...èK.+Èwï¸.»Í.f#Àu-f.ûTCPAu$.ù..r..h.».hp..h..fSfSfU...h¸.fa..Í.3À¿(.¹Ø.üóªé_...f`..f¡..f.....fh....fP.Sh..h..´BŠ.....‹ôÍ.fY[ZfYfY..‚..fÿ.......ŽÂÿ...u¼..faàø.è.. û.è..ôëý´.‹ð¬<.t.´.»..Í.ëòÃ..A disk read error occurred...BOOTMGR is missing...BOOTMGR is compressed...Press Ctrl+Alt+Del to restart...Œ©¾Ö..Uª Is there a better way of doing this? I tried running it as admin, but still no dice. Any help would be much appreciated. Update: I changed the code a bit. Now if I specify a dd images as the input it writes the image perfectly, but when I try to use a disk as the input it only writes 0x00. QTextStream(stdout) << "Start\n"; QFile dsk("//./d:"); //QFile dsk("//./PhysicalDrive1"); //QFile dsk("//?/Device/Harddisk1/Partition0"); //QFile dsk("//./Volume{e988ffc3-3512-11e3-99d8-806e6f6e6963}"); //QFile dsk("//./Volume{04bbc7e2-a450-11e3-a9d9-902b34d5484f}"); //QFile dsk("C:/out_2.bin"); if (!dsk.open(QIODevice::ReadOnly)) qDebug() << "Failed to open:" << dsk.errorString(); qDebug() << "Size:" << dsk.size() << "\n"; // Blank out image file QFile img(dst); img.open(QIODevice::WriteOnly); img.write(0); img.close(); // Read and write operations while (!dsk.atEnd()) { QByteArray readBytes = dsk.readLine(); qDebug() << "Reading: " << readBytes.size() << "\n"; QFile img(dst); if (!img.open(QIODevice::Append)) qDebug() << "Failed to open:" << img.errorString(); img.write(readBytes); } QTextStream(stdout) << "End\n"; I guess the real problem I'm having is how to open a volume with QFile in Windows. I tried a few variants, but to no avail.

    Read the article

  • CodePlex Daily Summary for Tuesday, March 09, 2010

    CodePlex Daily Summary for Tuesday, March 09, 2010New Projects.NET Excel Wrapper - Read, Write, Edit & Automate Excel Files in .NET with ease: .NET Excel Wrapper encapsulates the complexity of working with multiple Excel objects giving you one central point to do all your processing. It h...Advancement Voyage: Advancement Voyage is a high quality RPG experience that provides all the advancement and voyaging that a player could hope for.ASP.Net Routing configuration: ASP.NET routing configuration enables you to configure the routes in the web.config bbinjest: bbinjestBuildUp: BuildUp is a build number increment tool for C# .net projects. It is run as a post build step in Visual Studio.Controlled Vocabulary: This project is devoted to creating tools to assist with Controlling Vocabulary in communication. The initial delivery is an Outlook 2010 Add-in w...CycleList: A replacement for the WPF ListBox Control. Displays only a single item and allows the user to change the selected item by clicking on it once. Very...Forensic Suite: A suite of security softwareFREE DNN Chat Module for 123 Flash Chat -- Embed FREE Chat Room!: 123 Flash Chat is a live chat solution and its DotNetNuke Chat Module helps to embed a live chat room into website with DotNetNuke(DNN) integrated ...HouseFly experimental controls: Experimental controls for use in HouseFly.ICatalogAll: junkMidiStylus: MidiStylus allows you to control MIDI-enabled hardware or software using your pressure-sensitive pen tablet. The program maps the X position, Y po...myTunes: Search for your favorite artistsNColony - Pluggable Socialism?: NColony will maximize the use of MEF to create flexible application architectures through a suite of plug-in solutions. If MEF is an outlet for plu...Network Monitor Decryption Expert: NmDecrypt is a Network Monitor Expert which when given a trace with encrypted frames, a security certificate, and a passkey will create a new trace...occulo: occulo is a free steganography program, meant to embed files within images with optional encrytion. Open Ant: A implementation of a Open Source Ant which is created to show what is possible in the serious game AntMe! The First implementation of that ProjectProgramming Patterns by example: Design patterns provide solutions to common software design problems. This project will contain samples, written in c# and ruby, of each design pat...project4k: Developing bulk mail system storing email informationQuail - Selenium Remote Control Made Easy: Quail makes it easy for Quality Assurance departments write automated tests against web applications. Both HTML and Silverlight applications can b...RedBulb for XNA Framework: RedBulb is a collection of utility functions and classes that make writing games with XNA a lot easier. Key features: Console,GUI (Labels, Buttons,...RegExpress: RegExpress is a WPF application that combines interactive demos of regular expressions with slide content. This was designed for a user group prese...RemoveFolder: Small utility program to remove empty foldersScrumTFS: ScrumTFSSharePoint - Open internal link in new window list definition: A simple SharePoint list definition to render SharePoint internal links with the option to open them in a new window.SqlSiteMap4MVC: SqlSiteMapProvider for ASP.Net MVC.T Sina .NET Client: t.sina.com.cn api 新浪微博APITest-Lint-Extensions: Test Lint is a free Typemock VS 2010 Extension that finds common problems in your unit tests as you type them. this project will host extensions ...ThinkGearNET: ThinkGearNET is a library for easy usage of the Neurosky Mindset headset from .NET .Wiki to Maml: This project enables you to write wiki syntax and have it converted into MAML syntax for Sandcastle documentation projects.WPF Undo/Redo Framework: This project attempts to solve the age-old programmer problem of supporting unlimited undo/redo in an application, in an easily reusable manner. Th...WPFValidators: WPF Validators Validações de campos para WPFWSP Listener: The WSP listener is a windows service application which waits for new WSC and WSP files in a specific folder. If a new WSC and WSP file are added, ...New Releases.NET Excel Wrapper - Read, Write, Edit & Automate Excel Files in .NET with ease: First Release: This is the first release which includes the main library release..NET Excel Wrapper - Read, Write, Edit & Automate Excel Files in .NET with ease: Updated Version: New Features:SetRangeValue using multidimensional array Print current worksheet Print all worksheets Format ranges background, color, alig...ArkSwitch: ArkSwitch v1.1.2: This release removes all memory reporting information, and is focused on stability.BattLineSvc: V2.1: - Fixed a bug where on system start-up, it would pop up a notification box to let you know the service started. Annoying! And fixed! - Fixed the ...BuildUp: BuildUp 1.0 Alpha 1: Use at your own risk!Not yet feature complete. Basic build incrementing and attribute overriding works. Still working on cascading build incremen...Controlled Vocabulary: 1.0.0.1: Initial Alpha Release. System Requirements Outlook 2010 .Net Framework 3.5 Installation 1. Close Outlook (Use Task Manager to ensure no running i...CycleList: CycleList: The binaries contain the .NET 3.5 DLL ONLY. Please download source for usage examples.FluentNHibernate.Search: 0.3 Beta: 0.3 Beta take the following changes : Mappings : - Field Mapping without specifying "Name" - Id Mapping without specifiying "Field" - Builtin Anal...FREE DNN Chat Module for 123 Flash Chat -- Embed FREE Chat Room!: 123 Flash Chat DNN Chat Module: With FREE DotNetNuke Chat Module of 123 Flash Chat, webmaster will be assist to add a chat room into DotNetNuke instantly and help to attract more ...GameStore League Manager: League Manager 1.0 release 3: This release includes a full installer so that you can get your league running faster and generate interest quicker.iExporter - iTunes playlist exporting: iExporter gui v2.3.1.0 - console v1.2.1.0: Paypal donate! Solved a big bug for iExporter ( Gui & Console ) When a track isn't located under the main iTunes library, iExporter would crash! ...jQuery.cssLess: jQuery.cssLess 0.3: New - Removed the dependency from XRegExp - Added comment support (both CSS style and C style) - Optimised it for speed - Added speed test TOD...jQuery.cssLess: jQuery.cssLess 0.4: NEW - @import directive - preserving of comments in the resulting CSS - code refactoring - more class oriented approach TODO - implement operation...MapWindow GIS: MapWindow 6.0 msi (March 8): Rewrote the shapefile saving code in the indexed case so that it uses the shape indices rather than trying to create features. This should allow s...MidiStylus: MidiStylus 0.5.1: MidiStylus Beta 0.5.1 This release contains basic functionality for transmitting MIDI data based on X position, Y position, and pressure value rea...MiniTwitter: 1.09.1: MiniTwitter 1.09.1 更新内容 修正 URL に & が含まれている時に短縮 URL がおかしくなるバグを修正Mosaictor: first executable: .exe file of the app in its current state. Mind you that this will likely be highly unstable due to heaps of uncaught errors.MvcContrib a Codeplex Foundation project: T4MVC: T4MVC is a T4 template that generates strongly typed helpers for ASP.NET MVC. You can download it below, and check out the documention here.N2 CMS: 2.0 beta: Major Changes ASP.NET MVC 2 templates Refreshed management UI LINQ support Performance improvements Auto image resize Upgrade Make a comp...NotesForGallery: ASP.NET AJAX Photo Gallery Control: NotesForGallery 2.0: PresentationNotesForGallery is an open source control on top of the Microsoft ASP.NET AJAX framework for easy displaying image galleries in the as...occulo: occulo 0.1 binaries: Windows binaries. Tested on Windows XP SP2.occulo: occulo 0.1 source: Initial source release.Open NFe: DANFE 1.9.5: Ajuste de layout e correção dos campos de ISS.patterns & practices Web Client Developer Guidance: Web Application Guidance -- March 8th Drop: This iteration we focused on documentation and bug fixes.PoshConsole: PoshConsole 2.0 Beta: With this release, I am refocusing PoshConsole... It will be a PowerShell 2 host, without support for PowerShell 1.0 I have used some of the new P...Quick Performance Monitor: QPerfmon 1.1: Now you can specify different updating frequencies.RedBulb for XNA Framework: Cipher Puzzle (Sample) Creators Club Package: RedBulb Sample Game: Cipher Puzzle http://bayimg.com/image/galgfaacb.jpgRedBulb for XNA Framework: RedBulbStarter (Base Code): This is the code you need to start with. Quick Start Guide: Download the latest version of RedBulb: http://redbulb.codeplex.com/releases/view/415...RoTwee: RoTwee 7.0.0.0 (Alpha): Now this version is under improvement of code structure and may be buggy. However movement of rotation is quite good in this version thanks to clea...SCSI Interface for Multimedia and Block Devices: Release 9 - Improvements and Bug Fixes: Changes I have made in this version: Fixed INQUIRY command timeout problem Lowered ISOBurn's memory usage significantly by not explicitly setting...SharePoint - Open internal link in new window list definition: Open link in new window list definition: First release, with english and italian localization supportSharePoint Outlook Connector: Version 1.2.3.2: Few bug fixing and some ui enhancementsSysI: sysi, release build: Better than ever -- now allows for escalation to adminThe Silverlight Hyper Video Player [http://slhvp.com]: Beta 1: Beta (1.1) The code is ready for intensive testing. I will update the code at least every second day until we are ready to freeze for V1, which wi...Truecrafting: Truecrafting 0.52: fixed several trinkets that broke just before i released 0.51, sorry fixed water elemental not doing anything while summoned if not using glyph o...Truecrafting: Truecrafting 0.53: fixed mp5 calculations when gear contained mp5 and made the formulas more efficient no need to rebuild profiles with this release if placed in th...umbracoSamplePackageCreator (beta): Working Beta: For Visual Studio 2008 creating packages for Umbraco 4.0.3.VCC: Latest build, v2.1.30307.0: Automatic drop of latest buildVCC: Latest build, v2.1.30308.0: Automatic drop of latest buildVOB2MKV: vob2mkv-1.0.3: This is a maintenance update of the VOB2MKV utility. The MKVMUX filter now describes the cluster locations using a separate SeekHead element at th...WPFValidators: WPFValidators 1.0 Beta: Primeira versão do componente ainda em Beta, pode ser utilizada em produção pois esta funcionando bem e as futuras alterações não sofreram muito im...WSDLGenerator: WSDLGenerator 0.0.06: - Added option to generate SharePoint compatible *disco.aspx file. - Changed commandline optionsWSP Listener: WSP Listener version 1.0.0.0: First version of the WSP Listener includes: Easy cop[y paste installation of WSP solutions Extended logging E-mail when installation is finish...Yet another pali text reader: Pali Text Reader App v1.1: new features/updates + search history is now a tab + format codes in dictionary + add/edit terms in the dictionary + pali keyboard inserts symbols...Most Popular ProjectsMetaSharpi4o - Indexed LINQResExBraintree Client LibraryGeek's LibrarySharepoint Feature ManagerConfiguration ManagementOragon Architecture SqlBuilderTerrain Independant Navigating Automaton v2.0WBFS ManagerMost Active ProjectsUmbraco CMSRawrSDS: Scientific DataSet library and toolsBlogEngine.NETjQuery Library for SharePoint Web ServicesFasterflect - A Fast and Simple Reflection APIFarseer Physics Enginepatterns & practices – Enterprise LibraryTeam FTW - Software ProjectIonics Isapi Rewrite Filter

    Read the article

  • Visual Studio 2010 Hosting :: Connect to MySQL Database from Visual Studio VS2010

    - by mbridge
    So, in order to connect to a MySql database from VS2010 you need to 1. download the latest version of the MySql Connector/NET from http://www.mysql.com/downloads/connector/net/ 2. install the connector (if you have an older version you need to remove it from Control Panel -> Add / Remove Programs) 3. open Visual Studio 2010 4. open Server Explorer Window (View -> Server Explorer) 5. use Connect to Database button 6. in the Choose Data Source windows select MySql Database and press Continue 7. in the Add Connection window - set server name: 127.0.0.1 or localhost for MySql server running on local machine or an IP address for a remote server - username and password - if the the above data is correct and the connection can be made, you have the possibility to select the database If you want to connect to a MySql database from a C# application (Windows or Web) you can use the next sequence: //define the connection reference and initialize it MySql.Data.MySqlClient.MySqlConnection msqlConnection = null; msqlConnection = new MySql.Data.MySqlClient.MySqlConnection(“server=localhost;user id=UserName;Password=UserPassword;database=DatabaseName;persist security info=False”);     //define the command reference MySql.Data.MySqlClient.MySqlCommand msqlCommand = new MySql.Data.MySqlClient.MySqlCommand();     //define the connection used by the command object msqlCommand.Connection = this.msqlConnection;     //define the command text msqlCommand.CommandText = "SELECT * FROM TestTable;"; try {     //open the connection     this.msqlConnection.Open();     //use a DataReader to process each record     MySql.Data.MySqlClient.MySqlDataReader msqlReader = msqlCommand.ExecuteReader();     while (msqlReader.Read())     {         //do something with each record     } } catch (Exception er) {     //do something with the exception } finally {     //always close the connection     this.msqlConnection.Close(); }.

    Read the article

  • Retrieve the content of Microsoft Word document using OpenXml and C#

    - by ybbest
    One of the tasks involves me to retrieve the contents of Microsoft Word document (word2007 above). I try to search for some resources online with not much luck; most of the examples are for writing contents to word document using OpenXml. I decide to blog this as my reference and hopefully people who read this post will find it useful as well. To retrieve the contents of Microsoft Word document using XML is extremely simple. 1. Firstly, you need to download and install the Open XML SDK 2.0 for Microsoft Office. (Download link) 2. Create a Console application then add the DocumentFormat.OpenXml.dll and WindowsBase.dll to the project, you can find these dlls in the .NET tab of the Add Reference window. 3. Write the following code to grab the contents from the word document and display it on the console window. You can download the complete source code here. References: Getting Started with the Open XML SDK 2.0 for Microsoft Office Walkthrough: Word 2007 XML Format Word Processing How To Open XML SDK 2.0 for Microsoft Office Office Developer Center openxmldeveloper Open XML Package Explorer

    Read the article

  • F# and ArcObjects, Part 2

    - by Marko Apfel
    After accessing one feature now iterating through all features of a feature class: open System;; #I "C:\Program Files\ArcGIS\DotNet";; #r "ESRI.ArcGIS.System.dll";; #r "ESRI.ArcGIS.DataSourcesGDB.dll";; #r "ESRI.ArcGIS.Geodatabase.dll";; open ESRI.ArcGIS.esriSystem;; open ESRI.ArcGIS.DataSourcesGDB;; open ESRI.ArcGIS.Geodatabase;; let aoInitialize = new AoInitializeClass();; let status = aoInitialize.Initialize(esriLicenseProductCode.esriLicenseProductCodeArcEditor);; let workspacefactory = new SdeWorkspaceFactoryClass();; let connection = "SERVER=okul;DATABASE=p;VERSION=sde.default;INSTANCE=sde:sqlserver:okul;USER=s;PASSWORD=g";; let workspace = workspacefactory.OpenFromString(connection, 0);; let featureWorkspace = (box workspace) :?> IFeatureWorkspace;; let featureClass = featureWorkspace.OpenFeatureClass("Praxair.SFG.BP_L_ROHR");; let queryFilter = new QueryFilterClass();; let featureCursor = featureClass.Search(queryFilter, true);; let featureCursorSeq (featureCursor : IFeatureCursor) = let actualFeature = ref (featureCursor.NextFeature()) seq { while (!actualFeature) <> null do yield actualFeature do actualFeature := featureCursor.NextFeature() };; featureCursorSeq featureCursor |> Seq.iter (fun feature -> Console.WriteLine ((!feature).OID));;

    Read the article

  • Connecting to SQL database using SQLCMD

    - by kaleidoscope
    As we all know, there are a number of ways you can connect to your SQL Azure Database. One of the quick options is to try to connect to SQL server is SQLCMD. To start the SQLCMD utility and connect to a named instance of SQL Server Open a Command Prompt window, and type sqlcmd -S myServer\instanceName. Replace myServer\instanceName with the name of the computer and the instance of SQL Server that you want to connect to. Press ENTER. The sqlcmd prompt (1>) indicates that you are connected to the specified instance of SQL Server. SQL Management Studio offers the facility to use SQLCMD from within SQL scripts by using SQLCMD Mode. How to: Enable SQLCMD mode in the Transact-SQL Editor (About how to start the editor, see How to: Start the Transact-SQL Editor.) To toggle SQLCMD mode from the Data menu 1. Open the query in the Transact-SQL editor. 2. On the Data menu, point to Transact-SQL Editor, and click SQLCMD Mode. To toggle SQLCMD mode from the toolbar 1. Open the query in the Transact-SQL editor. 2. On the Transact-SQL Editor toolbar, click SQLCMD Mode. To toggle SQLCMD mode from the shortcut menu 1. Open the query in the Transact-SQL editor. 2. Right-click anywhere in the editor window, and then click SQLCMD Mode. For more information follow below link http://msdn.microsoft.com/en-us/library/ms170207.aspx   Geeta, G

    Read the article

  • 256 Windows Azure Worker Roles, Windows Kinect and a 90's Text-Based Ray-Tracer

    - by Alan Smith
    For a couple of years I have been demoing a simple render farm hosted in Windows Azure using worker roles and the Azure Storage service. At the start of the presentation I deploy an Azure application that uses 16 worker roles to render a 1,500 frame 3D ray-traced animation. At the end of the presentation, when the animation was complete, I would play the animation delete the Azure deployment. The standing joke with the audience was that it was that it was a “$2 demo”, as the compute charges for running the 16 instances for an hour was $1.92, factor in the bandwidth charges and it’s a couple of dollars. The point of the demo is that it highlights one of the great benefits of cloud computing, you pay for what you use, and if you need massive compute power for a short period of time using Windows Azure can work out very cost effective. The “$2 demo” was great for presenting at user groups and conferences in that it could be deployed to Azure, used to render an animation, and then removed in a one hour session. I have always had the idea of doing something a bit more impressive with the demo, and scaling it from a “$2 demo” to a “$30 demo”. The challenge was to create a visually appealing animation in high definition format and keep the demo time down to one hour.  This article will take a run through how I achieved this. Ray Tracing Ray tracing, a technique for generating high quality photorealistic images, gained popularity in the 90’s with companies like Pixar creating feature length computer animations, and also the emergence of shareware text-based ray tracers that could run on a home PC. In order to render a ray traced image, the ray of light that would pass from the view point must be tracked until it intersects with an object. At the intersection, the color, reflectiveness, transparency, and refractive index of the object are used to calculate if the ray will be reflected or refracted. Each pixel may require thousands of calculations to determine what color it will be in the rendered image. Pin-Board Toys Having very little artistic talent and a basic understanding of maths I decided to focus on an animation that could be modeled fairly easily and would look visually impressive. I’ve always liked the pin-board desktop toys that become popular in the 80’s and when I was working as a 3D animator back in the 90’s I always had the idea of creating a 3D ray-traced animation of a pin-board, but never found the energy to do it. Even if I had a go at it, the render time to produce an animation that would look respectable on a 486 would have been measured in months. PolyRay Back in 1995 I landed my first real job, after spending three years being a beach-ski-climbing-paragliding-bum, and was employed to create 3D ray-traced animations for a CD-ROM that school kids would use to learn physics. I had got into the strange and wonderful world of text-based ray tracing, and was using a shareware ray-tracer called PolyRay. PolyRay takes a text file describing a scene as input and, after a few hours processing on a 486, produced a high quality ray-traced image. The following is an example of a basic PolyRay scene file. background Midnight_Blue   static define matte surface { ambient 0.1 diffuse 0.7 } define matte_white texture { matte { color white } } define matte_black texture { matte { color dark_slate_gray } } define position_cylindrical 3 define lookup_sawtooth 1 define light_wood <0.6, 0.24, 0.1> define median_wood <0.3, 0.12, 0.03> define dark_wood <0.05, 0.01, 0.005>     define wooden texture { noise surface { ambient 0.2  diffuse 0.7  specular white, 0.5 microfacet Reitz 10 position_fn position_cylindrical position_scale 1  lookup_fn lookup_sawtooth octaves 1 turbulence 1 color_map( [0.0, 0.2, light_wood, light_wood] [0.2, 0.3, light_wood, median_wood] [0.3, 0.4, median_wood, light_wood] [0.4, 0.7, light_wood, light_wood] [0.7, 0.8, light_wood, median_wood] [0.8, 0.9, median_wood, light_wood] [0.9, 1.0, light_wood, dark_wood]) } } define glass texture { surface { ambient 0 diffuse 0 specular 0.2 reflection white, 0.1 transmission white, 1, 1.5 }} define shiny surface { ambient 0.1 diffuse 0.6 specular white, 0.6 microfacet Phong 7  } define steely_blue texture { shiny { color black } } define chrome texture { surface { color white ambient 0.0 diffuse 0.2 specular 0.4 microfacet Phong 10 reflection 0.8 } }   viewpoint {     from <4.000, -1.000, 1.000> at <0.000, 0.000, 0.000> up <0, 1, 0> angle 60     resolution 640, 480 aspect 1.6 image_format 0 }       light <-10, 30, 20> light <-10, 30, -20>   object { disc <0, -2, 0>, <0, 1, 0>, 30 wooden }   object { sphere <0.000, 0.000, 0.000>, 1.00 chrome } object { cylinder <0.000, 0.000, 0.000>, <0.000, 0.000, -4.000>, 0.50 chrome }   After setting up the background and defining colors and textures, the viewpoint is specified. The “camera” is located at a point in 3D space, and it looks towards another point. The angle, image resolution, and aspect ratio are specified. Two lights are present in the image at defined coordinates. The three objects in the image are a wooden disc to represent a table top, and a sphere and cylinder that intersect to form a pin that will be used for the pin board toy in the final animation. When the image is rendered, the following image is produced. The pins are modeled with a chrome surface, so they reflect the environment around them. Note that the scale of the pin shaft is not correct, this will be fixed later. Modeling the Pin Board The frame of the pin-board is made up of three boxes, and six cylinders, the front box is modeled using a clear, slightly reflective solid, with the same refractive index of glass. The other shapes are modeled as metal. object { box <-5.5, -1.5, 1>, <5.5, 5.5, 1.2> glass } object { box <-5.5, -1.5, -0.04>, <5.5, 5.5, -0.09> steely_blue } object { box <-5.5, -1.5, -0.52>, <5.5, 5.5, -0.59> steely_blue } object { cylinder <-5.2, -1.2, 1.4>, <-5.2, -1.2, -0.74>, 0.2 steely_blue } object { cylinder <5.2, -1.2, 1.4>, <5.2, -1.2, -0.74>, 0.2 steely_blue } object { cylinder <-5.2, 5.2, 1.4>, <-5.2, 5.2, -0.74>, 0.2 steely_blue } object { cylinder <5.2, 5.2, 1.4>, <5.2, 5.2, -0.74>, 0.2 steely_blue } object { cylinder <0, -1.2, 1.4>, <0, -1.2, -0.74>, 0.2 steely_blue } object { cylinder <0, 5.2, 1.4>, <0, 5.2, -0.74>, 0.2 steely_blue }   In order to create the matrix of pins that make up the pin board I used a basic console application with a few nested loops to create two intersecting matrixes of pins, which models the layout used in the pin boards. The resulting image is shown below. The pin board contains 11,481 pins, with the scene file containing 23,709 lines of code. For the complete animation 2,000 scene files will be created, which is over 47 million lines of code. Each pin in the pin-board will slide out a specific distance when an object is pressed into the back of the board. This is easily modeled by setting the Z coordinate of the pin to a specific value. In order to set all of the pins in the pin-board to the correct position, a bitmap image can be used. The position of the pin can be set based on the color of the pixel at the appropriate position in the image. When the Windows Azure logo is used to set the Z coordinate of the pins, the following image is generated. The challenge now was to make a cool animation. The Azure Logo is fine, but it is static. Using a normal video to animate the pins would not work; the colors in the video would not be the same as the depth of the objects from the camera. In order to simulate the pin board accurately a series of frames from a depth camera could be used. Windows Kinect The Kenect controllers for the X-Box 360 and Windows feature a depth camera. The Kinect SDK for Windows provides a programming interface for Kenect, providing easy access for .NET developers to the Kinect sensors. The Kinect Explorer provided with the Kinect SDK is a great starting point for exploring Kinect from a developers perspective. Both the X-Box 360 Kinect and the Windows Kinect will work with the Kinect SDK, the Windows Kinect is required for commercial applications, but the X-Box Kinect can be used for hobby projects. The Windows Kinect has the advantage of providing a mode to allow depth capture with objects closer to the camera, which makes for a more accurate depth image for setting the pin positions. Creating a Depth Field Animation The depth field animation used to set the positions of the pin in the pin board was created using a modified version of the Kinect Explorer sample application. In order to simulate the pin board accurately, a small section of the depth range from the depth sensor will be used. Any part of the object in front of the depth range will result in a white pixel; anything behind the depth range will be black. Within the depth range the pixels in the image will be set to RGB values from 0,0,0 to 255,255,255. A screen shot of the modified Kinect Explorer application is shown below. The Kinect Explorer sample application was modified to include slider controls that are used to set the depth range that forms the image from the depth stream. This allows the fine tuning of the depth image that is required for simulating the position of the pins in the pin board. The Kinect Explorer was also modified to record a series of images from the depth camera and save them as a sequence JPEG files that will be used to animate the pins in the animation the Start and Stop buttons are used to start and stop the image recording. En example of one of the depth images is shown below. Once a series of 2,000 depth images has been captured, the task of creating the animation can begin. Rendering a Test Frame In order to test the creation of frames and get an approximation of the time required to render each frame a test frame was rendered on-premise using PolyRay. The output of the rendering process is shown below. The test frame contained 23,629 primitive shapes, most of which are the spheres and cylinders that are used for the 11,800 or so pins in the pin board. The 1280x720 image contains 921,600 pixels, but as anti-aliasing was used the number of rays that were calculated was 4,235,777, with 3,478,754,073 object boundaries checked. The test frame of the pin board with the depth field image applied is shown below. The tracing time for the test frame was 4 minutes 27 seconds, which means rendering the2,000 frames in the animation would take over 148 hours, or a little over 6 days. Although this is much faster that an old 486, waiting almost a week to see the results of an animation would make it challenging for animators to create, view, and refine their animations. It would be much better if the animation could be rendered in less than one hour. Windows Azure Worker Roles The cost of creating an on-premise render farm to render animations increases in proportion to the number of servers. The table below shows the cost of servers for creating a render farm, assuming a cost of $500 per server. Number of Servers Cost 1 $500 16 $8,000 256 $128,000   As well as the cost of the servers, there would be additional costs for networking, racks etc. Hosting an environment of 256 servers on-premise would require a server room with cooling, and some pretty hefty power cabling. The Windows Azure compute services provide worker roles, which are ideal for performing processor intensive compute tasks. With the scalability available in Windows Azure a job that takes 256 hours to complete could be perfumed using different numbers of worker roles. The time and cost of using 1, 16 or 256 worker roles is shown below. Number of Worker Roles Render Time Cost 1 256 hours $30.72 16 16 hours $30.72 256 1 hour $30.72   Using worker roles in Windows Azure provides the same cost for the 256 hour job, irrespective of the number of worker roles used. Provided the compute task can be broken down into many small units, and the worker role compute power can be used effectively, it makes sense to scale the application so that the task is completed quickly, making the results available in a timely fashion. The task of rendering 2,000 frames in an animation is one that can easily be broken down into 2,000 individual pieces, which can be performed by a number of worker roles. Creating a Render Farm in Windows Azure The architecture of the render farm is shown in the following diagram. The render farm is a hybrid application with the following components: ·         On-Premise o   Windows Kinect – Used combined with the Kinect Explorer to create a stream of depth images. o   Animation Creator – This application uses the depth images from the Kinect sensor to create scene description files for PolyRay. These files are then uploaded to the jobs blob container, and job messages added to the jobs queue. o   Process Monitor – This application queries the role instance lifecycle table and displays statistics about the render farm environment and render process. o   Image Downloader – This application polls the image queue and downloads the rendered animation files once they are complete. ·         Windows Azure o   Azure Storage – Queues and blobs are used for the scene description files and completed frames. A table is used to store the statistics about the rendering environment.   The architecture of each worker role is shown below.   The worker role is configured to use local storage, which provides file storage on the worker role instance that can be use by the applications to render the image and transform the format of the image. The service definition for the worker role with the local storage configuration highlighted is shown below. <?xml version="1.0" encoding="utf-8"?> <ServiceDefinition name="CloudRay" >   <WorkerRole name="CloudRayWorkerRole" vmsize="Small">     <Imports>     </Imports>     <ConfigurationSettings>       <Setting name="DataConnectionString" />     </ConfigurationSettings>     <LocalResources>       <LocalStorage name="RayFolder" cleanOnRoleRecycle="true" />     </LocalResources>   </WorkerRole> </ServiceDefinition>     The two executable programs, PolyRay.exe and DTA.exe are included in the Azure project, with Copy Always set as the property. PolyRay will take the scene description file and render it to a Truevision TGA file. As the TGA format has not seen much use since the mid 90’s it is converted to a JPG image using Dave's Targa Animator, another shareware application from the 90’s. Each worker roll will use the following process to render the animation frames. 1.       The worker process polls the job queue, if a job is available the scene description file is downloaded from blob storage to local storage. 2.       PolyRay.exe is started in a process with the appropriate command line arguments to render the image as a TGA file. 3.       DTA.exe is started in a process with the appropriate command line arguments convert the TGA file to a JPG file. 4.       The JPG file is uploaded from local storage to the images blob container. 5.       A message is placed on the images queue to indicate a new image is available for download. 6.       The job message is deleted from the job queue. 7.       The role instance lifecycle table is updated with statistics on the number of frames rendered by the worker role instance, and the CPU time used. The code for this is shown below. public override void Run() {     // Set environment variables     string polyRayPath = Path.Combine(Environment.GetEnvironmentVariable("RoleRoot"), PolyRayLocation);     string dtaPath = Path.Combine(Environment.GetEnvironmentVariable("RoleRoot"), DTALocation);       LocalResource rayStorage = RoleEnvironment.GetLocalResource("RayFolder");     string localStorageRootPath = rayStorage.RootPath;       JobQueue jobQueue = new JobQueue("renderjobs");     JobQueue downloadQueue = new JobQueue("renderimagedownloadjobs");     CloudRayBlob sceneBlob = new CloudRayBlob("scenes");     CloudRayBlob imageBlob = new CloudRayBlob("images");     RoleLifecycleDataSource roleLifecycleDataSource = new RoleLifecycleDataSource();       Frames = 0;       while (true)     {         // Get the render job from the queue         CloudQueueMessage jobMsg = jobQueue.Get();           if (jobMsg != null)         {             // Get the file details             string sceneFile = jobMsg.AsString;             string tgaFile = sceneFile.Replace(".pi", ".tga");             string jpgFile = sceneFile.Replace(".pi", ".jpg");               string sceneFilePath = Path.Combine(localStorageRootPath, sceneFile);             string tgaFilePath = Path.Combine(localStorageRootPath, tgaFile);             string jpgFilePath = Path.Combine(localStorageRootPath, jpgFile);               // Copy the scene file to local storage             sceneBlob.DownloadFile(sceneFilePath);               // Run the ray tracer.             string polyrayArguments =                 string.Format("\"{0}\" -o \"{1}\" -a 2", sceneFilePath, tgaFilePath);             Process polyRayProcess = new Process();             polyRayProcess.StartInfo.FileName =                 Path.Combine(Environment.GetEnvironmentVariable("RoleRoot"), polyRayPath);             polyRayProcess.StartInfo.Arguments = polyrayArguments;             polyRayProcess.Start();             polyRayProcess.WaitForExit();               // Convert the image             string dtaArguments =                 string.Format(" {0} /FJ /P{1}", tgaFilePath, Path.GetDirectoryName (jpgFilePath));             Process dtaProcess = new Process();             dtaProcess.StartInfo.FileName =                 Path.Combine(Environment.GetEnvironmentVariable("RoleRoot"), dtaPath);             dtaProcess.StartInfo.Arguments = dtaArguments;             dtaProcess.Start();             dtaProcess.WaitForExit();               // Upload the image to blob storage             imageBlob.UploadFile(jpgFilePath);               // Add a download job.             downloadQueue.Add(jpgFile);               // Delete the render job message             jobQueue.Delete(jobMsg);               Frames++;         }         else         {             Thread.Sleep(1000);         }           // Log the worker role activity.         roleLifecycleDataSource.Alive             ("CloudRayWorker", RoleLifecycleDataSource.RoleLifecycleId, Frames);     } }     Monitoring Worker Role Instance Lifecycle In order to get more accurate statistics about the lifecycle of the worker role instances used to render the animation data was tracked in an Azure storage table. The following class was used to track the worker role lifecycles in Azure storage.   public class RoleLifecycle : TableServiceEntity {     public string ServerName { get; set; }     public string Status { get; set; }     public DateTime StartTime { get; set; }     public DateTime EndTime { get; set; }     public long SecondsRunning { get; set; }     public DateTime LastActiveTime { get; set; }     public int Frames { get; set; }     public string Comment { get; set; }       public RoleLifecycle()     {     }       public RoleLifecycle(string roleName)     {         PartitionKey = roleName;         RowKey = Utils.GetAscendingRowKey();         Status = "Started";         StartTime = DateTime.UtcNow;         LastActiveTime = StartTime;         EndTime = StartTime;         SecondsRunning = 0;         Frames = 0;     } }     A new instance of this class is created and added to the storage table when the role starts. It is then updated each time the worker renders a frame to record the total number of frames rendered and the total processing time. These statistics are used be the monitoring application to determine the effectiveness of use of resources in the render farm. Rendering the Animation The Azure solution was deployed to Windows Azure with the service configuration set to 16 worker role instances. This allows for the application to be tested in the cloud environment, and the performance of the application determined. When I demo the application at conferences and user groups I often start with 16 instances, and then scale up the application to the full 256 instances. The configuration to run 16 instances is shown below. <?xml version="1.0" encoding="utf-8"?> <ServiceConfiguration serviceName="CloudRay" xmlns="http://schemas.microsoft.com/ServiceHosting/2008/10/ServiceConfiguration" osFamily="1" osVersion="*">   <Role name="CloudRayWorkerRole">     <Instances count="16" />     <ConfigurationSettings>       <Setting name="DataConnectionString"         value="DefaultEndpointsProtocol=https;AccountName=cloudraydata;AccountKey=..." />     </ConfigurationSettings>   </Role> </ServiceConfiguration>     About six minutes after deploying the application the first worker roles become active and start to render the first frames of the animation. The CloudRay Monitor application displays an icon for each worker role instance, with a number indicating the number of frames that the worker role has rendered. The statistics on the left show the number of active worker roles and statistics about the render process. The render time is the time since the first worker role became active; the CPU time is the total amount of processing time used by all worker role instances to render the frames.   Five minutes after the first worker role became active the last of the 16 worker roles activated. By this time the first seven worker roles had each rendered one frame of the animation.   With 16 worker roles u and running it can be seen that one hour and 45 minutes CPU time has been used to render 32 frames with a render time of just under 10 minutes.     At this rate it would take over 10 hours to render the 2,000 frames of the full animation. In order to complete the animation in under an hour more processing power will be required. Scaling the render farm from 16 instances to 256 instances is easy using the new management portal. The slider is set to 256 instances, and the configuration saved. We do not need to re-deploy the application, and the 16 instances that are up and running will not be affected. Alternatively, the configuration file for the Azure service could be modified to specify 256 instances.   <?xml version="1.0" encoding="utf-8"?> <ServiceConfiguration serviceName="CloudRay" xmlns="http://schemas.microsoft.com/ServiceHosting/2008/10/ServiceConfiguration" osFamily="1" osVersion="*">   <Role name="CloudRayWorkerRole">     <Instances count="256" />     <ConfigurationSettings>       <Setting name="DataConnectionString"         value="DefaultEndpointsProtocol=https;AccountName=cloudraydata;AccountKey=..." />     </ConfigurationSettings>   </Role> </ServiceConfiguration>     Six minutes after the new configuration has been applied 75 new worker roles have activated and are processing their first frames.   Five minutes later the full configuration of 256 worker roles is up and running. We can see that the average rate of frame rendering has increased from 3 to 12 frames per minute, and that over 17 hours of CPU time has been utilized in 23 minutes. In this test the time to provision 140 worker roles was about 11 minutes, which works out at about one every five seconds.   We are now half way through the rendering, with 1,000 frames complete. This has utilized just under three days of CPU time in a little over 35 minutes.   The animation is now complete, with 2,000 frames rendered in a little over 52 minutes. The CPU time used by the 256 worker roles is 6 days, 7 hours and 22 minutes with an average frame rate of 38 frames per minute. The rendering of the last 1,000 frames took 16 minutes 27 seconds, which works out at a rendering rate of 60 frames per minute. The frame counts in the server instances indicate that the use of a queue to distribute the workload has been very effective in distributing the load across the 256 worker role instances. The first 16 instances that were deployed first have rendered between 11 and 13 frames each, whilst the 240 instances that were added when the application was scaled have rendered between 6 and 9 frames each.   Completed Animation I’ve uploaded the completed animation to YouTube, a low resolution preview is shown below. Pin Board Animation Created using Windows Kinect and 256 Windows Azure Worker Roles   The animation can be viewed in 1280x720 resolution at the following link: http://www.youtube.com/watch?v=n5jy6bvSxWc Effective Use of Resources According to the CloudRay monitor statistics the animation took 6 days, 7 hours and 22 minutes CPU to render, this works out at 152 hours of compute time, rounded up to the nearest hour. As the usage for the worker role instances are billed for the full hour, it may have been possible to render the animation using fewer than 256 worker roles. When deciding the optimal usage of resources, the time required to provision and start the worker roles must also be considered. In the demo I started with 16 worker roles, and then scaled the application to 256 worker roles. It would have been more optimal to start the application with maybe 200 worker roles, and utilized the full hour that I was being billed for. This would, however, have prevented showing the ease of scalability of the application. The new management portal displays the CPU usage across the worker roles in the deployment. The average CPU usage across all instances is 93.27%, with over 99% used when all the instances are up and running. This shows that the worker role resources are being used very effectively. Grid Computing Scenarios Although I am using this scenario for a hobby project, there are many scenarios where a large amount of compute power is required for a short period of time. Windows Azure provides a great platform for developing these types of grid computing applications, and can work out very cost effective. ·         Windows Azure can provide massive compute power, on demand, in a matter of minutes. ·         The use of queues to manage the load balancing of jobs between role instances is a simple and effective solution. ·         Using a cloud-computing platform like Windows Azure allows proof-of-concept scenarios to be tested and evaluated on a very low budget. ·         No charges for inbound data transfer makes the uploading of large data sets to Windows Azure Storage services cost effective. (Transaction charges still apply.) Tips for using Windows Azure for Grid Computing Scenarios I found the implementation of a render farm using Windows Azure a fairly simple scenario to implement. I was impressed by ease of scalability that Azure provides, and by the short time that the application took to scale from 16 to 256 worker role instances. In this case it was around 13 minutes, in other tests it took between 10 and 20 minutes. The following tips may be useful when implementing a grid computing project in Windows Azure. ·         Using an Azure Storage queue to load-balance the units of work across multiple worker roles is simple and very effective. The design I have used in this scenario could easily scale to many thousands of worker role instances. ·         Windows Azure accounts are typically limited to 20 cores. If you need to use more than this, a call to support and a credit card check will be required. ·         Be aware of how the billing model works. You will be charged for worker role instances for the full clock our in which the instance is deployed. Schedule the workload to start just after the clock hour has started. ·         Monitor the utilization of the resources you are provisioning, ensure that you are not paying for worker roles that are idle. ·         If you are deploying third party applications to worker roles, you may well run into licensing issues. Purchasing software licenses on a per-processor basis when using hundreds of processors for a short time period would not be cost effective. ·         Third party software may also require installation onto the worker roles, which can be accomplished using start-up tasks. Bear in mind that adding a startup task and possible re-boot will add to the time required for the worker role instance to start and activate. An alternative may be to use a prepared VM and use VM roles. ·         Consider using the Windows Azure Autoscaling Application Block (WASABi) to autoscale the worker roles in your application. When using a large number of worker roles, the utilization must be carefully monitored, if the scaling algorithms are not optimal it could get very expensive!

    Read the article

  • Use a Free Utility to Create Multiple Virtual Desktops in Windows

    - by Lori Kaufman
    If you’ve used Linux, you’re probably familiar with the virtual desktop feature. It provides a convenient way to organize programs and folders open on your desktop. You can switch among multiple desktops and have different programs and folders open on each one. However, virtual desktops is a feature missing in Windows. There are many third-party options for adding virtual desktops to Windows, including one called Dexpot, which we have covered previously. Dexpot is free, but only for private use. Companies, public institutions, non-profit organizations, and even freelancers and self-employed people must buy the program. We found another virtual desktop tool that is completely free for everyone to use, called mDesktop. It’s a lightweight, open source program that allows you to switch among multiple desktops using hot keys and specify open programs or folders to be active on all desktops. You can use mDesktop to group related programs or to work on different projects on separate desktops. mDesktop is portable and does not need to be installed. Simply extract the .zip file you downloaded (see the link at the end of this article) and double-click the mDesktop.exe file. How To Boot Your Android Phone or Tablet Into Safe Mode HTG Explains: Does Your Android Phone Need an Antivirus? How To Use USB Drives With the Nexus 7 and Other Android Devices

    Read the article

  • 5 New Java Champions

    - by Tori Wieldt
    The Java Champions have nominated and accepted five new members to their group: Jonas Bonér, James Strachan, Rickard Oberg, Régina ten Bruggencate, and Clara Ko. Congratulations, and we look forward to hearing more from each of them!Jonas Bonér (Sweden) is a Java entrepreneur, programmer, teacher, speaker and author. He is an active contributor to the Open Source community; and most notably created the Akka Project, AspectWerkz Aspect-Oriented Programming (AOP) framework. James Strachan (UK) has more than 20 years experience in enterprise software development with a background in finance and middleware and is also committer on a number of open source projects, including Apache Karaf, Maven, Lift and Jersey.Rickard Oberg (Malaysia) has worked on several Open Source projects that involve JEE development, such as JBoss, XDoclet and WebWork. He has also been the principal architect of the SiteVision CMS/portal platform, where he used AOP as the foundation. Now he works for Jayway, developing the Qi4j framework and Composite Oriented Programming paradigm.Régina ten Bruggencate (Netherlands) is a senior Java developer for iProfs with 10-plus years of Java experience, mainly on enterprise applications. Régina is the current president of Duchess, and as such has the responsibility for the site and community. Duchess is a global organization for women in Java technology, currently with 350 members in over 50 countries.Clara Ko (Netherlands) is a freelance Java/J2EE professional living in Amsterdam. She has worked as a developer, architect, and project manager. She promotes the use of open source software and has led initiatives to adopt agile practices across multiple organizations. Clara is also co-founder of Duchess.The Java Champions are an exclusive group of passionate Java technology and community leaders who are community-nominated and selected under a project sponsored by Oracle. Java Champions get the opportunity to provide feedback, ideas, and direction that will help Oracle grow the Java Platform. This interchange may be in the form of technical discussions and/or community-building activities with Oracle's Java Development and Developer Program teams. Full bios and details about the champions are on http://java-champions.java.net/.

    Read the article

  • Java Spotlight Episode 148: Bruno Souza on SouJava and the JCP @JCP @Soujava

    - by Roger Brinkley
    Interview with Bruno Souza of SouJava on the upcoming JCP elections, SouJava's involvement in the JCP, Adopt a JSR program, transparency, and Juggy.. Right-click or Control-click to download this MP3 file. You can also subscribe to the Java Spotlight Podcast Feed to get the latest podcast automatically. If you use iTunes you can open iTunes and subscribe with this link: Java Spotlight Podcast in iTunes. Show Notes News Java SE 8: Lambda Quick Start JCP Executive Committee Elections start Oct 15 Java EE 7 Certification Survey - Participants Needed Events Oct 28-30, JAX London, London Nov 4-8, Oredev, Malmö, Sweden Nov 6, JFall, Amsterdam, Netherlands Nov 11-15, Devoxx, Belgium Feature Interview Bruno Souza is a Java Developer and Open Source Evangelist at Summa Technologies, and a Cloud Expert at ToolsCloud. Nurturing developer communities is a personal passion, and Bruno worked actively with Java, NetBeans, Open Solaris, OFBiz, and many other open source communities. As founder and coordinator of SouJava (The Java Users Society), one of the world's largest Java User Groups, Bruno leaded the expansion of the Java movement in Brazil. Founder of the Worldwide Java User Groups Community, Bruno helped the creation and organization of hundreds of JUGs worldwide. A Java Developer since the early days, Bruno participated in some of the largest Java projects in Brazil. What’s Cool ControlsFX 8.0.2 Release Screencast by Adam Bien on using JavaFX with Maven and SceneBuilder New DukePad video by Jasper Potts

    Read the article

< Previous Page | 841 842 843 844 845 846 847 848 849 850 851 852  | Next Page >