Search Results

Search found 5705 results on 229 pages for 'observer pattern'.

Page 86/229 | < Previous Page | 82 83 84 85 86 87 88 89 90 91 92 93  | Next Page >

  • ZSI.generate.Wsdl2PythonError: unsupported local simpleType restriction

    - by diegor
    Hi guys, i have this simple type from an external webservice: <xsd:element name="card_number" maxOccurs="1" minOccurs="1"> <xsd:simpleType> <xsd:restriction base="tns:PanType"> <xsd:pattern value="\d{16}"></xsd:pattern> <xsd:whiteSpace value="collapse"></xsd:whiteSpace> </xsd:restriction> </xsd:simpleType> </xsd:element> but whe i launch wsdl2py -b filename.wsdl i got this error: ZSI.generate.Wsdl2PythonError: unsupported local simpleType restriction: <schema targetNamespace="https://xxxxx.yyyyy.zz/sss/"><complexType name="PaymentReq"><sequence><element name="card_number"><simpleType> How can i fix this? I tried to change from simpleType to compleType and wsdl2py generate python code without problem. In this way i can't be able to use card_number in my python object. Thanks for helping.

    Read the article

  • jQuery - ajax page load - php scope

    - by Develman
    I am using jquery.tabs() and want to load the pages of the tabs with ajax. I am using MVC pattern with PHP and used a frontcontroller / pagecontroller pattern. The templating is done by PHP, e.g.: <?php if($this->userLoggedIn == TRUE): ?> <span>Herzlich Willkommen <?php echo $this->userName; ?>! [<a href="logout">Ausloggen</a>] </span> <?php endif; ?> The variables ($this-userName) are injected by the pagecontroller class. The problem is, that when I load a page via ajax, the variables are not known. Following PHP error is coming up: Fatal error: Using $this when not in object context.... Any idea, how to use / load the variables and using it in the template files.

    Read the article

  • Regular expression works normally, but fails when placed in an XML schema

    - by Eli Courtwright
    I have a simple doc.xml file which contains a single root element with a Timestamp attribute: <?xml version="1.0" encoding="utf-8"?> <root Timestamp="04-21-2010 16:00:19.000" /> I'd like to validate this document against a my simple schema.xsd to make sure that the Timestamp is in the correct format: <?xml version="1.0" encoding="utf-8"?> <xs:schema attributeFormDefault="unqualified" elementFormDefault="qualified" xmlns:xs="http://www.w3.org/2001/XMLSchema"> <xs:element name="root"> <xs:complexType> <xs:attribute name="Timestamp" use="required" type="timeStampType"/> </xs:complexType> </xs:element> <xs:simpleType name="timeStampType"> <xs:restriction base="xs:string"> <xs:pattern value="(0[0-9]{1})|(1[0-2]{1})-(3[0-1]{1}|[0-2]{1}[0-9]{1})-[2-9]{1}[0-9]{3} ([0-1]{1}[0-9]{1}|2[0-3]{1}):[0-5]{1}[0-9]{1}:[0-5]{1}[0-9]{1}.[0-9]{3}" /> </xs:restriction> </xs:simpleType> </xs:schema> So I use the lxml Python module and try to perform a simple schema validation and report any errors: from lxml import etree schema = etree.XMLSchema( etree.parse("schema.xsd") ) doc = etree.parse("doc.xml") if not schema.validate(doc): for e in schema.error_log: print e.message My XML document fails validation with the following error messages: Element 'root', attribute 'Timestamp': [facet 'pattern'] The value '04-21-2010 16:00:19.000' is not accepted by the pattern '(0[0-9]{1})|(1[0-2]{1})-(3[0-1]{1}|[0-2]{1}[0-9]{1})-[2-9]{1}[0-9]{3} ([0-1]{1}[0-9]{1}|2[0-3]{1}):[0-5]{1}[0-9]{1}:[0-5]{1}[0-9]{1}.[0-9]{3}'. Element 'root', attribute 'Timestamp': '04-21-2010 16:00:19.000' is not a valid value of the atomic type 'timeStampType'. So it looks like my regular expression must be faulty. But when I try to validate the regular expression at the command line, it passes: >>> import re >>> pat = '(0[0-9]{1})|(1[0-2]{1})-(3[0-1]{1}|[0-2]{1}[0-9]{1})-[2-9]{1}[0-9]{3} ([0-1]{1}[0-9]{1}|2[0-3]{1}):[0-5]{1}[0-9]{1}:[0-5]{1}[0-9]{1}.[0-9]{3}' >>> assert re.match(pat, '04-21-2010 16:00:19.000') >>> I'm aware that XSD regular expressions don't have every feature, but the documentation I've found indicates that every feature that I'm using should work. So what am I mis-understanding, and why does my document fail?

    Read the article

  • Problem deploying servlets in JBoss 5.1 on eclipse.

    - by Jeremy Goodell
    Yesterday I created a simple image servlet and attempted to deploy it. I am getting an error on JBoss startup, and then further errors on trying to invoke the servlet. I spent about 8 hours yesterday searching the web for answers and trying different scenarios. I ended up making my JBoss problems worse and then fixing them, but I never did get the servlet to work. The servlet is com.controller.MyImageServlet, and looks like this: package com.controller; import javax.servlet.http.*; /** * Servlet implementation class MyImageServlet */ public class MyImageServlet extends HttpServlet { private static final long serialVersionUID = 1L; public MyImageServlet() { super(); } // Process the HTTP Get request public void doGet(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException { /* ... */ } } The tags I've added to web.xml looks like this: <servlet> <servlet-name>ImageServlet</servlet-name> <servlet-class>com.controller.MyImageServlet</servlet-class> </servlet> <servlet-mapping> <servlet-name>ImageServlet</servlet-name> <url-pattern>/CERTIMAGE/*</url-pattern> </servlet-mapping> On server startup, this is the only indication in the log that something is amiss: 01:59:25,328 WARN [JAXWSDeployerHookPreJSE] Cannot load servlet class: com.controller.MyImageServlet When I try the URL pattern (http://localhost:9980/CERTIMAGE/1), I get the following stack trace in the log (and in the Browser): 01:59:39,640 INFO [[/]] Marking servlet ImageServlet as unavailable 01:59:39,640 ERROR [[ImageServlet]] Allocate exception for servlet ImageServlet java.lang.ClassNotFoundException: com.controller.MyImageServlet at java.net.URLClassLoader$1.run(URLClassLoader.java:202) at java.security.AccessController.doPrivileged(Native Method) at java.net.URLClassLoader.findClass(URLClassLoader.java:190) at java.lang.ClassLoader.loadClass(ClassLoader.java:307) at java.lang.ClassLoader.loadClass(ClassLoader.java:248) at org.jboss.web.tomcat.service.TomcatInjectionContainer.newInstance(TomcatInjectionContainer.java:262) at org.jboss.web.tomcat.service.TomcatInjectionContainer.newInstance(TomcatInjectionContainer.java:256) at org.apache.catalina.core.StandardWrapper.loadServlet(StandardWrapper.java:1006) at org.apache.catalina.core.StandardWrapper.allocate(StandardWrapper.java:777) at org.apache.catalina.core.StandardWrapperValve.invoke(StandardWrapperValve.java:129) at org.apache.catalina.core.StandardContextValve.invoke(StandardContextValve.java:191) at org.jboss.web.tomcat.security.SecurityAssociationValve.invoke(SecurityAssociationValve.java:190) at org.jboss.web.tomcat.security.JaccContextValve.invoke(JaccContextValve.java:92) at org.jboss.web.tomcat.security.SecurityContextEstablishmentValve.process(SecurityContextEstablishmentValve.java:126) at org.jboss.web.tomcat.security.SecurityContextEstablishmentValve.invoke(SecurityContextEstablishmentValve.java:70) at org.apache.catalina.core.StandardHostValve.invoke(StandardHostValve.java:127) at org.apache.catalina.valves.ErrorReportValve.invoke(ErrorReportValve.java:102) at org.jboss.web.tomcat.service.jca.CachedConnectionValve.invoke(CachedConnectionValve.java:158) at org.apache.catalina.core.StandardEngineValve.invoke(StandardEngineValve.java:109) at org.apache.catalina.connector.CoyoteAdapter.service(CoyoteAdapter.java:330) at org.apache.coyote.http11.Http11Processor.process(Http11Processor.java:829) at org.apache.coyote.http11.Http11Protocol$Http11ConnectionHandler.process(Http11Protocol.java:598) at org.apache.tomcat.util.net.JIoEndpoint$Worker.run(JIoEndpoint.java:447) at java.lang.Thread.run(Thread.java:619) If I try the URL pattern again, I get the following message in the log: 09:33:32,390 INFO [[ImageServlet]] Servlet ImageServlet is currently unavailable I have verified that MyImageServlet.class is in the WAR at WEB-INF/classes/com/controller/images. As a matter of fact, I even added some code to one of my JSPs to attempt to instantiate the Servlet and call the doGet method. This actually works and outputs the correct debug sequences to the log indicating that the Servlet constructor and doGet methods were called. I also tried following some instructions for creating/deploying a very simple HelloWorld servlet, and that has exactly the same problem. Note that web.xml already contained a servlet put there by JBoss: org.jboss.web.tomcat.service.StatusServlet -- that Servlet does not give any errors in the log. As an experiment, I removed ".web" from that path and ended up getting exactly the same error as I'm getting on my Servlet. So it would appear that JBoss is not able to locate my Servlet given the specified path. Just for kicks, I've tried all sorts of other paths, like just plain MyImageServlet, controller.MyImageServlet, and more. Also, the servlet was originally named ImageServlet, but I attempted the name change thinking maybe there was some conflict with an existing ImageServlet. In all cases, the behavior is the same. After all of my research yesterday, I would say that this appears to be a problem with the JBoss servlet container, and I also learned that JBoss 5.1.0.GA should come bundled with a tomcat servlet container. I installed JBoss on my PC (Windows XP) myself less than 2 months ago (from jboss.org) and used it pretty much as is. Note that I am running on JDK 1.6, so I did use the jboss-jdk6 installation version. I am running on Windows, but I also deploy to a Linux virtual dedicated server. I deployed the current version of my program, including the servlet to the Linux box, but I get the exact same errors. I'm reluctant to just try reinstalling JBoss, since it's hard to place the blame on the JBoss installation when I get the same errors on two completely different installations. I am a bit suspicious of the bundled tomcat servlet container, because using eclipse, I haven't been able to locate any indication that there is a tomcat bundled into JBoss. I did locate servlet-api.jar in the JBoss common/lib directory. This is on the eclipse build path. One possibly useful note: I had previously used a standalone tomcat server for other projects using the same eclipse, so maybe it's some sort of eclipse issue? But, as I said, I do get the same errors when I deploy to the Linux server, and that deployment process just involves ftping files to the server and then putting them into the deployed war package and restarting JBoss. Thanks for any help you can provide.

    Read the article

  • Google App Engine - Blob Store Service with a Dispatcher Servlet

    - by Rahul
    I have a central dispatcher servlet that has a servlet mapping of : <servlet-mapping> <servlet-name>dispatcher</servlet-name> <url-pattern>/</url-pattern> </servlet-mapping> When i try to use the blob store service's createUploadUrl("/uploadComplete") it maps to a URL for e.g *'/_ah/upload/agp0d2VldG15cGljchsLEhVfX0Jsb2JVcGxvYWRTZXNzaW9uX18YEgw'*. Before the Blob store service can handle the upload and redirect to /uploadComplete; my dispatcher servlet gets called and i am therefore not being able to upload anything. Is there a servlet/ filter that i can map to /_ah/upload/* in my web.xml ? How do i avoid the dispatcher servlet from getting called before the Blob store service can do its thing?

    Read the article

  • Routing and URI parsing in Codeigniter

    - by bobo
    I have a route defined in CI, $route['user/activate-account/:any'] = "user/activate_account"; People access the route in this url pattern, http://mydomain.com/user/activate-account/user_id/12345/token/abcdefghijk Inside the activate_account function, I tried to use the following codes to retrieve the required data, $user_id=$this->input->get('user_id'); $token=$this->input->get('token'); But they return FALSE, does this mean that for this kind of url pattern, I am supposed to use the functions provided by the URI class (http://codeigniter.com/user_guide/libraries/uri.html) to retrieve the variables?

    Read the article

  • Trouble enabling Grails logging

    - by Dave
    I have this logging configuration in my Config.groovy file. This is a development environment, started as such. I have verified the file exists and there are 775 perms on the file, but nothing is getting output to the file. // set per-environment serverURL stem for creating absolute links environments { production { grails.serverURL = "http://www.changeme.com" } development { grails.serverURL = "http://localhost:8080/${appName}" logFilePath = "/Users/davea/Tomcat/logs/log4j.log" } test { grails.serverURL = "http://localhost:8080/${appName}" } } // log4j configuration log4j = { console name:'Appender1', layout:pattern(conversionPattern: '%-4r [%t] %-5p %c %x - %m%n') rollingFile name:'Appender2', maxFileSize:1024 * 1024, file:logFilePath, layout:pattern(conversionPattern: '%-4r [%t] %-5p %c %x - %m%n') root { debug 'Appender1', 'Appender2' } } Can anyone tell what's wrong with my configuration? Thanks, - Dave

    Read the article

  • How can I implement Unix grep in Perl?

    - by Ankit Rathod
    How can I implement grep of Unix in Perl? I tried to use Perl's built-in grep. Here is the code which is not working: $pattern = @ARGV[0]; $file= @ARGV[1]; open($fp,$file); @arr = <$fp>; @lines = grep $pattern, @arr; close($fp); print @lines; And by the way, i am trying only basic grep functionality not full featured and secondly i don't want to do string parsing myself. I want to use inbuilt grep or some function of Perl. Thanks in advance :)

    Read the article

  • Regex - replace only last part of an expression

    I'm attempting to find the best methodology for finding a specific pattern and then replace the ending portion of the pattern. Here is a quick example (in C#): //Find any year value starting with a bracket or underscore string patternToFind = "[[_]2007"; Regex yearFind = new Regex(patternToFind); //I want to change any of these values to x2008 where x is the bracket or underscore originally in the text. I was trying to use Regex.Replace(), but cannot figure out if it can be applied. If all else fails, I can find Matches using the MatchCollection and then switch out the 2007 value with 2008; however, I'm hoping for something more elegant MatchCollections matches = yearFind.Matches(" 2007 [2007 _2007"); foreach (Match match in matches){ //use match to find and replace value }

    Read the article

  • How to sort my paws?

    - by Ivo Flipse
    In my previous question I got an excellent answer that helped me detect where a paw hit a pressure plate, but now I'm struggling to link these results to their corresponding paws: I manually annotated the paws (RF=right front, RH= right hind, LF=left front, LH=left hind). As you can see there's clearly a pattern repeating pattern and it comes back in aknist every measurement. Here's a link to a presentation of 6 trials that were manually annotated. My initial thought was to use heuristics to do the sorting, like: There's a ~60-40% ratio in weight bearing between the front and hind paws; The hind paws are generally smaller in surface; The paws are (often) spatially divided in left and right. However, I’m a bit skeptical about my heuristics, as they would fail on me as soon as I encounter a variation I hadn’t thought off. They also won’t be able to cope with measurements from lame dogs, whom probably have rules of their own. Furthermore, the annotation suggested by Joe sometimes get's messed up and doesn't take into account what the paw actually looks like. Based on the answers I received on my question about peak detection within the paw, I’m hoping there are more advanced solutions to sort the paws. Especially because the pressure distribution and the progression thereof are different for each separate paw, almost like a fingerprint. I hope there's a method that can use this to cluster my paws, rather than just sorting them in order of occurrence. So I'm looking for a better way to sort the results with their corresponding paw. For anyone up to the challenge, I have pickled a dictionary with all the sliced arrays that contain the pressure data of each paw (bundled by measurement) and the slice that describes their location (location on the plate and in time). To clarfiy: walk_sliced_data is a dictionary that contains ['ser_3', 'ser_2', 'sel_1', 'sel_2', 'ser_1', 'sel_3'], which are the names of the measurements. Each measurement contains another dictionary, [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10] (example from 'sel_1') which represent the impacts that were extracted. Also note that 'false' impacts, such as where the paw is partially measured (in space or time) can be ignored. They are only useful because they can help recognizing a pattern, but won't be analyzed. And for anyone interested, I’m keeping a blog with all the updates regarding the project!

    Read the article

  • Design of Business Layer

    - by Adil Mughal
    Hi, We are currently revamping our architecture and design of application. We have just completed design of Data Access Layer which is generic in the sense that it works using XML and reflection to persist data. Any ways now we are in the phase of designing business layer. We have read some books related to Enterprise Architecture and Design so we have found that there are few patterns that can be applied on business layer. Table Pattern and Domain Model are example of such patterns. Also we have found Domain Driven Design as well. Earlier we decided to build Entities against table objects. But we found that there is difference in Entities and Value Objects when it comes to DDD. For those of you who have gone through such design. Please guide me related to pattern, practice and sample. Thank you in advance! Also please feel free to discuss if you didn't get any point of mine.

    Read the article

  • StackOverflowError occured as using java.util.regex.Matcher

    - by Captain Kidd
    Hi guys I try to catch text by Regular Expression. I list codes as follows. Pattern p=Pattern.compile("<@a>(?:.|\\s)+?</@a>"); Matcher m = p.matcher(fileContents.toString()); while(m.find()) { //Error will be thrown at this point System.out.println(m.group()); } If the length of text I want to catch is too long, system will throw me a StackOverflowError. Otherwise, the codes work well. Please help me how to solve this problem.

    Read the article

  • initial caps in actionScript using Regex

    - by Deyon
    I'm trying to do initial caps in actionScript with no loops but now i'm stuck. I wanted to select the first letter or every word then apply uppercase on that letter. Well I got the selection part right, but at a dead end right now, any ideas? I was trying to do this with out loops and cutting up strings. //replaces with x cant figure out how to replace with the found result as uppercase public function initialcaps():void { var pattern:RegExp=/\b[a-z]/g; var myString:String="yes that is my dog dancing on the stage"; var nuString:String=myString.replace(pattern,"x"); trace(nuString); }

    Read the article

  • Find ASCII "arrows" in text

    - by ulver
    I'm trying to find all the occurrences of "Arrows" in text, so in "<----=====><==->>" the arrows are: "<----", "=====>", "<==", "->", ">" This works: String[] patterns = {"<=*", "<-*", "=*>", "-*>"}; for (String p : patterns) { Matcher A = Pattern.compile(p).matcher(s); while (A.find()) { System.out.println(A.group()); } } but this doesn't: String p = "<=*|<-*|=*>|-*>"; Matcher A = Pattern.compile(p).matcher(s); while (A.find()) { System.out.println(A.group()); } No idea why. It often reports "<" instead of "<====" or similar. What is wrong?

    Read the article

  • spring 3 mvc requestmapping dynamic param problem

    - by Faisal khan
    I have the following code which works fine with http://localhost:8080/HelloWorldSpring3/forms/helloworld but i want to have url have some thing like this http://localhost:8080/HelloWorldSpring3/forms/helloworld/locname_here/locid_here I found that adding this @RequestMapping("/helloworld/**") will work but when i try to access http://localhost:8080/HelloWorldSpring3/forms/helloworld/locname_here/locid_here it is not found. Web.xml entry as follows <servlet-mapping> <servlet-name>dispatcher</servlet-name> <url-pattern>/forms/*</url-pattern> </servlet-mapping> Mapping bean entry @RequestMapping("/helloworld/**") public ModelAndView helloWord(){ String message = "Hello World, Spring 3.0!"; return new ModelAndView("helloworld", "message",message); }

    Read the article

  • .Net Regular expression - how to do an exact match exclusion on a full string?

    - by Nathan Ridley
    I need a .Net regular expression that matches anything OTHER than the exact full string match specified. So basically: ^Index$ ... is the only exclusion I care about. Strings can start with, finish with or contain "Index", but not match exactly. My brain doesn't seem to be working today and I'm failing to work this one out. EDIT The answer MUST be via the pattern itself, as I am passing an argument to a third party library and do not have control over the process other than via the Regex pattern.

    Read the article

  • [C#, Regex] EOL Special Char not matching

    - by Aurélien Ribon
    Hello, I am trying to find every "a - b, c, d" pattern in an input string. The pattern I am using is the following : "^[ \t]*(\\w+)[ \t]*->[ \t]*(\\w+)(,[ \t]*\\w+)*$" The input is : a -> b b -> c c -> d The function is : private void ParseAndBuildGraph(String input) { MatchCollection mc = Regex.Matches(input, "^[ \t]*(\\w+)[ \t]*->[ \t]*(\\w+)(,[ \t]*\\w+)*$", RegexOptions.Multiline); foreach (Match m in mc) { Debug.WriteLine(m.Value); } } The output is : c -> d Actually, there is a problem with the line ending "$" special char. If I insert a "\r" before "$", it works, but I thought "$" would match any line termination (with the Multiline option), especially a \r\n in a Windows environment. Is it not the case ?

    Read the article

  • NSPredicate error/behaving differently on 10.5 vs 10.6

    - by Tristan
    I am using a NSPredicate to determine if an entered email address is valid. On 10.6 it works perfectly as expected. I recently decided to get my app going on 10.5 and this is the only thing that doesn't work. The error i get is as follows: "Can't do regex matching, reason: Can't open pattern U_MALFORMED_SET (string [email protected], pattern ([\w-+]+(?:\.[\w-+]+)*@(?:[\w-]+\.)+[a-zA-Z]{2,7}), case 0, canon 0)" The code im using is as follows: NSString *regex = @"([\\w-+]+(?:\\.[\\w-+]+)*@(?:[\\w-]+\\.)+[a-zA-Z]{2,7})"; NSPredicate *regextest = [NSPredicate predicateWithFormat:@"SELF MATCHES %@", regex]; if ([regextest evaluateWithObject:[userEmail objectValue]] == YES) Does anyone know why this isn't working on 10.5? And how I might get it working or be able to do this test in a way compatible for both 10.5 and 10.6?

    Read the article

  • Static Access To Multiple Instance Variable

    - by Qua
    I have a singleton instance that is referenced throughout the project which works like a charm. It saves me the trouble from having to pass around an instance of the object to every little class in the project. However, now I need to manage multiple instances of the previous setup, which means that the singleton pattern breaks since each instance would need it's own singleton instance. What options are there to still maintain static access to the singleton? To be more specific, we have our game engine and several components and plugins reference the engine through a static property. Now our server needs to host multiple game instances each having their own engine, which means that on the server side the singleton pattern breaks. I'm trying to avoid all the classes having the engine in the constructor.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Regular Expression Help in .NET

    - by Matt H.
    I have a simple pattern I am trying to match, any characters captured between parenthesis at the end of an HTML paragraph. I am running into trouble any time there is additional parentheticals in that paragraph: i.e. If the input string is "..... (321)</p" i want to get the value (321) However, if the paragraph has this text: "... (123) (321)</p" my regex is returning "(123) (321)" (everything between the opening "(" and closing ")" I am using the regex pattern "\s(.+)</p" How can I grab the correct value (using VB.NET) This is what I'm doing so far: Dim reg As New Regex("\s\(.+\)</P>", RegexOptions.IgnoreCase) Dim matchC As MatchCollection = reg.Matches(su.Question) If matchC.Count > 0 Then Dim lastMatch As Match = matchC(matchC.Count - 1) Dim DesiredValue As String = lastMatch.Value End If

    Read the article

  • Unit Testing functions within repository interfaces - ASP.net MVC3 & Moq

    - by RawryLions
    I'm getting into writing unit testing and have implemented a nice repository pattern/moq to allow me to test my functions without using "real" data. So far so good.. However.. In my repository interface for "Posts" IPostRepository I have a function: Post getPostByID(int id); I want to be able to test this from my Test class but cannot work out how. So far I am using this pattern for my tests: [SetUp] public void Setup() { mock = new Mock<IPostRepository>(); } [Test] public void someTest() { populate(10); //This populates the mock with 10 fake entries //do test here } In my function "someTest" I want to be able to call/test the function GetPostById. I can find the function with mock.object.getpostbyid but the "object" is null. Any help would be appreciated :) iPostRepository: public interface IPostRepository { IQueryable<Post> Posts {get;} void SavePost(Post post); Post getPostByID(int id); }

    Read the article

  • WCF client proxy initialization

    - by 123Developer
    I am consuming a WCF service and created its proxy using the VS 2008 service reference. I am looking for the best pattern to call WCF service method Should I create the client proxy instance every time I call the service method and close the client as soon as I am done with that? When I profiled my client application, I could see that it is taking lot of time to get the Channel while initializing the proxy client Should I use a Singleton pattern for the client proxy so that I can use the only once instance and get rid of the re-initializing overhead? Is there any hidden problem with this approach? I am using .Net framework 3.5 SP1, basicHttp binding with little customization.

    Read the article

< Previous Page | 82 83 84 85 86 87 88 89 90 91 92 93  | Next Page >