Search Results

Search found 60513 results on 2421 pages for 'parse com'.

Page 87/2421 | < Previous Page | 83 84 85 86 87 88 89 90 91 92 93 94  | Next Page >

  • jQuery: How to parse a multidemensional array?

    - by Allen G
    I'm not sure if the array is too deep or what, but I can't seem to get anything other than the keys and undefines. Help please! I'm using Codeigniter for development. Here is the PHP then the jQuery: $term = $this->input->post('search_term'); $this->db->like('book_title', $term); $search_query = $this->db->get('books'); $return = array(); $i = 0; if ($search_query->num_rows() > 1) { foreach($search_query->result() as $s) { $return['books']['book_id'] = $s->book_id; $return['books']['book_title'] = $s->book_title; $return['books']['book_price'] = $s->book_price; $i++; } } elseif ($search_query->num_rows() == 1) { echo 1; $i = 0; $return['book_id'] = $search_query->row('book_id'); $return['book_title'] = $search_query->row('book_title'); $return['book_price'] = $search_query->row('book_price'); } elseif ($search_query->num_rows() == 0) { echo 0; } echo json_encode($return); $("#search").change(function() { var searchTerm = $(this).val(); $.post("/contentcreator/search_by_term", { search_term: searchTerm }, function(data) { $("#book_scroller").empty(); var lengthHolder = data.books; for (var i = 0; i data.books.length; i++) { var row = '<li id="book_item_' + l + '">' + data.books['book_title'] +'</li>'; $("#book_scroller").append(row); }; i++; }, "json"); }); Thanks!

    Read the article

  • WinDbg can't find mfc90 version 9.0.30729.4148 symbols on msdl.microsoft.com

    - by Simon Hofverberg
    I think the title states my problem fairly well. Where are those mfc symbols? Some background info: I have a crash dump that I want to analyze in WinDbg. My symbol path contains msdl.microsoft.com/download/symbols (and it says h t t p first but I'm a new user here so I'm not allowed to write that twice. The 9.0.30729.4148 version seems to be installed by some Windows update When a dump contains an earlier version of mfc90, it is located by WinDbg on the Microsoft symbol server with the same settings. When I use !sym noisy, the output for mfc90.dll contains: SYMSRV: http://msdl.microsoft.com/download/symbols/mfc90.dll/4A596D4939c000/mfc90.dll not found The same thing happens on two different computers Edit: See my comments below. The symbols are present on the server, but WinDbg can't get them.

    Read the article

  • Ensure connection to a POSPrinter connected via COM

    - by Alexander
    Hi, I need to make sure that the connection to a POS printer is successful before writing data to the database and then printing a receipt. The POSprinter is normally of type BTP 2002NP but may differ. The common thing is that they are all connected via COM-port and NOT usb, so no drivers installed at all on the client. Can I send some kind of "ping" on a COM-port and check if a device is connected and turned on? Any help or suggestions are very much appreciated. Additional information, the application is developed in VB.net and Visual Studio 2008

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • android get duration from maps.google.com directions

    - by urobo
    At the moment I am using this code to inquire google maps for directions from an address to another one, then I simply draw it on a mapview from its GeometryCollection. But yet this isn't enough I need also to extract the total expected duration from the kml. can someone give a little sample code to help me? thanks StringBuilder urlString = new StringBuilder(); urlString.append("http://maps.google.com/maps?f=d&hl=en"); urlString.append("&saddr=");//from urlString.append( Double.toString((double)src.getLatitudeE6()/1.0E6 )); urlString.append(","); urlString.append( Double.toString((double)src.getLongitudeE6()/1.0E6 )); urlString.append("&daddr=");//to urlString.append( Double.toString((double)dest.getLatitudeE6()/1.0E6 )); urlString.append(","); urlString.append( Double.toString((double)dest.getLongitudeE6()/1.0E6 )); urlString.append("&ie=UTF8&0&om=0&output=kml"); //Log.d("xxx","URL="+urlString.toString()); // get the kml (XML) doc. And parse it to get the coordinates(direction route). Document doc = null; HttpURLConnection urlConnection= null; URL url = null; try { url = new URL(urlString.toString()); urlConnection=(HttpURLConnection)url.openConnection(); urlConnection.setRequestMethod("GET"); urlConnection.setDoOutput(true); urlConnection.setDoInput(true); urlConnection.connect(); dbf = DocumentBuilderFactory.newInstance(); db = dbf.newDocumentBuilder(); doc = db.parse(urlConnection.getInputStream()); if(doc.getElementsByTagName("GeometryCollection").getLength()>0) { //String path = doc.getElementsByTagName("GeometryCollection").item(0).getFirstChild().getFirstChild().getNodeName(); String path = doc.getElementsByTagName("GeometryCollection").item(0).getFirstChild().getFirstChild().getFirstChild().getNodeValue() ; //Log.d("xxx","path="+ path); String[] pairs = path.split(" "); String[] lngLat = pairs[0].split(","); // lngLat[0]=longitude lngLat[1]=latitude lngLat[2]=height // src GeoPoint startGP = new GeoPoint((int)(Double.parseDouble(lngLat[1])*1E6),(int)(Double.parseDouble(lngLat[0])*1E6)); mMapView01.getOverlays().add(new MyOverLay(startGP,startGP,1)); GeoPoint gp1; GeoPoint gp2 = startGP; for(int i=1;i<pairs.length;i++) // the last one would be crash { lngLat = pairs[i].split(","); gp1 = gp2; // watch out! For GeoPoint, first:latitude, second:longitude gp2 = new GeoPoint((int)(Double.parseDouble(lngLat[1])*1E6),(int)(Double.parseDouble(lngLat[0])*1E6)); mMapView01.getOverlays().add(new MyOverLay(gp1,gp2,2,color)); //Log.d("xxx","pair:" + pairs[i]); } mMapView01.getOverlays().add(new MyOverLay(dest,dest, 3)); // use the default color } }catch (MalformedURLException e){ e.printStackTrace(); }catch (IOException e){ e.printStackTrace(); }catch (SAXException e){ e.printStackTrace(); } catch (ParserConfigurationException e) { e.printStackTrace(); } }

    Read the article

  • Using JavaScript to parse an XML file

    - by Chris Clouten
    I am new to Stack OverFlow and coding in general. I am trying to take an XML file and render it in the browser using JavaScript. I have looked around at some sample code of how to do this and came up with the following code: <!DOCTYPE html> <html> <body> <script> if (window.XMLHttpRequest) {// code for IE7+, Firefox, Chrome, Opera, Safari xmlhttp=new XMLHttpRequest(); } else {// code for IE6, IE5 xmlhttp=new ActiveXObject("Microsoft.XMLHTTP"); } xmlhttp.open("GET","social.xml",false); xmlhttp.send(); xmlDoc=xmlhttp.responseXML; document.write("<table border='1'>"); var x=xmlDoc.getElementsByTagName("CD"); for (i=0;i<x.length;i++) { document.write("<tr><td>"); document.write(x[i].getElementsByTagName("c_id")[0].childNodes[0].nodeValue); document.write("</td><td>"); document.write(x[i].getElementsByTagName("facebook_id")[0].childNodes[0].nodeValue); document.write("</td></tr>"); } document.write("</table>"); </script> </body> </html> Anyway, when I run this on my local server none of the data that I am trying to display in the table appears. My .html file and .xml file are in the same folder, so I believe I have the correct file pathway. I could just be making a rookie mistake here, but I can't for the life of me figure out why a table listing the c_id and facebook_id values is not being created. I looked around for answers and haven't been able to find any. Any help would be greatly appreciated. Thanks!

    Read the article

  • How to parse an XML file using PHP?

    - by Jack
    Here I have a variable 'response' which is obtained by parsing an XML file. $url = 'http://xxxxx.xml'; $ch = curl_init($url); $response = curl_exec($ch); The url structure is as follows - <user> <id>734</id> <name>Peter Parker</name> - <status> <favorited>false</favorited> </status> </user> How to access each bit of info like id,name,favorited from response?

    Read the article

  • Parse multiple named command line parameters

    - by scholzr
    I need to add the ability to a program to accept multiple named parameters when opening the program via the command line. i.e. program.exe /param1=value /param2=value and then be able to utilize these parameters as variables in the program. I have found a couple of ways to accomplish pieces of this, but can't seem to figure out how to put it all together. I have been able to pass one named parameter and recover it using the code below, and while I could duplicate it for every possible named parameter, I know that can't be the preffered way to do this. Dim inputArgument As String = "/input=" Dim inputName As String = "" For Each s As String In My.Application.CommandLineArgs If s.ToLower.StartsWith(inputArgument) Then inputName = s.Remove(0, inputArgument.Length) End If Next Alternatively, I can get multiple unnamed parameters from the command line using My.Application.CommandLineArgs But this requires that the parameters all be passed in the same order/format each time. I need to be able to pass a random subset of parameters each time. Ultimately, what I would like to be able to do, is separate each argument and value, and load it into a multidimentional array for later use. I know that I could find a way to do this by separating the string at the "=" and stripping the "/", but as I am somewhat new to this, I wanted to see if there was a "preffered" way for dealing with multiple named parameters?

    Read the article

  • Jquery-ajax parse xml and set radiobutton

    - by haltman
    hi everybody, I've a form with some radio button like this: <input type="radio" name="leva" value="a"><input type="radio" name="leva" value="b"> with ajax post method I receive value of the radio. The question is how can I set correct radio value to checked? thanks in advance ciao h.

    Read the article

  • Salon LesJeudis.com : plus de 500 postes IT à pourvoir à Lyon le 22 novembre, à l'Espace Tête d'Or

    Salon LesJeudis.com Lyon : plus de 500 postes IT à pourvoir Le jeudi 22 novembre à l'Espace Tête d'Or LesJeudis.com organise un nouveau salon de recrutement ce jeudi 22 novembre à l'Espace Tête d'Or de 10h à 18h. Pour les développeurs qui recherchent un emploi ou un nouveau poste, plus de 500 postes seront à pourvoir. Parmi les nombreuses entreprises qui seront à la recherche de candidats, citons l'habituel Steria mais aussi Michelin, OVH ou Homsys (spécialiste du conseil en Business Intelligence). Chaque candidat aura également la possibilité de soumettre son profil à un consultant en ressources humaines pour affiner sa stratégie d'attaque.

    Read the article

  • java.lang.NoClassDefFoundError: com/google/appengine/tools/enhancer/Enhance

    - by user1204337
    I am new to GAE, I follow the instructions on http://code.google.com/eclipse/docs/install-eclipse-3.7.html. I got the installation and registration done pretty fast. But when I tried to build the helloWorld project in Eclipse, before I can do anything, Eclipse gives me an error says "java.lang.NoClassDefFoundError: com/google/appengine/tools/enhancer/Enhance" and it is very weird. Because when you expand the app engine sdk, you can easily find the Enhance class under related jar file. I also tried Enhance e = null; and it is working. It seems that my eclipse just cannot find it. I don't know why it is not working, I am using JDK1.6, I reinstall my eclipse and the google plugins, I even disabled my firewall. Please help!!!

    Read the article

  • How to intercept, parse and compile?

    - by epitka
    This is a problem I've been struggling to solve for a while. I need a way to either replace code in the method with a parsed code from the template at compile time (PostSharp comes to mind) or to create a dynamic proxy (Linfu or Castle). So given a source code like this [Template] private string GetSomething() { var template = [%=Customer.Name%] } I need it to be compiled into this private string GetSomething() { MemoryStream mStream = new MemoryStream(); StreamWriter writer = new StreamWriter(mStream,System.Text.Encoding.UTF8); writer.Write(@"" ); writer.Write(Customer.Name); StreamReader sr = new StreamReader(mStream); writer.Flush(); mStream.Position = 0; return sr.ReadToEnd(); } It is not important what technology is used. I tried with PostSharp's ImplementMethodAspect but got nowhere (due to lack of experience with it). I also looked into Linfu framework. Can somebody suggest some other approach or way to do this, I would really appreciate. My whole project depends on this.

    Read the article

  • org.hibernate.HibernateException: Error while accessing enum.values(): class com.mksoft.fbautomate.d

    - by Misha Koshelev
    This error is driving me nuts!!! Caused by: java.lang.NoSuchMethodException: com.mksoft.fbautomate.domain.Account$Type.values() The same exact class works fine in a separate Groovy file. Any ideas/help much appreciated. Most confusing... http://java.sun.com/j2se/1.5.0/docs/api/java/lang/Enum.html has no values() method! Here is my class: @Entity class Account { @Id @GeneratedValue(strategy=GenerationType.AUTO) public Long id enum Type {MYVALUE} @Enumerated(EnumType.STRING) public Type type public String email // @org.hibernate.annotations.Type(type="encryptedString") public String pass public String fullName String toString() { "type:\""+type+"\",email:\""+email+"\""+",fullName=\""+fullName+"\"" } } Thank you! Misha

    Read the article

  • Scala parser combinators: how to parse "if(x)" if x can contain a ")"

    - by Germán
    I'm trying to get this to work: def emptyCond: Parser[Cond] = ("if" ~ "(") ~> regularStr <~ ")" ^^ { case s => Cond("",Nil,Nil) } where regularStr is defined to accept a number of things, including ")". Of course, I want this to be an acceptable input: if(foo()). But for any if(x) it is taking the ")" as part of the regularStr and so this parser never succeeds. What am I missing?

    Read the article

  • How to parse text as JavaScript?

    - by Danjah
    This question of mine (currently unanswered), drove me toward finding a better solution to what I'm attempting. My requirements: chunks of code which can be arbitrarily added into a document, without an identifier: [div class="thing"] [elements... /] [/div] the objects are scanned for and found by an external script: var things = yd.getElementsBy(function(el){ return yd.hasClass('thing'); },null,document ); the objects must be individually configurable, what I have currently is identifier-based: [div class="thing" id="thing0"] [elements... /] [script type="text/javascript"] new Thing().init({ id:'thing0'; }); [/script] [/div] So I need to ditch the identifier (id="thing0") so there are no duplicates when more than one chunk of the same code is added to a page I still need to be able to config these objects individually, without an identifier SO! All of that said, I wondered about creating a dynamic global variable within the script block of each added chunk of code, within its script tag. As each 'thing' is found, I figure it would be legit to grab the innerHTML of the script tag and somehow convert that text into a useable JS object. Discuss. Ok, don't discuss if you like, but if you get the drift then feel free to correct my wayward thinking or provide a better solution - please! d

    Read the article

  • When does a Tumbling Window Start in StreamInsight

    Whilst getting some courseware ready I was playing around writing some code and I decided to very simply show when a window starts and ends based on you asking for a TumblingWindow of n time units in StreamInsight.  I thought this was going to be a two second thing but what I found was something I haven’t yet found documented anywhere until now.   All this code is written in C# and will slot straight into my favourite quick-win dev tool LinqPad   Let’s first create a sample dataset   var EnumerableCollection = new [] { new {id = 1, StartTime = DateTime.Parse("2010-10-01 12:00:00 PM").ToLocalTime()}, new {id = 2, StartTime = DateTime.Parse("2010-10-01 12:20:00 PM").ToLocalTime()}, new {id = 3, StartTime = DateTime.Parse("2010-10-01 12:30:00 PM").ToLocalTime()}, new {id = 4, StartTime = DateTime.Parse("2010-10-01 12:40:00 PM").ToLocalTime()}, new {id = 5, StartTime = DateTime.Parse("2010-10-01 12:50:00 PM").ToLocalTime()}, new {id = 6, StartTime = DateTime.Parse("2010-10-01 01:00:00 PM").ToLocalTime()}, new {id = 7, StartTime = DateTime.Parse("2010-10-01 01:10:00 PM").ToLocalTime()}, new {id = 8, StartTime = DateTime.Parse("2010-10-01 02:00:00 PM").ToLocalTime()}, new {id = 9, StartTime = DateTime.Parse("2010-10-01 03:20:00 PM").ToLocalTime()}, new {id = 10, StartTime = DateTime.Parse("2010-10-01 03:30:00 PM").ToLocalTime()}, new {id = 11, StartTime = DateTime.Parse("2010-10-01 04:40:00 PM").ToLocalTime()}, new {id = 12, StartTime = DateTime.Parse("2010-10-01 04:50:00 PM").ToLocalTime()}, new {id = 13, StartTime = DateTime.Parse("2010-10-01 05:00:00 PM").ToLocalTime()}, new {id = 14, StartTime = DateTime.Parse("2010-10-01 05:10:00 PM").ToLocalTime()} };   Now let’s create a stream of point events   var inputStream = EnumerableCollection .ToPointStream(Application,evt=> PointEvent .CreateInsert(evt.StartTime,evt),AdvanceTimeSettings.StrictlyIncreasingStartTime);   Now we can create our windows over the stream.  The first window we will create is a one hour tumbling window.  We’'ll count the events in the window but what we do here is not the point, the point is our window edges.   var windowedStream = from win in inputStream.TumblingWindow(TimeSpan.FromHours(1),HoppingWindowOutputPolicy.ClipToWindowEnd) select new {CountOfEntries = win.Count()};   Now we can have a look at what we get.  I am only going to show the first non Cti event as that is enough to demonstrate what is going on   windowedStream.ToIntervalEnumerable().First(e=> e.EventKind == EventKind.Insert).Dump("First Row from Windowed Stream");   The results are below   EventKind Insert   StartTime 01/10/2010 12:00   EndTime 01/10/2010 13:00     { CountOfEntries = 5 }   Payload CountOfEntries 5   Now this makes sense and is quite often the width of window specified in examples.  So what happens if I change the windowing code now to var windowedStream = from win in inputStream.TumblingWindow(TimeSpan.FromHours(5),HoppingWindowOutputPolicy.ClipToWindowEnd) select new {CountOfEntries = win.Count()}; Now where does your window start?  What about   var windowedStream = from win in inputStream.TumblingWindow(TimeSpan.FromMinutes(13),HoppingWindowOutputPolicy.ClipToWindowEnd) select new {CountOfEntries = win.Count()};   Well for the first example your window will start at 01/10/2010 10:00:00 , and for the second example it will start at  01/10/2010 11:55:00 Surprised?   Here is the reason why and thanks to the StreamInsight team for listening.   Windows start at TimeSpan.MinValue. Windows are then created from that point onwards of the size you specified in your code.  If a window contains no events they are not produced by the engine to the output.  This is why window start times can be before the first event is created.

    Read the article

  • Salon LesJeudis.com Paris : plus de 2.000 postes IT à pourvoir ce jeudi 27 septembre, Rennes et Lyon suivront

    Salon LesJeudis.com Paris : plus de 2.000 postes IT à pourvoir cette semaine Le jeudi 27 septembre, Rennes et Lyon suivront LesJeudis.com organise un nouveau salon de recrutement ce jeudi 27 septembre au CNIT de la Défense de 11h à 21h. Pour les développeurs qui recherchent un emploi ou un nouveau poste, plus de 2.000 postes seront à pourvoir. Parmi les nombreuses entreprises qui seront à la recherche de candidats, citons les habituels Sogeti, ou Steria mais aussi dans un éventail assez large des entreprises comme Parrot, Michelin, OVH ou le PMU. Chaque candidat aura également la possibilité de soumettre son profil à un consultant en ressources humain...

    Read the article

  • jQuery Autocomplete fetch and parse data source with custom function, except not

    - by Ben Dauphinee
    So, I am working with the jQuery Autocomplete function, and am trying to write a custom data parser. Not sure what I am doing incorrectly, but it throws an error on trying to call the autocompleteSourceParse function, saying that req is not set. setURL("ajax/clients/ac"); function autocompleteSourceParse(req, add){ var suggestions = []; $.getJSON(getURL()+"/"+req, function(data){ $.each(data, function(i, val){ suggestions.push(val.name); }); add(suggestions); }); return(suggestions); } $("#company").autocomplete({ source: autocompleteSourceParse(req, add), minLength: 2 });

    Read the article

  • Using NSXMLParser to parse Vimeo XML on iPhone.

    - by Sonny Fazio
    Hello, I'm working on an iPhone app that will use Vimeo Simple API to give me a listing our videos by a certain user, in a convenient TableView format. I'm new to Parsing XML and have tried TouchXML, TinyXML, and now NSXMLParser with no luck. Most tutorials on parsing XML are for a blog, and not for an API XML sheet. I've tried modifying the blog parsers to search for the specific tags, but it doesn't seem to work. Right now I'm working with NSXMLParser and it seems to correctly find the value of an XML tag, but when it goes to append it to a NSMutableString, it writes a whole bunch of nulls in between it. I'm using a tutorial from theappleblog and modifying it to work with Vimeo API - (void)parser:(NSXMLParser *)parser foundCharacters:(NSString *)string{ if ([currentElement isEqualToString:@"video_title"]) { NSLog(@"String: %@",string); [currentTitle appendString:string]; } else if ([currentElement isEqualToString:@"video_url"]) { [currentLink appendString:string]; } else if ([currentElement isEqualToString:@"video_description"]) { [currentSummary appendString:string]; } else if ([currentElement isEqualToString:@"date"]) { [currentDate appendString:string]; } Here is the nulls it writes: http://grab.by/grabs/92d9cfc2df4fac3fe6579493b1a8e89f.png Then when it finishes, it has to add the NSMutableStrings into a NSMutableDictionary - (void)parser:(NSXMLParser *)parser didStartElement:(NSString *)elementName namespaceURI:(NSString *)namespaceURI qualifiedName:(NSString *)qName attributes:(NSDictionary *)attributeDict{ //NSLog(@"found this element: %@", elementName); currentElement = [elementName copy]; if ([elementName isEqualToString:@"item"]) { // clear out our story item caches... item = [[NSMutableDictionary alloc] init]; currentTitle = [[NSMutableString alloc] init]; currentDate = [[NSMutableString alloc] init]; currentSummary = [[NSMutableString alloc] init]; currentLink = [[NSMutableString alloc] init]; } } - (void)parser:(NSXMLParser *)parser didEndElement:(NSString *)elementName namespaceURI:(NSString *)namespaceURI qualifiedName:(NSString *)qName{ NSLog(@"Title: %@",currentTitle); if ([elementName isEqualToString:@"item"]) {// save values to an item, then store that item into the array... [item setObject:currentTitle forKey:@"video_title"]; NSLog(@"Current Title%@", currentTitle); [item setObject:currentLink forKey:@"video_url"]; [item setObject:currentSummary forKey:@"video_description"]; [item setObject:currentDate forKey:@"date"]; [stories addObject:[item copy]]; NSLog(@"adding story: %@", currentTitle); } } I would really appreciate it if someone has any advance

    Read the article

  • Gruber URL Regex tweak to capture "domain.com"

    - by mootymoots
    I found an updated version of John Gruber's regex for url matching in this post by user GianPac, which states it's been adapted to recognize url without protocol or the www part: (?i)\b((?:[a-z][\w-]+:(?:/{1,3}|[a-z0-9%])|www\d{0,3}[.]|[a-z0-9.-]+[.][a-z]{2,4}/?)(?:[^\s()<]+|(([^\s()<]+|(([^\s()<]+)))))(?:(([^\s()<]+|(([^\s()<]+))))|[^\s`!()[]{};:'\".,<?«»“”‘’])) Whilst this works in most cases, I found it does not match "google.com". It does match "google.comm" and "google.co.uk", so this must be a small oversight. The trouble is, I literally hate regex. It's the bane of my life. I just want to try and tweak this one more time to allow for "google.com" - can anyone throw me a pointer? I (think) it's something to do with this part of the code: +[.][a-z]{2,4}/?) ?

    Read the article

  • Find/parse server-side <?abc?>-like tags in html document

    - by Iggyhopper
    I guess I need some regex help. I want to find all tags like <?abc?> so that I can replace it with whatever the results are for the code ran inside. I just need help regexing the tag/code string, not parsing the code inside :p. <b><?abc print 'test' ?></b> would result in <b>test</b> Edit: Not specifically but in general, matching (<?[chars] (code group) ?>)

    Read the article

< Previous Page | 83 84 85 86 87 88 89 90 91 92 93 94  | Next Page >