Search Results

Search found 8970 results on 359 pages for 'space'.

Page 88/359 | < Previous Page | 84 85 86 87 88 89 90 91 92 93 94 95  | Next Page >

  • Keyboard with normal layout just without numpad? [closed]

    - by Pla
    Do you know any keyboard that does not have a numpad and, at the same time, is not a compact keyboard? I type a lot and I enjoy using standard full sized keyboards. I am annoyed by the presence of the numpad. I've never used it; it just wastes desktop space! All I could find are (even more annoying) compact keyboards. Sadly those keyboards are so compact that cram the arrow keys and the page up/down keys in a very little space. So, does anyone know a keyboard with a normal layout but without the numpad?

    Read the article

  • Unaccounted for database size

    - by Nazadus
    I currently have a database that is 20GB in size. I've run a few scripts which show on each tables size (and other incredibly useful information such as index stuff) and the biggest table is 1.1 million records which takes up 150MB of data. We have less than 50 tables most of which take up less than 1MB of data. After looking at the size of each table I don't understand why the database shouldn't be 1GB in size after a shrink. The amount of available free space that SqlServer (2005) reports is 0%. The log mode is set to simple. At this point my main concern is I feel like I have 19GB of unaccounted for used space. Is there something else I should look at? Normally I wouldn't care and would make this a passive research project except this particular situation calls for us to do a backup and restore on a weekly basis to put a copy on a satellite (which has no internet, so it must be done manually). I'd much rather copy 1GB (or even if it were down to 5GB!) than 20GB of data each week. sp_spaceused reports the following: Navigator-Production 19184.56 MB 3.02 MB And the second part of it: 19640872 KB 19512112 KB 108184 KB 20576 KB while I've found a few other scripts (such as the one from two of the server database size questions here, they all report the same information either found above or below). The script I am using is from SqlTeam. Here is the header info: * BigTables.sql * Bill Graziano (SQLTeam.com) * graz@<email removed> * v1.11 The top few tables show this (table, rows, reserved space, data, index, unused, etc): Activity 1143639 131 MB 89 MB 41768 KB 1648 KB 46% 1% EventAttendance 883261 90 MB 58 MB 32264 KB 328 KB 54% 0% Person 113437 31 MB 15 MB 15752 KB 912 KB 103% 3% HouseholdMember 113443 12 MB 6 MB 5224 KB 432 KB 82% 4% PostalAddress 48870 8 MB 6 MB 2200 KB 280 KB 36% 3% The rest of the tables are either the same in size or smaller. No more than 50 tables. Update 1: - All tables use unique identifiers. Usually an int incremented by 1 per row. I've also re-indexed everything. I ran the dbcc shrink command as well as updating the usage before and after. And over and over. An interesting thing I found is that when I restarted the server and confirmed no one was using it (and no maintenance procs are running, this is a very new application -- under a week old) and when I went to run the shrink, every now and then it would say something about data changed. Googling yielded too few useful answers with the obvious not applying (it was 1am and I disconnected everyone, so it seems impossible that was really the case). The data was migrated via C# code which basically looked at another server and brought things over. The quantity of deletes, at this point in time, are probably under 50k in rows. Even if those rows were the biggest rows, that wouldn't be more than 100M I would imagine. When I go to shrink via the GUI it reports 0% available to shrink, indicating that I've already gotten it as small as it thinks it can go. Update 2: sp_spaceused 'Activity' yields this (which seems right on the money): Activity 1143639 134488 KB 91072 KB 41768 KB 1648 KB Fill factor was 90. All primary keys are ints. Here is the command I used to 'updateusage': DBCC UPDATEUSAGE(0); Update 3: Per Edosoft's request: Image 111975 2407773 19262184 It appears as though the image table believes it's the 19GB portion. I don't understand what this means though. Is it really 19GB or is it misrepresented? Update 4: Talking to a co-worker and I found out that it's because of the pages, as someone else here has also state the potential for that. The only index on the image table is a clustered PK. Is this something I can fix or do I just have to deal with it? The regular script shows the Image table to be 6MB in size. Update 5: I think I'm just going to have to deal with it after further research. The images have been resized to be roughly 2-5KB each and on a normal file system doesn't consume much space but on SqlServer it seems to consume considerably more. The real answer, in the long run, will likely be separating that table in to another partition or something similar.

    Read the article

  • Spacing differences between IE7 and Firefox/Opera/Chrome

    - by user306940
    I have an ongoing issue with the amount of vertical space of unordered lists in IE7 vs. Firefox/Chrome/Opera and I can't seem to find a solution out there. In IE7, the space is less and what I would like to see. In Firefox, Chrome, and Opera, the space between is about twice as much. I can't account for any of the spacing issues in my code or page. On my page, the code looks like this: <!--BEGIN SIDEBOX--> <div id="sidebox_new"> <div id="sidebox_top"><div id="sup">SUPPORT LINKS</div></div> <div id="sidebox_bod"> <br /> <ul> <li><a href="training.aspx">User Training</a></li><br /><br /> <li><a href="faqs.aspx">FAQ</a></li><br /><br /> <li><a href="logonasst.aspx">Logon Assist. Center</a></li><br /><br /> <li><a href="faxus.aspx">Fax Us</a></li><br /><br /> <li><a href="callus.aspx">Call Us</a></li><br /><br /> <li><a href="feedback.aspx">General Feedback</a></li> </ul> </div> <div id="sidebox_btm"></div> </div> <!--END SIDEBOX--> My CSS for this section looks like this: #sidebox_bod { width: 200px; margin: 0 30px 0 0; padding: 0; background: url('../img/supbxbod.gif'); background-repeat:repeat-y; background-position:bottom; } #sidebox_bod ul { list-style-image:url('../triangle.gif'); text-align:left; padding: 0 0 0 30px; margin: 0; } #sidebox_bod ul li a { font-size: 13px; } Any idea what I can do to try to have the vertical spacing the same across all browsers? I would prefer to have the IE7 look to try to fix this. Thanks.

    Read the article

  • Flash CS5 font is largest part of the SWF

    - by dev.e.loper
    I'm transferring a project from CS4 to CS5 and (without any changes) my SWF file gets to be 10 times bigger. It was 7kb and now it's 77kb. I generated a size report and it looks like the font is taking up most of the space. I haven't changed settings. I'm not sure why font is taking up so much space. Is there a way around this? Here is my size report: Font Name Bytes Characters ----------------- ---------- ---------- _sans 12 MilkyWell 317 .blsu Calibri-Bold Bold 75960 %.0123456789 As you can see Calibri-Bold is taking up 75kb and I only have 12 characters in it.

    Read the article

  • Oracle 10g - JAXB unmarshalling is not working as expected

    - by Santhosh Reddy Mandadi
    We're using Oracle 10g application server and deployed the Web service and trying to deploy the web service client. Server is working fine i.e.; marshalling is working fine. We're getting the output from the service properly but the search client is not unmarshalling (parsing) the response received. We're using all the tags under same name space so there is no name space problem. Different collections would exists in the XSD. Has anyone faced similar kind of issue? Is there any solution for this? Thanks Santhosh

    Read the article

  • How to change handedness of coordinates?

    - by 742
    How to convert from Euler's coordinates E1 = (x1, y1, z1, yaw1, pitch1, roll1) to E2 = (x2, y2, z2, yaw2, pitch2, roll2) where x, y, z are the coordinates of a point and yaw, pitch, roll the direction/orientation of a vector which origin is the point. yaw is around y, pitch around x, roll around z. They are performed in that order. Yaw 0 is normal to the plan xy (opposite to z in E1 and equal to z in E2). E1 uses a right handed space and E2 a left handed space. Both have the same origin, the same direction for y (top) and z (into the screen). They differ by x which is to the left on E1 and to the right on E2. They also differ by their direction of positive rotations. I've a custom type to hold the scalar representation and to convert from and to the equivalent WPF Matrix3d representation.

    Read the article

  • DrawString with character wrapping

    - by Roy
    Hi all, I'm creating a fatal error dialog for a Windows Mobile Application using C#. The problem is when I try to draw the stacktrace using DrawString, half of my stacktrace is getting clipped off because DrawString uses word wrapping instead of character wrapping. For those who don't understand the explanation: When i draw the stacktrace, it comes out as this: at company.application.name.space.Funct at company.application.name.Function(St at etc. etc. And i want it to print like this: at company.application.name.space.Funct ion(String sometext, Int32 somenumbe r) at company.application.name.Function(St ring sometext, Int32 somenumber, Int 32 anothernumber) at etc. etc. Is this possible in Csharp?

    Read the article

  • Bibtex with no references title

    - by Bryan Ward
    I am working on writing a scientific poster in LaTeX, and I want to include a few references for my work. Because this is a poster, I have my own customized headers for different sections, and don't want my related works to have a separate title. Essentially I have something like this: \begin{textblock}{5.5}(19.5,11) \CHead{Related Work} %a newcommand header I wrote \bibliographystyle{acm} \bibliography{mybib} \end{textblock} And it comes out with a header called "Related Work" like I want, but it also under that says "References", which I don't want. I found a few websites that said that I could override this with something like \renewcommand\refname{} But all this does is take the word "References" out, but the space allotted for the title is still there. Is there a way to completely eliminate the title and any space it may take up?

    Read the article

  • Strange error in SpringMVC Application Startup

    - by Euzel Villanueva
    I'm getting a very strange stack trace when trying to load a SpringMVC application and at a lost to why this is occurring. org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'org.springframework.web.servlet.mvc.annotation.AnnotationMethodHandlerAdapter#0': Cannot create inner bean '(inner bean)' of type [org.springframework.http.converter.xml.XmlAwareFormHttpMessageConverter] while setting bean property 'messageConverters' with key [4]; nested exception is org.springframework.beans.factory.BeanCreationException: Error creating bean with name '(inner bean)#6': Instantiation of bean failed; nested exception is org.springframework.beans.BeanInstantiationException: Could not instantiate bean class [org.springframework.http.converter.xml.XmlAwareFormHttpMessageConverter]: Constructor threw exception; nested exception is java.lang.OutOfMemoryError: Java heap space at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveInnerBean(BeanDefinitionValueResolver.java:281) at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveValueIfNecessary(BeanDefinitionValueResolver.java:125) at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveManagedList(BeanDefinitionValueResolver.java:353) at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveValueIfNecessary(BeanDefinitionValueResolver.java:153) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.applyPropertyValues(AbstractAutowireCapableBeanFactory.java:1325) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.populateBean(AbstractAutowireCapableBeanFactory.java:1086) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:517) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:456) at org.springframework.beans.factory.support.AbstractBeanFactory$1.getObject(AbstractBeanFactory.java:291) at org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:222) at org.springframework.beans.factory.support.AbstractBeanFactory.doGetBean(AbstractBeanFactory.java:288) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:190) at org.springframework.beans.factory.support.DefaultListableBeanFactory.preInstantiateSingletons(DefaultListableBeanFactory.java:580) at org.springframework.context.support.AbstractApplicationContext.finishBeanFactoryInitialization(AbstractApplicationContext.java:895) at org.springframework.context.support.AbstractApplicationContext.refresh(AbstractApplicationContext.java:425) at org.springframework.web.servlet.FrameworkServlet.createWebApplicationContext(FrameworkServlet.java:442) at org.springframework.web.servlet.FrameworkServlet.createWebApplicationContext(FrameworkServlet.java:458) at org.springframework.web.servlet.FrameworkServlet.initWebApplicationContext(FrameworkServlet.java:339) at org.springframework.web.servlet.FrameworkServlet.initServletBean(FrameworkServlet.java:306) at org.springframework.web.servlet.HttpServletBean.init(HttpServletBean.java:127) at javax.servlet.GenericServlet.init(GenericServlet.java:160) at org.apache.catalina.core.StandardWrapper.initServlet(StandardWrapper.java:1133) at org.apache.catalina.core.StandardWrapper.loadServlet(StandardWrapper.java:1087) at org.apache.catalina.core.StandardWrapper.load(StandardWrapper.java:996) at org.apache.catalina.core.StandardContext.loadOnStartup(StandardContext.java:4834) at org.apache.catalina.core.StandardContext$3.call(StandardContext.java:5155) at org.apache.catalina.core.StandardContext$3.call(StandardContext.java:5150) at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:303) at java.util.concurrent.FutureTask.run(FutureTask.java:138) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:619) Caused by: org.springframework.beans.factory.BeanCreationException: Error creating bean with name '(inner bean)#6': Instantiation of bean failed; nested exception is org.springframework.beans.BeanInstantiationException: Could not instantiate bean class [org.springframework.http.converter.xml.XmlAwareFormHttpMessageConverter]: Constructor threw exception; nested exception is java.lang.OutOfMemoryError: Java heap space at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.instantiateBean(AbstractAutowireCapableBeanFactory.java:965) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBeanInstance(AbstractAutowireCapableBeanFactory.java:911) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:485) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:456) at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveInnerBean(BeanDefinitionValueResolver.java:270) ... 31 more Caused by: org.springframework.beans.BeanInstantiationException: Could not instantiate bean class [org.springframework.http.converter.xml.XmlAwareFormHttpMessageConverter]: Constructor threw exception; nested exception is java.lang.OutOfMemoryError: Java heap space at org.springframework.beans.BeanUtils.instantiateClass(BeanUtils.java:141) at org.springframework.beans.factory.support.SimpleInstantiationStrategy.instantiate(SimpleInstantiationStrategy.java:74) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.instantiateBean(AbstractAutowireCapableBeanFactory.java:958) ... 35 more

    Read the article

  • Sync GIT and ClearCase

    - by Senthil A Kumar
    I am currently working on ClearCase and now migrating to GIT. But we need this migration in a way that all work will be done in GIT and the data will be synced backed to ClearCase stream. We will have the same branch names and stream names in both GIT and CC, so scripting shouldn't be a problem. The problem here is, Can someone suggest which is the best model to sync CC and GIT Have all the Vobs in CC as single repo in GIT, and have the major stream in CC as various branches in GIT. - Single GIT repo (VOBS) and many branches (CC streams). - This takes up less space as VOBs are kept as single repo with many branches. Have important CC branches as independent GIT repositories and each repository having all the CC VOBs. - Many GIT repo for many CC branch - This will take up lots of space as VOBs will be replicated across. Which do you think is the best way to keep it in sync with ClearCase

    Read the article

  • Regex-expression with danish characters

    - by timkl
    I'm currently trying to wrap my head around regex, I have a validation snippet that tests an input box against a regex-expression: $.validator.addMethod("customerName", function(value, element){ return (/^[a-zA-Z]*$/).test(value); }, "Some text"); That works well, but when I try to add a space and some special danish characters, it doesn't filter the danish characters, only the space. $.validator.addMethod("customerName", function(value, element){ return (/^[a-zA-Z æøåÆØÅ]*$/).test(value); }, "Some text"); Any ideas to what could be wrong?

    Read the article

  • Pros and cons of ways of storing an unsigned int without an unsigned int data type

    - by fields
    I have values that are 64-bit unsigned ints, and I need to store them in mongodb, which has no unsigned int type. I see three main possibilities for storing them in other field types, and converting on going in and out: Using a signed int is probably easiest and most space efficient, but has the disadvantage that they're not human readable and if someone forgets to do the conversion, some of them will work, which may obscure errors. Raw binary is probably most difficult for inexperienced programmers to deal with, and also suffers from non-human-readability. A string representation is the least space efficient (~40 bytes in unicode vs 8 bytes per field), but then at least all of the possible values will map properly, and for querying only a conversion to string is required instead of a more complicated conversion. I need these values to be available from different platforms, so a single driver-specific solution isn't an option. Any major pros and cons I've missed? Which one would you use?

    Read the article

  • Doubts in System call mechanism in linux

    - by bala1486
    We transit from ring3 to ring0 using 'int' or the new 'syscall/sysenter' instruction. Does that mean that the page tables and other stuffs that needs to be modified for the kernel is automatically done by the 'int' instruction or the interrupt handler for the 'int 0x80' will do the required stuff and jump to the respective system call. Also when returning from a system call, we again need to go to user space. For this we need to know the instruction address in the user space to continue the user application. Where is that address stored. Does the 'ret' instruction automatically changes the ring from ring3 to ring0 or where/how this ring changing mechanism takes place? Then, i read that changing from ring3 to ring0 is not as costly as changing from ring0 to ring3. Why is this so?? Thanks, Bala

    Read the article

  • Enabling full documentation for J2EE in eclipse

    - by maayank
    I'm new to Eclipse and am using it currently to play with J2EE. When using Ctrl+Space for types/functions from the regular Java libraries I get a full description (i.e. general description of the type, what are the arguments of the method for, etc.). However I don't get the same for J2EE types. For example, when using Ctrl+Space on methods of the HttpSession class I get only names like "arg0" or "obj" and no description. Is there some kind of a package I can install to remedy this?

    Read the article

  • ffmpeg screen capture

    - by Mirai
    I wrote this script for some basic screen capture; it gets the window dimensions then uses the ffmpeg binary to record. I suspect there is a better way (maybe with the ffmpeg library), but scripting is what I know and ffmpeg generally works. Any software (other than recordmydesktop), or improvements to the script are welcome. info=`xwininfo -frame` H=`echo "$info" | grep Height | sed -E "s/^.*: ([[:digit:]]+)$/\1/"` W=`echo "$info" | grep Width | sed -E "s/^.*: ([[:digit:]]+)$/\1/"` offset=:0.0+`echo "$info" | grep Corners | sed -E "s/^.*:[[:space:]]+\+([[:digit:]]+\+[[:digit:]]+)[[:space:]]+.+/\1/" | tr + ,` /usr/local/bin/ffmpeg -f x11grab -s ${W}x${H} -r 45 -i $offset -sameq -f avi ~/videos/`date +%Y-%m-%d-%H%M%s`_vid & echo $! > /tmp/$(basename $0)-$USER

    Read the article

  • Oracle Hash Cluster Overflow Blocks

    - by Andrew
    When inserting a large number of rows into a single table hash cluster in Oracle, it will fill up the block with any values that hash to that hash-value and then start using overflow blocks. These overflow blocks are listed as chained off the main block, but I can not find detailed information on the way in which they are allocated or chained. When an overflow block is allocated for a hash value, is that block exclusively allocated to that hash value, or are the overflow blocks used as a pool and different hash values can then start using the same overflow block. How is the free space of the chain monitored - in that, as data is continued to be inserted, does it have to traverse the entire chain to find out if it has some free space in the current overflow chain, and then if it finds none, it then chooses to allocate a new block?

    Read the article

  • parsing string off a configuration using strtok in C

    - by Jessica
    in the configuration file i have entries similar to this one: filepath = c:\Program Files\some value Where the path can contain spaces and there are no quotes on that string. I tried parsing this with strtok like: char *option; char *value; value = strtok(line, " ="); strcpy(option, value); value = strtok(NULL, " ="); where line is the line I am reading from the file, option will contain the left side of the equal (filepath) and value will contain the right side (c:\program files\some value). I know, it's poor coding, but I haven't found something better. sorry... In any case, for those options where there's no space in the right side it works great, but in those containing spaces it only return the string until the 1st space: c:\Program. Is there any other way to do this? Code is appreciated. Jessica

    Read the article

  • How to sort in-place using the merge sort algorithm?

    - by eSKay
    I know the question is too open. All I want is someone to tell me how to convert a normal merge sort into an in-place merge sort (or a merge sort with constant extra space overhead). All I can find (on the net) is pages saying "it is too complex" or "out of scope of this text". "The only known ways to merge in-place (without any extra space) are too complex to be reduced to practical program." (from here) Even if it is too complex, can somebody outline the basic concept of how to make the merge sort in-place?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • What Regex can strip e.g. "note:" and "firstName: " from the left of a string?

    - by Edward Tanguay
    I need to strip the "label" off the front of strings, e.g. note: this is a note needs to return: note and this is a note I've produced the following code example but am having trouble with the regexes. What code do I need in the two ???????? areas below so that I get the desired results shown in the comments? using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Text.RegularExpressions; namespace TestRegex8822 { class Program { static void Main(string[] args) { List<string> lines = new List<string>(); lines.Add("note: this is a note"); lines.Add("test: just a test"); lines.Add("test:\t\t\tjust a test"); lines.Add("firstName: Jim"); //"firstName" IS a label because it does NOT contain a space lines.Add("She said this to him: follow me."); //this is NOT a label since there is a space before the colon lines.Add("description: this is the first description"); lines.Add("description:this is the second description"); //no space after colon lines.Add("this is a line with no label"); foreach (var line in lines) { Console.WriteLine(StringHelpers.GetLabelFromLine(line)); Console.WriteLine(StringHelpers.StripLabelFromLine(line)); Console.WriteLine("--"); //note //this is a note //-- //test //just a test //-- //test //just a test //-- //firstName //Jim //-- // //She said this to him: follow me. //-- //description //this is the first description //-- //description //this is the first description //-- // //this is a line with no label //-- } Console.ReadLine(); } } public static class StringHelpers { public static string GetLabelFromLine(this string line) { string label = line.GetMatch(@"^?:(\s)"); //??????????????? if (!label.IsNullOrEmpty()) return label; else return ""; } public static string StripLabelFromLine(this string line) { return ...//??????????????? } public static bool IsNullOrEmpty(this string line) { return String.IsNullOrEmpty(line); } } public static class RegexHelpers { public static string GetMatch(this string text, string regex) { Match match = Regex.Match(text, regex); if (match.Success) { string theMatch = match.Groups[0].Value; return theMatch; } else { return null; } } } }

    Read the article

  • Fixed footer with 960.gs

    - by Oguz
    I want to create fixed footer but , is it possible with 960 gs , because I am having trouble with height of container div . I can no set it to %100. <div class="container_12" > <div class="grid_3" id="side-space"></div> <div class="grid_6"> <div id="content-box"></div> </div> <div class="grid_3" id="side-space"></div> </div>

    Read the article

< Previous Page | 84 85 86 87 88 89 90 91 92 93 94 95  | Next Page >