Search Results

Search found 1058 results on 43 pages for 'pradeep kumar'.

Page 9/43 | < Previous Page | 5 6 7 8 9 10 11 12 13 14 15 16  | Next Page >

  • how 2 use logmath twice in same form(sphinx4)

    - by Pradeep
    i have configured sphinx with netbeans and its wroking fine. but im using a button to do the process. but after it recognisers. i want to do the process again. but then it gives a error saying the "logmath instance is already present" and saying cannot open the microphone. can someone give me a solution. what i want to do is use speech recogntion in several times in the same form. till it gives the correct answer. please help me this is the error i get "Creating new instance of LogMath while another instance is already present 10:53:27.833 SEVERE microphone Can't open microphone line with format PCM_SIGNED 16000.0 Hz, 16 bit, mono, 2 bytes/frame, big-endian not supported."

    Read the article

  • 2 javascripts problem

    - by pradeep
    <?php global $user; $userId = $user->uid; /* start with default */ $myresult = ""; /* All Includes - start */ include_once('db.php'); include_once('valid-scripts/validateData.php'); /* All Includes - end */ /* Build All required Variables - start */ $alias = $_GET['alias']; $product = $_GET['product']; $product = strtolower(substr($product,0,-1)); $master_table = $product.'_master'; $rating_master_table = $product.'_rating_master'; $rating_table = $product.'_rating'; $numProperties = 15; /* Build All required Variables - end */ /* Add all Styles required - start */ $myresult .= '<link href="/jquery.rating.css" type="text/css" rel="stylesheet"/>'; /* Add all Styles required - end */ /* Show Hide Variables/parameters - start */ include_once('all_include_files/show_hide.php'); /* Show Hide Variables/parameters - end */ /* All Javascript - start */ //$myresult .= '<script src="/jquery.rating.js" type="text/javascript" language="javascript"></script>'; ?> <style> #tabs { //font-size: 90%; //margin: 20px 0; margin: 2px 0; } #tabs ul { float: right; background: #E3FEFA; width: 600px; //padding-top: 4px; } #tabs li { margin-left: 8px; list-style: none; } * html #tabs li { display: inline; /* ie6 double float margin bug */ } #tabs li, #tabs li a { float: left; } #tabs ul li a { text-decoration: none; //padding: 8px; color: #0073BF; font-weight: bold; } #tabs ul li.active { background: #CEE1EF url(/all_include_files/img/nav-right.gif) no-repeat right top; } #tabs ul li.active a { background: url(/all_include_files/img/nav-left.gif) no-repeat left top; color: #333333; } #tabs div { //background: #CEE1EF; clear: both; //padding: 20px; min-height: 200px; } #tabs div h3 { text-transform: uppercase; margin-bottom: 10px; letter-spacing: 1px; #tabs div p { line-height: 150%; } </style> <script src="/jquery.rating.js" type="text/javascript" language="javascript"></script> <script src="/jquery.metadata.js" type="text/javascript" language="javascript"></script> <script type='text/javascript'> function openComment(number) { alert('working'); $('#comment'+number).css('display',''); } $('.star').rating({ callback: function(value, link){ alert(value); } }); $(document).ready(function() { //$('#tabs div').hide(); //$('#tabs div:first').show(); $('#tabs ul li:first').addClass('active'); $('#tabs ul li a').click(function() { $('#tabs ul li').removeClass('active'); $(this).parent().addClass('active'); var currentTab = $(this).attr('href'); $('#tabs div').hide(); $(currentTab).show(); return false; }); $("#clickit").click(function() { $.post("/mobile/tablechange.php",{ p1:'<?php echo $brand ?>',p2:'<?php echo $model ?>',userid:'<?php echo $userid ?>' } ,function(data){ $("#changetable").html(data); }); }); $('div.expandable p').expander({ slicePoint: 200, // default is 100 expandText: 'more &raquo;', // default is 'read more...' collapseTimer: 0, // re-collapses after 5 seconds; default is 0, so no re-collapsing userCollapseText: '[^]' // default is '[collapse expanded text]' }); }); </script> <?php /* All Javascript - end */ /* Form Processing after submit - start */ /* Form Processing after submit - end */ /* Actual Form or Page - start */ /*fetch all data needed */ /* initial query */ $result_product = query_product_table($product,$alias); /*fetch property names of product */ $product_properties = master_table($master_table); /*rating table query */ $master_rating_properties = master_rating_table($rating_master_table); /*get user ratings*/ $user_ratings = user_ratings($userId,$alias,$rating_table); $myresult .= '<div class=\'Services\'>'; //$myresult .="<form name ='form1' id='form1' method = 'POST' action='".$_SERVER['php_self'] ."'>"; if(!$result_product) { header('Location: /page-not-found'); } else { $row_product = mysql_fetch_array($result_product); $myresult .= "<h3 class='newstyle'>".$row_product['alias']." <a style='float:right;padding-right:20px;color:white;text-decoration:underline;' href='/'>Back</a> </h3>"; /* start actual product display - start*/ $myresult .= "<div class=\"product\">"; /* start table 1*/ $myresult .= '<table border=\'0\' cellspacing=\'0\' cellpadding=\'0\' style=\'width:580px; table-layout:fixed;\'>'; $myresult .= '<tr>'; $myresult .='<td valign=\'top\'>'; /* start table 2*/ $myresult .='<table width=\'100%\' border=\'0\' cellspacing=\'0\' cellpadding=\'0\'>'; $myresult .= '<tr>'; $myresult .= '<td valign=\'top\' style=\'width:164px;\'>'; /* start table 3*/ $myresult .= '<table style=\'width:164px;\' border=\'0\' cellspacing=\'0\' cellpadding=\'0\'>'; $myresult .= "<tr>"; /* start of the pic row */ $myresult .= '<td align=\'center\' class=\'various_product\'>'; if($row_product['pic'] != "") { $myresult .= '<ul id=\'mycarousel\' style=\'display:\';>'; $myresult .= '<li><a href=\'/all_image_scripts/origpicdisplay.php?product='.rawurlencode($product).'&alias='.rawurlencode($alias).'&picid=pic&p= \'rel=\'lightbox[roadtrip]\'><img src=\'/all_image_scripts/picdisplay1.php?product='.rawurlencode($product).'&alias='.rawurlencode($alias).'\'></img></a></li>'; for($p = 1; $p <= 4; $p++) { if($row_product['pic'.$p] != "") { $myresult .= '<li><a href=\'/all_image_scripts/origpicdisplay.php?product='.rawurlencode($product).'&alias='.rawurlencode($alias).'&picid=pic'.rawurlencode($p).'&p='.rawurlencode($p).'\' rel=\'lightbox[roadtrip]\'><img src=\'/all_image_scripts/thumbpicdisplay.php?product='.rawurlencode($product).'&alias='.rawurlencode($alias).'&picid=pic'.rawurlencode($p).'\'></img></a></li>'; } } $myresult .= '</ul>'; } else { $myresult .= "<img width='50' height='70' src='/images/no-image.gif'></img>"; } jcarousel_add('#mycarousel', array('horizontal' => TRUE,'scroll' => 1,'visible' => 1)); $myresult .= "</td>"; /* end display of pic td*/ $myresult .= "</tr>"; /* end display of pic tr*/ $myresult .= "</table></td>"; /* end display of pic table and earlier td - Still 1 open TR td table tr -hint*/ $myresult .= '<td style=\'width:450px;\'>'; /*table - 4*/ $myresult .= '<table width=\'100%\' border=\'0\' cellspacing=\'0\' cellpadding=\'0\' style=\'display:block;\'>'; /* Start showing property and values */ $myresult .= '<tr>'; $myresult .= '<td class=\'tick\'><img src=\'/images/ul_li_bg.gif\' width=\'12\' height=\'12\' /></td>'; $myresult .= '<td class=\'leftText\'>'.ucfirst($product).':</td>'; $myresult .= '<td class=\'rightText\'>'.$row_product['alias'] .'</td>'; $myresult .= "</tr>"; for($j = 3; $j <= 5 ; $j++){ if($product_properties['property'.$j.'_name'] != "") { if($row_product['property'.$j] != "") { $myresult .= '<tr>'; $myresult .= '<td class=\'tick\'><img src=\'/images/ul_li_bg.gif\' width=\'12\' height=\'12\' /></td>'; $myresult .= '<td class=\'leftText\'>'.$product_properties['property'.$j.'_name'].':</td>'; $myresult .= '<td class=\'rightText\'>'.$row_product['property'.$j] .'</td>'; $myresult .= '</tr>'; } /* end if*/ } /* end if*/ } /* end for*/ /* show hide block */ $myresult .= '<tbody id=\'extra_properties\' style=\'display: none;\'>'; for($j = 6; $j <= 15 ; $j++){ if($product_properties['property'.$j.'_name'] != "") { if($row_product['property'.$j] != "") { $myresult .= '<tr>'; $myresult .= '<td class=\'tick\'><img src=\'/images/ul_li_bg.gif\' width=\'12\' height=\'12\' /></td>'; $myresult .= '<td class=\'leftText\'>'.$produtc_properties['property'.$j.'_name'].':</td>'; $myresult .= '<td class=\'rightText\'>'.$row_product['property'.$j] .'</td>'; $myresult .= '</tr>'; } /* end if*/ } /* end if*/ } /* end for */ $myresult .= '</tbody>'; /* end show/hide tbody */ $myresult .= '<tr>'; $myresult .= '<td>'; $myresult .= '&nbsp;'; $myresult .= '</td>'; $myresult .= '<td>'; $myresult .= '&nbsp;'; $myresult .= '</td>'; $myresult .= '<td align=\'right\' style=\'text-align:right;text-decoration:underline;\'>'; $myresult .= '<a class=\'right_link\' href=\'javascript:showMore()\'>Show Additional Details...</a>'; $myresult .= '</td>'; $myresult .= '</tr>'; /* End showing property and values */ $showreview = 'display:'; /* review show hide */ /*$myresult .= '<tbody '.$showreview.'>'; $myresult .= '<tr>'; $myresult .= '<td colspan=\'2\'><span class=\'reviews\'>'; //check //$numreviews = getreviewcount($brand,$model,'mobile_user_reviews'); if($numreviews > 0) { $myresult .= '<a href=\'mobilereviews?alias='.rawurlencode($alias).'\'> <span>$numreviews Reviews</span></a>'; } else { $myresult .= " $numreviews Reviews"; } $myresult .= "</span></td>"; $myresult .= "</tr>"; */ $myresult .= "</tbody>"; /* review show hide - end */ /* count show hide */ $myresult .= '<tbody '.$showcount.'>'; $myresult .= '<tr>'; $myresult .= '<td colspan=\'2\'><span class=\'reviews\'>'; //check //$totalvotes = gettotalvotes($row['property1'],$row['property2'],'mobile_rating'); $myresult .= "</td>"; $myresult .= "</tr>"; $myresult .= "</tbody>"; /* count show hide - end */ $myresult .= "</table></td>"; /* end table 4 */ $myresult .= '</tr>'; /* end 1 row and remaining tr , td ,table */ $myresult .= '</table></td>'; $myresult .= '</tr>'; /* remianing only 1 table */ /* ratings - positive last section starts here */ $max= array(); for ($l = 1 ; $l < 15; $l++){ if($row_product['property'.$l.'_avg']){ $maxarray = 0; $maxarray = $row_product['property'.$l.'_avg']; $max['rating'.$l.'_name'] = $maxarray; } } if(count($max) >0 ) { include('all_include_files/min_max_properties.php'); } if(($row_product['freshness'] <= strtotime("-3 month"))) { $image_type= 'old'; } else if(($row_product['freshness'] <= strtotime("-2 month"))) { $image_type= 'bitold'; } else if(($row_product['freshness'] <= strtotime("-1 month")) || ($row_product['freshness'] > strtotime("-1 month"))) { $image_type= 'new'; } $img_name = $image_type; $myresult .= "<tr>"; $myresult .= "<td>"; $myresult .= "<table width='100%' border='0'>"; $myresult .= "<tr>"; $myresult .= "<td width='170' class=\"ratingz\"><span><u>Overall rating</u></span></td>"; $myresult .= "<td width='150' class=\"ratingz\"><span><u>Positive</u></span></td>"; $myresult .= "<td width='150' class=\"ratingz\"><span><u>Negative</u></span></td>"; if($img_name == 'new'){ $images = "<img src='/sites/default/files/battery-discharging-100.png' width='40' height='40'></img>"; } else if($img_name == 'bitold'){ $images = "<img src='/sites/default/files/battery-discharging-80.png' width='40' height='40'></img>"; } else if($img_name == 'old'){ $images = "<img src='/sites/default/files/battery-discharging-0.png' width='40' height='40'></img>"; } else { $images = ""; } $myresult .= "<td rowspan='2'><p ".$showbattery.">". $images ."</p></td>"; $myresult .= "</tr>"; $myresult .= "<tr>"; $myresult .= "<td>"; $i++; for($k = 0.5; $k <= 10.0; $k+=0.5) { $overall = roundOff($row_product['overall_rating']); if($overall == $k) { $chk ="checked"; } else { $chk = ""; } $myresult .= '<input class=\'star {split:2}\' type=\'radio\' value=\''. $k .'\' '.$chk.' title=\''. $k.' out of 10 \' disabled />'; } $myresult .= '</td>'; $myresult .= '<td ><span>'.$positive.'</span></td>'; $myresult .= '<td ><span>'.$negative.'</span></td>'; $myresult .= '</tr>'; $myresult .= '</table></td>'; $myresult .= '</tr>'; /* ratings - positive last section ends here */ $myresult .= '<tr>'; if($row_product['description'] != ""){ if(words_count($row_product['description']) > 8){ $myresult .= '<td><p><span class=\'description\'><strong><u>Description</u>:</strong></span>&nbsp;&nbsp; <div class=\'expandable\'><p>'.$row_product['description'].'</div></p></p></td>'; } else { $myresult .= '<td><p><span class=\'description\'><strong><u>Description</u>:</strong></span>&nbsp;&nbsp;'. $row_product['description'] .'</p></td>'; } } $myresult .= '</tr>'; $myresult .= '</table>'; /* end 1st table */ $myresult .= '</div>'; /* start actual product display - end*/ /*start the form to take ratings */ $myresult .= '<div id=\'tabs\'>'; $myresult .= '<ul>'; $myresult .= '<li><a href=\'#tab-1\'>Ratings</a></li>'; $myresult .= '<li><a href=\'#tab-2\'>Click here to rate</a></li>'; $myresult .= '</ul>'; $myresult .= '<div id=\'tab-1\'>'; /* actual rating table - start - jsut display ratings */ $myresult .= '<table id=\'rounded-corner\'>'; /* thead - start */ $myresult .= '<thead>'; $myresult .= '<tr>'; $myresult .= '<th width=\'30%\' class=\'rounded-company\' scope=\'col\'><span style=\'font: normal 18px Arial, Helvetica, sans-serif; color:#FFF;\'>Ratings</span></th>'; $myresult .= '<th width=\'70%\' colspan=\'2\'class=\'rounded-q4\' scope=\'col\'><a href=\'#rounded-corner\' id=\'clickit\' style=\'color:white;text-decoration:underline;\' $disabled ></a></th> '; /*$myresult .= '<th width=\'70%\' colspan=\'2\'class=\'rounded-q4\' scope=\'col\'><a href=\'#rounded-corner\' id=\'clickit\' style=\'color:white;text-decoration:underline;\' $disabled >Click here to rate</a></th> ';*/ $myresult .= '</tr>'; $myresult .= '</thead>'; /* thead - end */ /* tbody - start */ $myresult .= '<tbody>'; /*start printing the table wth feature and ratings */ for ($i = 1 ; $i < $numProperties; $i++){ if($master_rating_properties['rating'.$i.'_name']){ $myresult .= '<tr>'; $myresult .= '<td width=\'22%\'>'; $indfeature = 0; $indfeature = $row_product['property'.$i.'_avg']; $myresult .= $master_rating_properties['rating'.$i.'_name'].' ( '.$indfeature .')'; $myresult .= '</td>'; $myresult .= '<td colspan=\'0\' width=\'38%\' >'; $tocheck = $indfeature; for($k = 0.5; $k <= 10.0; $k+=0.5){ $tocheck = roundOff($tocheck); if(($tocheck) == $k) { $chk = "checked"; } else { $chk = ""; } $myresult .= '<input class=\'star {split:2}\' type=\'radio\' name=\'drating'.$i.'\' id=\'drating'.$i.''.$k.'\' value=\''. $k .'\' '.$chk.' title=\''. $k.' out of 10 \' disabled \'/>'; } /* for k loop end */ $myresult .= '</tr>'; } /* end if loop */ } /* end i for loop */ $myresult .= '</tbody>'; /* end tbody */ /* footer round corner start */ $myresult .= '<tfoot>'; $myresult .= '<tr>'; $myresult .= '<td class=\'rounded-foot-left\'>&nbsp;</td>'; $myresult .= '<td class=\'rounded-foot-right\' colspan=\'4\' >'; $myresult .= '</td>'; $myresult .= '</tr>'; $myresult .= '</tfoot>'; $myresult .= '</table>'; /*round corner table end */ $myresult .= '</div>'; /*end 1st tab */ /*start 2nd tab */ $myresult .= '<div id=\'tab-2\'>'; $myresult .= '<form name =\'form1\' id=\'form1\' method = \'POST\' action=\''.$_SERVER['php_self'] .'\'>'; /* actual rating table - start - actual rate/update */ $myresult .= '<table id=\'rounded-corner\'>'; /* thead - start */ $myresult .= '<thead>'; $myresult .= '<tr>'; $myresult .= '<th width=\'30%\' class=\'rounded-company\' scope=\'col\'><span style=\'font: normal 18px Arial, Helvetica, sans-serif; color:#FFF;\'>Ratings</span></th>'; $myresult .= '<th width=\'70%\' colspan=\'2\'class=\'rounded-q4\' scope=\'col\'></th>'; $myresult .= '</tr>'; $myresult .= '</thead>'; /* thead - end */ /* tbody - start */ $myresult .= '<tbody>'; unset($i); /*start printing the table wth feature and ratings */ for ($i = 1 ; $i < $numProperties; $i++){ if($master_rating_properties['rating'.$i.'_name']){ $myresult .= '<tr>'; /*fetch ratings and comments - 1st make it to null */ $indfeature = 0; $comment = ''; $indfeature = $user_ratings['rating'.$i]; if($indfeature == NULL){ $indfeature = 0; } $comment = $user_ratings['rating'.$i.'_comment']; $myresult .= '<td width=\'22%\'>'; $myresult .= $master_rating_properties['rating'.$i.'_name'].' ( '.$indfeature.' )'; $myresult .= '</td>'; $myresult .= '<td colspan=\'0\' width=\'38%\' >'; if(($userId != '0') && (is_array($user_ratings))) { $tocheck = $indfeature; } else { $tocheck = '0'; } for($k = 0.5; $k <= 10.0; $k+=0.5){ $tocheck = roundOff($tocheck); if(($tocheck) == $k) { $chk = "checked"; } else { $chk = ""; } $myresult .= '<input class=\'star {split:2}\' type=\'radio\' name=\'rating'.$i.'\' id=\'rating'.$i.''.$k.'\' value=\''. $k .'\' '.$chk.' title=\''. $k.' out of 10 \' '.$disabled.' \' />'; } /* for k loop end */ $myresult .= '</td>'; $myresult .= '<td width=\'40%\'>'; $myresult .= '<input title=\'Reason for this Rating.. \'type=\'text\' size=\'25\' name=\'comment'.$i.'\' id=\'comment'.$i.'\' style=\'display:;\' maxlength=\'255\' value="'.$comment.'">'; $myresult .= '</td>'; $myresult .= '</tr>'; } /* end if loop */ } /* end i for loop */ $myresult .= '</tbody>'; /* end tbody */ /* footer round corner start */ $myresult .= '<tfoot>'; $myresult .= '<tr>'; $myresult .= '<td class=\'rounded-foot-left\'>&nbsp;</td>'; $myresult .= '<td class=\'rounded-foot-right\' colspan=\'4\' >'; if(($userId != '0') && (is_array($user_ratings))) { $myresult .= '<input type=\'button\' id=\'update_form\' value=\'Update\'>'; } else { $myresult .= '<input type=\'button\' id=\'save_form\' value=\'Save\'>'; } $myresult .= '</td>'; $myresult .= '</tr>'; $myresult .= '</tfoot>'; $myresult .= '</table>'; /*round corner table end */ $myresult .= '</form>'; /*end the form to take ratings */ $myresult .= '</div>'; /*end 2nd tab */ $myresult .= '</div>'; /*end tabs div */ /* actual rating table - end */ /* 1st form ends here id- ratings_form */ } /* end of if loop result_product loop */ /* start table 3 - overall comment*/ $myresult .= '<table border=\'0\' cellspacing=\'0\' cellpadding=\'0\' style=\'width:580px; table-layout:fixed;\' id=\'rounded-corner\'>'; $myresult .= '<tbody>'; /* thead - start */ $myresult .= '<thead>'; $myresult .= '<tr>'; $myresult .= '<th width=\'100%\' colspan=\'2\' class=\'rounded-company\' scope=\'col\'><span style=\'font: normal 18px Arial, Helvetica, sans-serif; color:#FFF;\'>Overall Comments</span></th>'; $myresult .= '<th colspan=\'3\' class=\'rounded-q4\' scope=\'col\'></th>'; $myresult .= '</tr>'; $myresult .= '</thead>'; /* thead - end */ $myresult .= '<tr>'; $myresult .= '<td colspan=\'4\'>'; $myresult .= '<textarea title=\'OverAll Comment\' name=\'overall_comment\' cols=\'65\'></textarea>'; $myresult .= '</td>'; $myresult .= '</tr>'; $myresult .= '<tbody>'; $myresult .= '</table>'; /* end table 3 - overall comment*/ /* start table 4 - summary*/ $myresult .= '<table border=\'0\' cellspacing=\'0\' cellpadding=\'0\' style=\'width:580px; table-layout:fixed;\' id=\'rounded-corner\'>'; $myresult .= '<tbody>'; /* thead - start */ $myresult .= '<thead>'; $myresult .= '<tr>'; $myresult .= '<th colspan=\'2\' class=\'rounded-company\' scope=\'col\'><span style=\'font: normal 18px Arial, Helvetica, sans-serif; color:#FFF;\'>Your Opinion</span></th>'; $myresult .= '<th colspan=\'2\'class=\'rounded-q4\' scope=\'col\'></th>'; $myresult .= '</tr>'; $myresult .= '</thead>'; /* thead - end */ $myresult .= '<tr>'; $myresult .= '<td colspan=\'2\'>'; $myresult .= 'Do you Agree with the Ratings'; $myresult .= '</td>'; $myresult .= '<td colspan=\'2\'>'; $myresult .= 'Was the Information Helpful'; $myresult .= '</td>'; $myresult .= '</tr>'; $myresult .= '<tr>'; $myresult .= '<form name=\'form2\' id=\'form2\' method=\'post\'>'; $myresult .= '<td>'; $myresult .= '<input type=\'button\' class=\'agree\' value=\'agree\'>'; $myresult .= '</td>'; $myresult .= '<td>'; $myresult .= '<input type=\'button\' class=\'disagree\' value=\'disagree\'>'; $myresult .= '</td>'; $myresult .= '<input type=\'hidden\' name=\'agree_disagree\' id=\'agree_disagree\'>'; $myresult .= '</form>'; $myresult .= '<form name=\'form3\' id=\'form3\' method=\'post\'>'; $myresult .= '<td>'; $myresult .= '<input type=\'button\' class=\'helpful\' value=\'Helpful\'>'; $myresult .= '</td>'; $myresult .= '<td>'; $myresult .= '<input type=\'button\' class=\'nothelpful\' value=\'Not Helpful\'>'; $myresult .= '</td>'; $myresult .= '<input type=\'hidden\' name=\'help_nohelp\' id=\'help_nohelp\'>'; $myresult .= '</form>'; $myresult .= '</tr>'; $myresult .= '</tbody>'; $myresult .= '</table>'; /*end table 4 summary table */ $myresult .= '</div>'; /* Actual Form or Page - end */ echo $myresult; //echo 'Product: '.$product; //echo '<br/>Alias: '.$alias; ?> hey this code is working fine for me . as required. the star class code is taken from http://www.fyneworks.com/jquery/star-rating/ ... it works well.. but when i insert code to add tabs for content ,the starts is not visible at all. but when i check source code. the stars are actually there . dono whats the prob. any suggestions on this this is the tabs code $('#tabs div').hide(); ('#tabs div:first').show(); $('#tabs ul li:first').addClass('active'); $('#tabs ul li a').click(function() { $('#tabs ul li').removeClass('active'); $(this).parent().addClass('active'); var currentTab = $(this).attr('href'); $('#tabs div').hide(); $(currentTab).show(); return false; });

    Read the article

  • Sorting manually generated index using perl script

    - by Pradeep Singh
    \item Bernoulli measure, 14 \item cellular automata \subitem Soft, 3, 28 \subitem balance theorem, 23, 45 \item tiles \subitem tiling problem, 19, 58 \subitem aperiodic tile set, 18, 45 \item Garden-of-Eden -theorem, 12 \item Bernoulli measure, 15, 16, 35 \item cellular automata \subitem balance theorem, 9, 11, 14 \subitem blocking word, 22, 32 \item Garden-of-Eden -theorem, 32 I have to sort the above index alphabetically using a perl script. Duplicate item or subitem entries should be merged and their numbers should be sorted. The subitems also should be sorted under respective item and their numbers should be also sorted. If same item is repeated in more than one place with subitems all the subitems should be merged under a single item and also subitems should be sorted

    Read the article

  • error logging in zend

    - by pradeep
    i am using zend for 1st time..i am facing problems in finding errors. when a setter and getter function name mismatch i get a an error...but the error is show sometimes and not all the time...how do i log such errors.is there any separate log for this?

    Read the article

  • Backing Up Database from Remote Server to Local in VB.NET

    - by Pradeep
    Hi, I am making a VB.NET application that can download/backup the database that is currently on a remote server. I have Remote Server IP,Username,Password and Database name. I am also able to connect to it. But i don't know what to do after connecting to it. I don't know what all files are need to be backed up. ( i think database and log file both must be backed up, i am not sure ) please let me know that basic commmands that i will need to backup the whole database. Thanks in advance.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Google App Engine appcfg.py data_upload Authentication fail

    - by Pradeep Upadhyay
    Hi, I am using appcfg.py to upload data to datastore from a csv file. But every time I try, I am getting error: [info ] Authentication failed even if i am using Admin id and password. In my app.yaml file I am having: handlers: - url: /remote_api script: $PYTHON_LIB/google/appengine/ext/remote_api/handler.py login: admin - url: .* script: MainHandler.py Can anybody please help me? Thanks in advance.

    Read the article

  • How to change the default text of Cancel BUtton which appears in the UISearchBar +Iphone

    - by Pradeep Reddy Kypa
    HI I am developing an Application where i wanted to change the text of Search String in the SearchBar. I wanted to change the text of Cancel Button Also which appears next to the SearchBar. Before entering any string in the search bar we wil get the Search String as the default string. i wanted to change the text of that string and when we click on that searchbar we get a cancel button next to searchbar and i wanted to change the text of that cancel button. PLease help me.

    Read the article

  • Design Web Templates

    - by Pradeep
    Hi, I am a PHP, VB.NET programmer and i like to build websites. I am good at coding but have never done website designing. Please suggest me some good study resource on Photoshop and flash website design. I have recently made few templates on photoshop but don't know how to code them for valid HTML-CSS. Please let me know which is the best method to design website template e.g. Photoshop, DreamWeaver etc. Also provide links to good study and practice resource for the same. Thanks in advance.

    Read the article

  • rawurl encode problem

    - by pradeep
    hi, i am using rawurlencode($url_variable) while passing to a script.. when i receive the variable in the script ,before passing this variable to mysql ,i was doing mysql_real_escape_string . now the problem is like when there is a variable like $url_variable = "Off-St.Mark's-Road" ...after i do mysql_real_escape_string it become slike Off-St.Mark\\'s-Road . which is creating a problem in mysql query ... how i get over this...rawurlencode is necessary to pass variables to the script and i want to do mysql_real_escape_string to make the data safe...

    Read the article

  • jquery return false in form

    - by pradeep
    [CODE] function confirmSubmit() { jConfirm('Is the Appointment Confirmed?', 'Confirmation Dialog', function(r) { if(r){return true;} else {return false;} }); } [/CODE] whjen i submit the foem i call this function and use jConfirm from jquery. i print r .its printing properly like true and false.but return false or return true has no effects.it just shows ths pop up and submits the form,does not wait for confirmation. how to solve this?

    Read the article

  • How to dynamically show/hide rows in a table

    - by pradeep
    I'm working on a website where I need to show/hide table rows. I got the feature working, but the CSS gets bad when I do show. I'm providing a working link; click the 'More...' link and see the action for an example. I'm using jQuery's toggle(slow) for hiding and showing

    Read the article

  • jcarousel not working in IE

    - by pradeep
    i have used jcarousel for my slideshow. it does not work in IE http://ratingscorner.com/product_rating.php?alias=Rashtreeya-Vidyalaya-College-of-Engineering-Mysore-Road-Bangalore&product=colleges any help on it.?

    Read the article

  • not able to solve markup problem

    - by pradeep
    http://validator.w3.org/check?uri=http%3A%2F%2Fratingscorner.com%2Fproduct_rating.php%3Falias%3DPeoples-Education-Society-Institute-of-Technology-%28PESIT%29-100-feet-Ring-Road-Bangalore%26product%3DColleges&charset=%28detect+automatically%29&doctype=Inline&ss=1&outline=1&group=1&No200=1&verbose=1&st=1&user-agent=W3C_Validator%2F1.767 have fixed most of the errors . but could not fix the » problems ...if any1 can help it will be helpful for me.

    Read the article

  • jquery not printing the image in IE 6

    - by pradeep
    if(count > 0){ for(var i= parseInt(start); i < parseInt(count); i++) { link ='<a href="/diabetes/ropimages/origpicdisplay.php?pid='+pid+'&rid='+i+'" target="_blank"><img src="/diabetes/ropimages/thumbpicdisplay.php?pid='+pid+'&rid='+i+'"/><a>&nbsp;&nbsp;'; if(i > start){ $("#content1").append(link);} else{ $("#content1").empty().html(link);} } } i use code like this. it does print images in FF but not in IE6 any solutions for this ?

    Read the article

  • not null usage in mysql

    - by pradeep
    Hi, I use syntax like name varchar(20) NOT NULL in mysql..i have a big confusion over here. typically does it mean that this field is mandatory? but when i store a space in this field it accepts it.is it correct. its like while insert i say '".$_POST['name']."'. even if the name does not have any value query is executed. can any1 just clarify me on this ? is NULL and blank space same ?

    Read the article

< Previous Page | 5 6 7 8 9 10 11 12 13 14 15 16  | Next Page >