Search Results

Search found 34778 results on 1392 pages for 'url link'.

Page 916/1392 | < Previous Page | 912 913 914 915 916 917 918 919 920 921 922 923  | Next Page >

  • Why is my nginx alias not working?

    - by Rob
    I'm trying to set up an alias so when someone accesses /phpmyadmin/, nginx will pull it from /home/phpmyadmin/ rather than from the usual document root. However, everytime I pull up the URL, it gives me a 404 on all items not pulled through fastcgi. fastcgi seems to be working fine, whereas the rest is not. strace is telling me it's trying to pull everything else from the usual document root, yet I can't figure out why. Can anyone provide some insight? Here is the relevant part of my config: location ~ ^/phpmyadmin/(.+\.php)$ { include fcgi.conf; fastcgi_index index.php; fastcgi_pass unix:/tmp/php-cgi.sock; fastcgi_param SCRIPT_FILENAME /home$fastcgi_script_name; } location /phpmyadmin { alias /home/phpmyadmin/; }

    Read the article

  • Firefox 11 Bookmarks Toolbar too Tall

    - by tba
    After updating to Firefox 11, my Bookmarks Toolbar is unpleasantly tall. This link implies that it's due to the presence of separators in my toolbar. I tried adding the suggested CSS in post 5 to my userChrome.css file, but this did nothing. I have also tried #PersonalToolbar {max-height:10px !important;} But this simply truncates the bottom of the toolbar. Does anyone know how to change the size of the bookmarks toolbar to match Firefox 10? More info: Here is a screenshot of my Bookmarks Toolbar. I'm using OSX 10.6.8 with the default theme. I have "View Toolbars Customize Use small icons" enabled. I'm also using the LiveClick 0.4.2.0 extension, but disabling it does not fix the issue.

    Read the article

  • How can I prevent JungleDisk/MacOS X (10.6) creating a local volume for a removed external drive?

    - by Rew
    Ok, here is situation: I use JungleDisk to sync an online folder on to a external drive connected to my Mac. If I right click Finder, click Go to Folder... then type /Volumes/ I see the drive linked here. Once I remove the external drive, an actual folder is created here in the name of the external drive, JungleDisk continues to copy files to this folder, rather than stop. Is this a feature of Mac OS X? Can I turn if off? After I re-connect my external drive, the link to the drive is appended with a 1 (so if I called the drive SpareDrive it becomes SpareDrive 1 as the newly created folder is called SpareDrive. I realise my explanation isn't very clear, but anyone understand this, and knows how to prevent it happening please let me know. PS: I have a low reputation as I don't use this often, I tend to use stackoverflow, but will check back here for answers.

    Read the article

  • why page is automatically redirecting to some other sites

    - by raj
    In my browser (Firefox 10.0.7) the page is automatically redirect to some other sites without clicking any link. If I enter the superuser.com url after pressing Enter button, It redirect to some other sites. sometimes while refreshing also the page is redirect to some other site. It's redirecting to this sites http://result.seenfind.com/ncp/Default.aspx?term=gatlinburg%20cabin&u=1000670913 http://search.cpvee.com/search.php?q=gatlinburg+cabin&y=&f=2168&s= http://www.insidecelebritygossip.com/ I cleared all history and all but still same problem. I am using CentOS 6.3

    Read the article

  • My Router is fast when i reset it but slows down seconds later

    - by hglocke
    I have a Belkin N wireless router which until recently worked perfectly fine. Now i have to reset the router every few minutes, otherwise it slows down to a crawl. What can I do? I have tried turning the routers firewall off, but it does not make any difference. As far as I'm aware there have been no recent firmware updates. EDIT: The other devices on my network (laptop and iphone) do not have this problem. I connect to the router using a TP-Link wireless network card and I have already tried uninstalling and installing the driver. Hopefully this will narrow down the problem significantly.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • What is your approach to draw a representation of your network ?

    - by Kartoch
    Hello, I'm looking to the community to see how people are drawing their networks, i.e. using symbols to represent complex topology. You can have hardware approach, where every hardware unit are represented. You can also have "entity" approach, where each "service" is shown. Both are interesting but it is difficult to have both on the same schema (but this is needed, especially using virtualization environment). Furthermore, it is difficult to have complex informations on such representation. For instance security parameters (encrypted link, need for authentication) or specific details (protocol type, ports, encapsulation). So my question is: where your are drawing a representation of your network, what is your approach ? Are you using methodology and/or specific softwares ? What is your recommendations for information to put (or not) ? How to deal with the complexity when the network becomes large and/or you want to put a lot of information on it ? Examples and links to good references will be appreciated.

    Read the article

  • cookie not being sent when requesting JS

    - by Mala
    I host a webservice, and provide my members with a Javascript bookmarklet, which loads a JS sript from my server. However, clients must be logged in, in order to receive the JS script. This works for almost everybody. However, some users on setups (i.e. browser/OS) that are known to work for other people have the following problem: when they request the script via the javascript bookmarklet from my server, their cookie from my server does not get included with the request, and as such they are always "not authenticated". I'm making the request in the following way: var myScript = eltCreate('script'); myScript.setAttribute('src','http://myserver.com/script'); document.body.appendChild(myScript); In a fit of confused desperation, I changed the script page to simply output "My cookie has [x] elements" where [x] is count($_COOKIE). If this extremely small subset of users requests the script via the normal method, the message reads "My cookie has 0 elements". When they access the URL directly in their browser, the message reads "My cookie has 7 elements". What on earth could be going on?!

    Read the article

  • Best practice- handling images on website

    - by Steve
    I am porting an old eCommerce site to MVC 3 and would like to take advantage of design improvements. The site currently has product images stored in 3 sizes: thumbnail, medium (for display in a list) and expanded for a zoomed look. Right now we are having to upload 3 separate images that are sized exactly right, provide 3 different names that match what the site expects, etc., it is a pain. I'd like to upload just 1 file, the large one, then let the site reduce it to needed sizes, and I'd like the flexibility to change the thumbnail and list sizes depending on user preferences, form factor (e.g. mobile, iPad, desktop), etc. so might need many copies of the same image. My question is should the image be reduced then saved several times upon upload and if so what is a good storage/naming convention? The other idea is to store just the single image but resize it programmatically before serving it to the client. Has anybody done this and what are the tradeoffs besides a few more machine cycles? How do you pass a temporary image in memory to the client (there is no URL)?

    Read the article

  • How to rewrite index.php (and other valid default files) to the document root using mod_rewrite?

    - by TMG
    Hello, I would like to redirect index.php, as well as any other valid default file (e.g. index.html, index.asp, etc.) to the document root (which contains index.php) with something like this: RewriteRule ^index\.(php|htm|html|asp|cfm|shtml|shtm)/?$ / [NC,L] However, this is of course giving me an infinite redirect loop. What's the right way to do this? If possible, I'd like to have this work in both the development and production environment, so I don't want to specify an explicit url like http://www.mysite.com/ as the target. Thanks!

    Read the article

  • Set one homepage for all browsers simultaneously

    - by MorganTiley
    For testing purposes, I would like to set the homepage of all browsers installed on my computer — Internet Explorer, Chrome, Firefox and Safari — to the same page. I'd like to do this all at the same time. I imagine that there's an application that has an input box for the URL I want to use as homepage and an OK button to set it in all browsers. Where can I get a utility or script that can do this?

    Read the article

  • South Florida Code Camp and Other Events

    - by MOSSLover
    My grandmother wanted me to make her a video when she heard I got MVP in SharePoint Server of one of my sessions.  I decided I haven’t visited in two years, so maybe I can do an in person session.  I googled around and found South Florida Code Camp, which will be Saturday, February 12th.  I will be doing a session at 9:50 in the morning on Silverlight just for my grandmother and whoever shows up.  Here is the link for more information: http://www.fladotnet.com/codecamp/. In the upcoming months I plan to return to SharePoint Saturday speaking.  We are also organizing another New York event on Saturday, July 30th.  We will open up submissions for sponsors and speakers somewhere after Best Practices Conference in LaJolla.  I will be speaking at Best Practices LaJolla and the The Expert’s Conference in the upcoming months.  I am really sorry for the lack of updates it’s just been incredibly crazy going back and forth to DC and not having internet on weekdays or having the slowest internet in the world has just not helped.  I am also trying to attend Coders 4 Charity this year, so I can visit some people in St. Louis.  I’ve already got an incredibly crazy schedule going for the year.  I might be helping organize more events.  I’m going to volunteer at New York Code Camp too doing whatever they need this year.  Check back for more updates. Technorati Tags: SharePoint Conferences 2011,Events 2011

    Read the article

  • Show and Tell: What work are you the most proud of? [closed]

    - by dannywartnaby
    Hey, In the spirit of building community, and because it's always cool to see great work being pushed out and created by people, anyone up for a little show and tell? The rules are really simple, and this is supposed to be a bit of fun, so; post a link to a single piece of work (anything you've produced, designed or developed (or helped developed)) and write a little paragraph or two on what it is, what you like about it, the technology you used and perhaps one thing that you learnt from the project. It could be a website, framework, open source project, game, mobile application... etc. So, allow me to start. I'm personally very proud of a tiny iPhone application I designed and developed. It's only available to UK AppStore users, and I only have a small userbase, but, I like it. The application is called Sushi Total: http://knowledgeisporridge.com/sushitotal.html It's written in Objective-C. It's a very simply application that allows you to total up your bill at Yo Sushi restaurants by tapping coloured plates. If I learnt anything from making this application it's this: I believe software should be simple and uncluttered, and that producing an application with one feature is absolutely fine as long as it works really well. So, who's next?

    Read the article

  • Compilation problem [closed]

    - by Misery
    I am trying to compile a program called Triangle Mesh Generator. It is an open source code written in ANSI C. I need it to bo a callable lib so I am using a switch (#define) created by it's Author. However I get this error: /usr/lib/gcc/x86_64-linux-gnu/4.6/../../../x86_64-linux-gnu/crt1.o: In function `_start': collect2: ld returned 1 exit status make: *** [triangle] Error 1 I am not sure why such an error occurs. Worth adding is that compiling it as a stand alone program is succesful. I am using GCC on 12.04. The lines quoted above constitute the total output. What I put in the terminal is just make in the proper folder. There are no other errors, warnings, or other messages. Link to the sources I found some additional instructions. I'll get back after reading them :] EDIT: I have found some additional instructions that let me compile it. Thanks for help. I am closing question right now. Regards

    Read the article

  • Why is my email server in AT&T's blacklist?

    - by legoscia
    I just got this bounce message: <¦¦¦¦¦¦¦¦@att.net>: host scc-mailrelay.att.net[204.127.208.75] said: 521-88.208.246.34 blocked by sbc:blacklist.mailrelay.att.net. 521 DNSRBL: Blocked for abuse. See http://att.net/blocks (in reply to MAIL FROM command) So I'm trying to figure out why our server ended up on their blacklist. The web page link doesn't tell me why, as far as I can see. From a few multi-RBL tools I conclude that our IP is only on the collateral damage lists of uceprotect.net (you can be exempt from that with a paid subscription), and I dearly hope that AT&T doesn't use that. From the mail server logs I see that an email to another @att.net address went through two days ago without being blocked. Does anyone have any ideas how I can find out what went wrong?

    Read the article

  • Chrome opens to untitled blank page

    - by jackncoke
    I am working on a computer that had a lot of malware on it. I removed most of it to my knowledge. Now when I open Google Chrome I get a blank untitled page, with the traditional sign-in URL on top. If I go to the settings, the settings tab opens up blank as well. All pages that I navigate to will come up blank as well. The browser doesn't even perform a postback, it is like it is unresponsive. I did some googling and have seen people with similar errors, but no fixes. IE 8 works great without issues. Re-installing Chrome was the first thing I did! Any suggestions?

    Read the article

  • Windows 8 power-shell "update-help" is failing. Does anyone know how to fix it?

    - by Warren P
    Windows 8 includes PowerShell out of the box, but not the help. To get the help you run PowerShell as administrator and type "update-help". I get this error: > update-help update-help : Failed to update Help for the module(s) 'BitLocker, NetWNV' with UI culture(s) {en-US} : The value of the HelpInfoUri key in the module manifest must resolve to a container or root URL on a website where the help files are stored. The HelpInfoUri 'http://technet.microsoft.com/library/cc732148.aspx' does not resolve to a container. At line:1 char:1 + update-help + ~~~~~~~~~~~ + CategoryInfo : InvalidOperation: (:) [Update-Help], Exception + FullyQualifiedErrorId : InvalidHelpInfoUri,Microsoft.PowerShell.Commands.UpdateHelpCommand Can anyone tell me how I fix this or if it's not important? I'm guessing that if I don't need help on NetWNV or BitLocker, that this is the only thing wrong?

    Read the article

  • Install Problems on ASUS X401A Notebook

    - by tired_of_trying
    okay... I tried many approaches to install Ubuntu 12.xxx on my new Asus notebook with varying degrees of failure... First: I'm not a newbie but I'm as frustrated as one! Install background: Install from USB DVD drive: The install went well. Re-booted machine. choose ubuntu and it errors with a MBR file error (can't remember the exact wording - something to do with missing the file. Choosing to boot W7 works fine. Install from USB Stick: Couldn't get machine to recognize the .iso Install into Oracle's Vbox: Got the boot splash screen, then hangs with a zillion errors. Note: I didn't have any problems installing ubuntu in Vbox on my iMac and it run's great. Installed using wubi: Installed fine but get errors when booting ubuntu (it doesn't find the needed wubi files). I downloaded to the C: drive and tried installing from there - no luck. For kicks: I tried running Slax Linux .iso from a USB stick and it runs fine. Some Questions: Did I use the correct .iso? (I tried 12.04.0 and 12.04.1 both 32 and 64 bit versions. I simply downloaded them from the download link and didn't use/look for an alternate version. Do I need to do something special when burning the .iso to disc? What? I did read tons of posts but, no luck with finding the solution. Any help is appreciated... thanks

    Read the article

  • How can I search for Gmail conversations that have more than one e-mail? [closed]

    - by Matt Refghi
    I previously used a service that sent me Slashdot articles as individual e-mails. All I had to do was give them the RSS url, and they handled the rest. On the Gmail side, I simply made a filter, labeling these e-mails as "News". Once I stopped using the service, I realized that I had more than 20,000 such e-mails stockpiled. While I could delete all "News" e-mails, there are some that I've forwarded to friends, sometimes receiving multiple replies. These conversations are valuable - I would like to keep them. As far as I can tell, there's no way to search for conversations that have more than one e-mail in the thread. Up until now, I've been deleting them page by page, carefully de-selecting the conversations that have more than one e-mail; however, it will take far too much time to complete. Is there an easier way that I'm missing? Thanks.

    Read the article

  • Microsoft Outlook 2007 Limit attachment size

    - by tasmanian_devil
    I have qmail server and authetication on Active Directory. All clients use Microsoft Outlook 2007 as default mail client. A have one central location and several remote location wich are connected with slow link speed connection. I have attachment limit on qmail, but i have problem when client attach file localy and send mail, attachment is been uploaded to qmail server and rejected because exceeded limit. Is it possible to limit attachment localy on MS Outlook 2007? I know that Office 2010 have attachment limitation but i think that is not working on Office 2007.

    Read the article

  • How to enable winhlp on Windows7 64bit?

    - by BGM
    Salvete! I just discovered that winhlp32.exe won't run on Windows7 64bit. I can't run the application, and I can't run hlp files either (but .chm files run fine). How do I make this work? I have downloaded the Microsoft fix here and restarted my computer, but to no avail. I can see the file winhlp32.exe in my c:\windows directory, but cannot run it. When I do run it, I get Windows' own "Help and Support" entitled, "Why can't I get Help from this program?" which sends me to the link above! How can I make it work?

    Read the article

  • What is the world wide web? [closed]

    - by think123
    I don't know where to post this question, so please move it if necessary. Ok, so I've heard of how the professional hosting companies can create 'links' to the world wide web to register an unregistered domain. So that's where my question comes from. Is the world wide web a server to which servers link? Is it created by abstract linkage? I'm not sure. Also, what does it mean for the DNS to be updated throughout the whole world?

    Read the article

  • Community TFS Build Manager available for Visual Studio 2012 RC

    - by Jakob Ehn
    I finally got around to push out a version of the Community TFS Build Manager that is compatible with Visual Studio 2012 RC. Unfortunately I had to do this as a separate extension, it references different versions of the TFS assemblies and also some properties and methods that the 2010 version uses are now obsolete in the TFS 2012 API. To download it, just open the Extension Manager, select Online and search for TFS Build:   You can also download it from this link: http://visualstudiogallery.msdn.microsoft.com/cfdb84b4-285e-4eeb-9fa9-dad9bfe2cd10 The functionality is identical to the 2010 version, the only difference is that you can’t start it from the Team Explorer Builds node (since the TE has been completely rewritten and the extension API’s are not yet published). So, to start it you must use the Tools menu: We will continue shipping updates to both versions in the future, as long as it functionality that is compatible with both TFS 2010 and TFS 2012. You might also note that the color scheme used for the build manager doesn’t look as good with the VS2012 theme….   Hope you will enjoy the tool in Visual Studio 2012 as well. I want to thank all the people who have downloaded and used the 2010 version! For feedback, feature requests, bug reports please post this to the CodePlex site: http://tfsbuildextensions.codeplex.com

    Read the article

  • Create Adjustable Depth of Field Photos with a DSLR

    - by Jason Fitzpatrick
    If you’re fascinating by the Lytro camera–a camera that let’s you change the focus after you’ve taken the photo–this DSLR hack provides a similar post-photo focus processing without the $400 price tag. Photography tinkers at The Chaos Collective came up with a clever way of mimicking the adjustable depth-of-field adjustment effect from the Lytro camera. The secret sauce in their technique is setting the camera to manual focus and capturing a short 2-3 second video clip while they rotate the focus through the entire focal range. From there, they use a simple applet to separate out each frame of the video. Check out the interactive demo below: Anywhere you click in the photo shifts the focus to that point, just like the post processing in the Lytro camera. It’s a different approach to the problem but it yields roughly the same output. Hit up the link below for the full run down on their technique and how you can get started using it with your own video-enabled DLSR. Camera HACK: DOF-Changeable Photos with an SLR [via Hack A Day] Secure Yourself by Using Two-Step Verification on These 16 Web Services How to Fix a Stuck Pixel on an LCD Monitor How to Factory Reset Your Android Phone or Tablet When It Won’t Boot

    Read the article

  • Apache resolves all URLs to default

    - by Ariel
    I am using Apache 2.2 on a Debian-based distro. For some reason, all URLs are directed to the default index. No error or anything. That means: example.domain.com goes to domain.com. "example" can be just anything. In the default Vhost file (/etc/apache2/sites-available/default) I've added: ServerName: www.domain.com But it still keeps that odd behaviour. Please let me know how to enable the common, default behaviour. I haven't changed anything by the way, this is since installation. Update: Following SvW's answer, I am looking for a way to force Apache not to accept any URL, only those specified as VirtualHosts.

    Read the article

< Previous Page | 912 913 914 915 916 917 918 919 920 921 922 923  | Next Page >