Search Results

Search found 6026 results on 242 pages for 'visitor pattern'.

Page 92/242 | < Previous Page | 88 89 90 91 92 93 94 95 96 97 98 99  | Next Page >

  • Regex - replace only last part of an expression

    I'm attempting to find the best methodology for finding a specific pattern and then replace the ending portion of the pattern. Here is a quick example (in C#): //Find any year value starting with a bracket or underscore string patternToFind = "[[_]2007"; Regex yearFind = new Regex(patternToFind); //I want to change any of these values to x2008 where x is the bracket or underscore originally in the text. I was trying to use Regex.Replace(), but cannot figure out if it can be applied. If all else fails, I can find Matches using the MatchCollection and then switch out the 2007 value with 2008; however, I'm hoping for something more elegant MatchCollections matches = yearFind.Matches(" 2007 [2007 _2007"); foreach (Match match in matches){ //use match to find and replace value }

    Read the article

  • How to sort my paws?

    - by Ivo Flipse
    In my previous question I got an excellent answer that helped me detect where a paw hit a pressure plate, but now I'm struggling to link these results to their corresponding paws: I manually annotated the paws (RF=right front, RH= right hind, LF=left front, LH=left hind). As you can see there's clearly a pattern repeating pattern and it comes back in aknist every measurement. Here's a link to a presentation of 6 trials that were manually annotated. My initial thought was to use heuristics to do the sorting, like: There's a ~60-40% ratio in weight bearing between the front and hind paws; The hind paws are generally smaller in surface; The paws are (often) spatially divided in left and right. However, I’m a bit skeptical about my heuristics, as they would fail on me as soon as I encounter a variation I hadn’t thought off. They also won’t be able to cope with measurements from lame dogs, whom probably have rules of their own. Furthermore, the annotation suggested by Joe sometimes get's messed up and doesn't take into account what the paw actually looks like. Based on the answers I received on my question about peak detection within the paw, I’m hoping there are more advanced solutions to sort the paws. Especially because the pressure distribution and the progression thereof are different for each separate paw, almost like a fingerprint. I hope there's a method that can use this to cluster my paws, rather than just sorting them in order of occurrence. So I'm looking for a better way to sort the results with their corresponding paw. For anyone up to the challenge, I have pickled a dictionary with all the sliced arrays that contain the pressure data of each paw (bundled by measurement) and the slice that describes their location (location on the plate and in time). To clarfiy: walk_sliced_data is a dictionary that contains ['ser_3', 'ser_2', 'sel_1', 'sel_2', 'ser_1', 'sel_3'], which are the names of the measurements. Each measurement contains another dictionary, [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10] (example from 'sel_1') which represent the impacts that were extracted. Also note that 'false' impacts, such as where the paw is partially measured (in space or time) can be ignored. They are only useful because they can help recognizing a pattern, but won't be analyzed. And for anyone interested, I’m keeping a blog with all the updates regarding the project!

    Read the article

  • Design of Business Layer

    - by Adil Mughal
    Hi, We are currently revamping our architecture and design of application. We have just completed design of Data Access Layer which is generic in the sense that it works using XML and reflection to persist data. Any ways now we are in the phase of designing business layer. We have read some books related to Enterprise Architecture and Design so we have found that there are few patterns that can be applied on business layer. Table Pattern and Domain Model are example of such patterns. Also we have found Domain Driven Design as well. Earlier we decided to build Entities against table objects. But we found that there is difference in Entities and Value Objects when it comes to DDD. For those of you who have gone through such design. Please guide me related to pattern, practice and sample. Thank you in advance! Also please feel free to discuss if you didn't get any point of mine.

    Read the article

  • Adding Listeners at runtime? - Java MVC

    - by Halo
    My model in my MVC pattern, generates components at runtime and gives them to the View to be displayed on the screen through update() method (you know, model is the observable and the view is the observer). But I also need to add listeners to these components, and the controller has the listener methods (because they say the MVC pattern is like this) and it's not involved in this update process. So I can't add the listeners at runtime, but only in the controller's constructor at startup. I've got an idea, that is making the controller the observer and then giving the data to the view, as well as adding the listeners. Do you think this would be OK?

    Read the article

  • StackOverflowError occured as using java.util.regex.Matcher

    - by Captain Kidd
    Hi guys I try to catch text by Regular Expression. I list codes as follows. Pattern p=Pattern.compile("<@a>(?:.|\\s)+?</@a>"); Matcher m = p.matcher(fileContents.toString()); while(m.find()) { //Error will be thrown at this point System.out.println(m.group()); } If the length of text I want to catch is too long, system will throw me a StackOverflowError. Otherwise, the codes work well. Please help me how to solve this problem.

    Read the article

  • initial caps in actionScript using Regex

    - by Deyon
    I'm trying to do initial caps in actionScript with no loops but now i'm stuck. I wanted to select the first letter or every word then apply uppercase on that letter. Well I got the selection part right, but at a dead end right now, any ideas? I was trying to do this with out loops and cutting up strings. //replaces with x cant figure out how to replace with the found result as uppercase public function initialcaps():void { var pattern:RegExp=/\b[a-z]/g; var myString:String="yes that is my dog dancing on the stage"; var nuString:String=myString.replace(pattern,"x"); trace(nuString); }

    Read the article

  • Find ASCII "arrows" in text

    - by ulver
    I'm trying to find all the occurrences of "Arrows" in text, so in "<----=====><==->>" the arrows are: "<----", "=====>", "<==", "->", ">" This works: String[] patterns = {"<=*", "<-*", "=*>", "-*>"}; for (String p : patterns) { Matcher A = Pattern.compile(p).matcher(s); while (A.find()) { System.out.println(A.group()); } } but this doesn't: String p = "<=*|<-*|=*>|-*>"; Matcher A = Pattern.compile(p).matcher(s); while (A.find()) { System.out.println(A.group()); } No idea why. It often reports "<" instead of "<====" or similar. What is wrong?

    Read the article

  • spring 3 mvc requestmapping dynamic param problem

    - by Faisal khan
    I have the following code which works fine with http://localhost:8080/HelloWorldSpring3/forms/helloworld but i want to have url have some thing like this http://localhost:8080/HelloWorldSpring3/forms/helloworld/locname_here/locid_here I found that adding this @RequestMapping("/helloworld/**") will work but when i try to access http://localhost:8080/HelloWorldSpring3/forms/helloworld/locname_here/locid_here it is not found. Web.xml entry as follows <servlet-mapping> <servlet-name>dispatcher</servlet-name> <url-pattern>/forms/*</url-pattern> </servlet-mapping> Mapping bean entry @RequestMapping("/helloworld/**") public ModelAndView helloWord(){ String message = "Hello World, Spring 3.0!"; return new ModelAndView("helloworld", "message",message); }

    Read the article

  • [C#, Regex] EOL Special Char not matching

    - by Aurélien Ribon
    Hello, I am trying to find every "a - b, c, d" pattern in an input string. The pattern I am using is the following : "^[ \t]*(\\w+)[ \t]*->[ \t]*(\\w+)(,[ \t]*\\w+)*$" The input is : a -> b b -> c c -> d The function is : private void ParseAndBuildGraph(String input) { MatchCollection mc = Regex.Matches(input, "^[ \t]*(\\w+)[ \t]*->[ \t]*(\\w+)(,[ \t]*\\w+)*$", RegexOptions.Multiline); foreach (Match m in mc) { Debug.WriteLine(m.Value); } } The output is : c -> d Actually, there is a problem with the line ending "$" special char. If I insert a "\r" before "$", it works, but I thought "$" would match any line termination (with the Multiline option), especially a \r\n in a Windows environment. Is it not the case ?

    Read the article

  • .Net Regular expression - how to do an exact match exclusion on a full string?

    - by Nathan Ridley
    I need a .Net regular expression that matches anything OTHER than the exact full string match specified. So basically: ^Index$ ... is the only exclusion I care about. Strings can start with, finish with or contain "Index", but not match exactly. My brain doesn't seem to be working today and I'm failing to work this one out. EDIT The answer MUST be via the pattern itself, as I am passing an argument to a third party library and do not have control over the process other than via the Regex pattern.

    Read the article

  • NSPredicate error/behaving differently on 10.5 vs 10.6

    - by Tristan
    I am using a NSPredicate to determine if an entered email address is valid. On 10.6 it works perfectly as expected. I recently decided to get my app going on 10.5 and this is the only thing that doesn't work. The error i get is as follows: "Can't do regex matching, reason: Can't open pattern U_MALFORMED_SET (string [email protected], pattern ([\w-+]+(?:\.[\w-+]+)*@(?:[\w-]+\.)+[a-zA-Z]{2,7}), case 0, canon 0)" The code im using is as follows: NSString *regex = @"([\\w-+]+(?:\\.[\\w-+]+)*@(?:[\\w-]+\\.)+[a-zA-Z]{2,7})"; NSPredicate *regextest = [NSPredicate predicateWithFormat:@"SELF MATCHES %@", regex]; if ([regextest evaluateWithObject:[userEmail objectValue]] == YES) Does anyone know why this isn't working on 10.5? And how I might get it working or be able to do this test in a way compatible for both 10.5 and 10.6?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Static Access To Multiple Instance Variable

    - by Qua
    I have a singleton instance that is referenced throughout the project which works like a charm. It saves me the trouble from having to pass around an instance of the object to every little class in the project. However, now I need to manage multiple instances of the previous setup, which means that the singleton pattern breaks since each instance would need it's own singleton instance. What options are there to still maintain static access to the singleton? To be more specific, we have our game engine and several components and plugins reference the engine through a static property. Now our server needs to host multiple game instances each having their own engine, which means that on the server side the singleton pattern breaks. I'm trying to avoid all the classes having the engine in the constructor.

    Read the article

  • Regular Expression Help in .NET

    - by Matt H.
    I have a simple pattern I am trying to match, any characters captured between parenthesis at the end of an HTML paragraph. I am running into trouble any time there is additional parentheticals in that paragraph: i.e. If the input string is "..... (321)</p" i want to get the value (321) However, if the paragraph has this text: "... (123) (321)</p" my regex is returning "(123) (321)" (everything between the opening "(" and closing ")" I am using the regex pattern "\s(.+)</p" How can I grab the correct value (using VB.NET) This is what I'm doing so far: Dim reg As New Regex("\s\(.+\)</P>", RegexOptions.IgnoreCase) Dim matchC As MatchCollection = reg.Matches(su.Question) If matchC.Count > 0 Then Dim lastMatch As Match = matchC(matchC.Count - 1) Dim DesiredValue As String = lastMatch.Value End If

    Read the article

  • Unit Testing functions within repository interfaces - ASP.net MVC3 & Moq

    - by RawryLions
    I'm getting into writing unit testing and have implemented a nice repository pattern/moq to allow me to test my functions without using "real" data. So far so good.. However.. In my repository interface for "Posts" IPostRepository I have a function: Post getPostByID(int id); I want to be able to test this from my Test class but cannot work out how. So far I am using this pattern for my tests: [SetUp] public void Setup() { mock = new Mock<IPostRepository>(); } [Test] public void someTest() { populate(10); //This populates the mock with 10 fake entries //do test here } In my function "someTest" I want to be able to call/test the function GetPostById. I can find the function with mock.object.getpostbyid but the "object" is null. Any help would be appreciated :) iPostRepository: public interface IPostRepository { IQueryable<Post> Posts {get;} void SavePost(Post post); Post getPostByID(int id); }

    Read the article

  • WCF client proxy initialization

    - by 123Developer
    I am consuming a WCF service and created its proxy using the VS 2008 service reference. I am looking for the best pattern to call WCF service method Should I create the client proxy instance every time I call the service method and close the client as soon as I am done with that? When I profiled my client application, I could see that it is taking lot of time to get the Channel while initializing the proxy client Should I use a Singleton pattern for the client proxy so that I can use the only once instance and get rid of the re-initializing overhead? Is there any hidden problem with this approach? I am using .Net framework 3.5 SP1, basicHttp binding with little customization.

    Read the article

  • plist vs static array

    - by morticae
    Generally, I use static arrays and dictionaries for containing lookup tables in my classes. However, with the number of classes creeping quickly into the hundreds, I'm hesitant to continue using this pattern. Even if these static collections are initialized lazily, I've essentially got a bounded memory leak going on as someone uses my app. Most of these are arrays of strings so I can convert strings into NSInteger constants that can be used with switch statements, etc. I could just recreate the array/dictionary on every call, but many of these functions are used heavily and/or in tight loops. So I'm trying to come up with a pattern that is both performant and not persistent. If I store the information in a plist, does the iphoneOS do anything intelligent about caching those when loaded? Do you have another method that might be related?

    Read the article

  • str_replace match only first instance

    - by kylex
    A followup question to http://stackoverflow.com/questions/3063704/ Given the following POST data: 2010-June-3 <remove>2010-June-3</remove> 2010-June-15 2010-June-16 2010-June-17 2010-June-3 2010-June-1 I'm wanting to remove ONLY the first instance of 2010-June-3, but the following code removes all the data. $i = 1; $pattern = "/<remove>(.*?)<\/remove>/"; preg_match_all($pattern, $_POST['exclude'], $matches, PREG_SET_ORDER); if (!empty($matches)) { foreach ($matches as $match) { // replace first instance of excluded data $_POST['exclude'] = str_replace($match[1], "", $_POST['exclude'], $i); } } echo "<br /><br />".$_POST['exclude']; This echos: <remove></remove> 2010-June-15 2010-June-16 2010-June-17 2010-June-1 It should echo: <remove>2010-June-3</remove> 2010-June-15 2010-June-16 2010-June-17 2010-June-3 2010-June-1

    Read the article

  • javascript string exec strange behavior

    - by Michael
    have funciton in my object which is called regularly. parse : function(html) { var regexp = /...some pattern.../ var match = regexp.exec(html); while (match != null) { ... match = regexp.exec(html); } ... var r = /...pattern.../g; var m = r.exec(html); } with unchanged html the m returns null each other call. let's say parse(html);// ok parse(html);// m is null!!! parse(html);// ok parse(html);// m is null!!! // ...and so on... is there any index or somrthing that has to be reset on html ... I'm really confused. Why match always returns proper result?

    Read the article

  • How to display a DateTime with chosen date parts, but in the order of the FormatProvider?

    - by Stephane
    I want to display the date in the order that the culture provides, but with the elements I want only. The DateTime.Tostring() method has a list of patterns that are very useful but I would like a very small change in it. The CultureInfo used in the following the following code are chosen as example, I don't want to rely on a specific list of CultureInfo, if possible var now = DateTime.Now; string nowString = now.ToString("m", CultureInfo.GetCultureInfo("en-us")); Console.WriteLine(nowString); nowString = now.ToString("m", CultureInfo.GetCultureInfo("fr-FR")); Console.WriteLine(nowString); displays : April 12 12 avril I would like a pattern that display the abbreviation of the month and the day, but that keeps the correct order from the specified CultureInfo. using the pattern "MMM dd" will always display the month's abbreviation first, followed by the day, breaking the french order for example. Any way to achieve that without too much custom code?

    Read the article

  • Windows Phone 7, MVVM, Silverlight and navigation best practice / patterns and strategies

    - by Matt F
    Whilst building a Windows Phone 7 app. using the MVVM pattern we've struggled to get to grips with a pattern or technique to centralise navigation logic that will fit with MVVM. To give an example, everytime the app. calls our web service we check that the logon token we've assigned the app. earlier hasn't expired. We always return some status to the phone from the web service and one of those might be Enum.AuthenticationExpired. If we receive that I'd imagine we'd alert the user and navigate back to the login screen. (this is one of many examples of status we might receive) Now, wanting to keep things DRY, that sort of logic feels like it should be in one place. Therein lies my question. How should I go about modelling navigation that relies on (essentially) switch or if statements to tell us where to navigate to next without repeating that in every view. Are there recognised patterns or techniques that someone could recommend? Thanks

    Read the article

  • handle when callback to a dealloced delegate?

    - by athanhcong
    Hi all, I implemented the delegate-callback pattern between two classes without retaining the delegate. But in some cases, the delegate is dealloced. (My case is that I have a ViewController is the delegate object, and when the user press back button to pop that ViewController out of the NavigationController stack) Then the callback method get BAD_EXE: if (self.delegate != nil && [self.delegate respondsToSelector:selector]) { [self.delegate performSelector:selector withObject:self withObject:returnObject]; } I know the delegate-callback pattern is implemented in a lot of application. What is your solution for this?

    Read the article

  • VB.NET 2.0 - StackOverflowException when using Thread Safe calls to Windows Forms Controls

    - by LamdaComplex
    I have a Windows Forms app that, unfortunately, must make calls to controls from a second thread. I've been using the thread-safe pattern described on the http://msdn.microsoft.com/en-us/library/ms171728.aspx. Which has worked great in the past. The specific problem I am having now: I have a WebBrowser control and I'm attempting to invoke the WebBrowser.Navigate() method using this Thread-Safe pattern and as a result I am getting StackOverflow exceptions. Here is the Thread-Safe Navigate method I've written. Private Delegate Sub NavigateControlCallback(ByRef wb As WebBrowser, ByVal url As String) Private Sub AsyncNavigate(ByRef wb As WebBrowser, ByVal URL As String) Try If wb.InvokeRequired Then Dim callback As New NavigateControlCallback(AddressOf AsyncNavigate) callback(wb, url) Else wb.Navigate(url) End If Catch ex As Exception End Try End Sub Is there a Thread-Safe way to interact with WinForms components without the side effect of these StackOverflowExceptions?

    Read the article

  • How to combine designable components with dependency injection

    - by Wim Coenen
    When creating a designable .NET component, you are required to provide a default constructor. From the IComponent documentation: To be a component, a class must implement the IComponent interface and provide a basic constructor that requires no parameters or a single parameter of type IContainer. This makes it impossible to do dependency injection via constructor arguments. (Extra constructors could be provided, but the designer would ignore them.) Some alternatives we're considering: Service Locator Don't use dependency injection, instead use the service locator pattern to acquire dependencies. This seems to be what IComponent.Site.GetService is for. I guess we could create a reusable ISite implementation (ConfigurableServiceLocator?) which can be configured with the necessary dependencies. But how does this work in a designer context? Dependency Injection via properties Inject dependencies via properties. Provide default instances if they are necessary to show the component in a designer. Document which properties need to be injected. Inject dependencies with an Initialize method This is much like injection via properties but it keeps the list of dependencies that need to be injected in one place. This way the list of required dependencies is documented implicitly, and the compiler will assists you with errors when the list changes. Any idea what the best practice is here? How do you do it? edit: I have removed "(e.g. a WinForms UserControl)" since I intended the question to be about components in general. Components are all about inversion of control (see section 8.3.1 of the UMLv2 specification) so I don't think that "you shouldn't inject any services" is a good answer. edit 2: It took some playing with WPF and the MVVM pattern to finally "get" Mark's answer. I see now that visual controls are indeed a special case. As for using non-visual components on designer surfaces, I think the .NET component model is fundamentally incompatible with dependency injection. It appears to be designed around the service locator pattern instead. Maybe this will start to change with the infrastructure that was added in .NET 4.0 in the System.ComponentModel.Composition namespace.

    Read the article

  • Using free function as pseudo-constructors to exploit template parameter deduction

    - by Poita_
    Is it a common pattern/idiom to use free functions as pseudo-constructors to avoid having to explicitly specify template parameters? For example, everyone knows about std::make_pair, which uses its parameters to deduce the pair types: template <class A, class B> std::pair<A, B> make_pair(A a, B b) { return std::pair<A, B>(a, b); } // This allows you to call make_pair(1, 2), // instead of having to type pair<int, int>(1, 2) // as you can't get type deduction from the constructor. I find myself using this quite often, so I was just wondering if many other people use it, and if there is a name for this pattern?

    Read the article

< Previous Page | 88 89 90 91 92 93 94 95 96 97 98 99  | Next Page >