Search Results

Search found 5853 results on 235 pages for 'vivian short'.

Page 93/235 | < Previous Page | 89 90 91 92 93 94 95 96 97 98 99 100  | Next Page >

  • preloading RSS contents in thunderbird, before actually reading them

    - by Berry Tsakala
    i have thunderbird 3.x, and i'm subscribed to several RSS feeds. How can I tell thunderbird to load/download any new RSS items in the background? The usual behavior with RSS feeds is that it download the headrs, or few introductory lines from the contents, but only when i'm clicking a feed item it starts loading "for real". I really want to receive the feeds and not to wait for them to load, the same way i receive emails in any email client - all messages are fully downloaded at once. there could be several reasons, BTW. - e.g. if i have short connection time, i'd rather connect, sync everything at once, and read it later. - or if i have a slow wifi connection, it's annoying to wait for each and every message, but the computer is idle while reading.. thanks

    Read the article

  • not able to make entry of ubuntu 10.04 grub.cfg into redhat 5.1 menu.lst file to run 2 linux os and

    - by Deepak Narwal
    Hello friend... In my computer there are three operating systems.. First i installed Windows 7 then i installed ubuntu 10.04 and in last i installed redhat 5.1 NOw i know one thing as i installed redhat then grub installed by ubuntu will be overwritten by redhat grub..and i know that to see all three operating syetm at the startup i have to make entry of /boot/grub/cfg into /boot/grub/menu.lst file.. Now the problem is like this In te previous version it was very easy to play with ubuntu grub file but now this file is modified..NOw i dont know what is to be picked up from ubuntu /grub/grub.cfg file so that i can make entry in redhat /boot/grub/menu.lst file.. In short i am not able to put entry of grub.cfg file into redhat menu.lst file.. will u help me plz i want to work on these thre eOS..

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Upgrade Subversion 1.6 to 1.7 on CentOS? (can't find yum repository)

    - by user743919
    I want to upgrade my SVN Server from 1.6 to 1.7. Unfortunately I can't find anything on the internet how to do this with yum. I have checked rpmforge-extras but it has only svn 1.6 and not 1.7 I wanted to update with yum because this is the most secure way for me. I'm not an experienced Linux user. Is there a yum repository that contains 1.7 (subversion.x86_64 0:1.7.xxxxx.el5.rfx) I hope somebody can help me out? If there is non, perhaps a short explenation how to update with just step by step.

    Read the article

  • WD Elements Desktop External - Not recognised on a single computer

    - by Aelexe
    My WD Elements Desktop External is no longer recognised on my main computer. It has worked fine in the past, but now all of a sudden is not detected. It does not prompt when plugged in, nor does it show up in the disc management interface or the device manager. It appears to be aware that it is plugged in however as the light on the external blinks rapidly for a short while after being plugged in. The strangest thing however is that it works fine on other computers, including my family computers and my laptop. I have attempted to troubleshoot the issue by trying various USB devices in multiple ports on each system to see if there is any correlation with the issue, but have come up with nothing that gives me an idea of what is going on. I have also attempted to format the external using my laptop, but that has not helped either. If anyone has had a similar issue, or knows of any potential solutions, please post your advice. Thanks for your time.

    Read the article

  • How to force Windows XP to rename a file with a special character?

    - by codeLes
    I have a song that Windows can't play because there is a question mark in the name of the file. "Where Have All the Cowboys Gone?.ogg" // as an example So I try to rename it and Windows complains whether I try it in Explorer or from command prompt. Error I get when trying to copy, rename, or move is: The Filename, directory name, or volume label syntax is incorrect Is there a Windows way to force a rename in this case? Update I'll keep an eye on this question, but after 13 answers and many attempts (aside form 3rd party solutions) it seems that Windows can't do this (or at least my windows can't, no short names). So I'm accepting the answer which was my original solution anyway of using Linux. It would be nice to see Windows handle this somehow, so don't stop just because I've accepted this answer, the question still stands!

    Read the article

  • How to force Windows XP to rename a file with a special character?

    - by codeLes
    I have a song that Windows can't play because there is a question mark in the name of the file. "Where Have All the Cowboys Gone?.ogg" // as an example So I try to rename it and Windows complains whether I try it in Explorer or from command prompt. Error I get when trying to copy, rename, or move is: The Filename, directory name, or volume label syntax is incorrect Is there a Windows way to force a rename in this case? Update I'll keep an eye on this question, but after 13 answers and many attempts (aside form 3rd party solutions) it seems that Windows can't do this (or at least my windows can't, no short names). So I'm accepting the answer which was my original solution anyway of using Linux. It would be nice to see Windows handle this somehow, so don't stop just because I've accepted this answer, the question still stands!

    Read the article

  • Is Exchange protected from/allow back dated emails?

    - by David
    Does Exchange Server adequately protect against backdating items in a mailbox folder? I want to determine from an auditing perspective what level of risk exists/what trust can be put into Exchange database records. Is there a (mis)feature that allows end point users to modify the sent/recieved date fields on their own messages? Is there a reasonable way short of hand editing the files for an Exchange Server admin to make such a change? And most importantly: Is there any kind of "sequence number" that we could use to audit Exchange records for evidence of date manipulation (ex. msg100 = Dec 15, msg101 = Dec 10, msg102 = Dec 16)

    Read the article

  • Boost Up My Old Laptop Using a SSD

    - by Sina Bizbone
    I have an old laptop Lenovo SL400 (Core2Due T9550 2.66GHz / 4GB DDR2 Ram). Since I can't afford to buy a new laptop, I thought maybe I could throw an ADATA SP600 64GB SSD as primary drive and move my current HDD to DVD-ROM space by using HDDCADDY. I know that 64gb will come short after installing Visual Studio, SQL Server, etc. So is there anyway to just install the kernel part of windows on SSD and the rest on HDD. Doesn't windows have built-in support to do this? (ReadyBoost is out of picture since it's just simple caching)

    Read the article

  • Bringing my Dell XPS 13 ultrabook back to factory state

    - by TysHTTP
    I have a brand new Dell XPS 13 ultra book. After i picked it up at the store, i wiped the exising partitions which also contained the restore/rescue data, which you need to reinstall the factory version of Windows 8 that comes with this machine. I did this because we have a different MS partner edition of Windows which i prefer to run. After doing all this, i noticed that there was something wrong with machine. No real damage, but the specs are not completely as they should be. Turned out that a simple mistake while ordering. Now, long story short, the shop says that it has no problem with taking the product back, as long as it is in it's original state. And this is the problem i'm having, because i formatted the original partitions that contain that rescue option / windows 8 setup, i don't have a clue whether it's possible to get back to that original. Does anyone have an idea on how to get this fixed?

    Read the article

  • ALT+TAB doesn't work properly in Windows 8.1

    - by Marco1
    Holding ALT+TAB will activate the flip 2D to switch from a window to another. The problem is that this function remains active for a very short time and I'm not able to select the window I want in the foreground. I also noticed that when I put the cursor on an icon on the taskbar, the live preview thumbnail disappears quickly. With a safe mode restart the problem is no longer there, all is fine! With a clean install of Windows 8.1(no driver and applications installed) the problem is here again; obviously disappears with a safe mode restart also in this situation. What's the problem? A Windows process or service?

    Read the article

  • VPN PPTPD with MPPE Support for Debian or Ubuntu

    - by user78395
    Having an unencrypted vpn connection from a windows client to linux is pretty easy by using pptpd. When I was looking for an solution for encrypted (per MPPE) connection, I found a lot of information about patching the kernel etc. - so it definitly works after some work. But all these information is pretty old (2005-2006). Is it the same solution nowadays? I am not asking for a complete instruction (only if it's short) - I am more asking for a link to the right solution.

    Read the article

  • Migrating users and IIS settings from a workgroup win2k3 machine to a new win2k8r2

    - by amber
    I am retiring my old Windows Server 2003 Standard 32bit machine to a new machine with Windows Server 2008 R2 Standard. The two sticking points are migrating user accounts (and there are a lot of them) and IIS settings/websites (again, there are a lot). The new machine has not been provisioned yet. I'm at that point where I'm about install the OS on it. The old machibe is configured with a mirrored set for its OS and data partitions. I have broken the mirror set, replicated all of the data to an external drive, and then rebuilt the mirror set. In short, I have an image of the old machine to play with while safely leaving it up and running. Thanks!

    Read the article

  • Sending XML to Servlet from Action Script

    - by John Doe
    I am only getting empty arrays on output. Anyone know what Exactly I'm doing wrong? package myDungeonAccessor; /* * To change this template, choose Tools | Templates * and open the template in the editor. */ import java.io.IOException; import java.io.ObjectInputStream; import java.io.ObjectOutputStream; import java.io.PrintWriter; import javax.servlet.ServletException; import javax.servlet.http.HttpServlet; import javax.servlet.http.HttpServletRequest; import javax.servlet.http.HttpServletResponse; public class myDungeonAccessorServlet extends HttpServlet { private myDungeonAccessor dataAccessor; /** * Processes requests for both HTTP <code>GET</code> and <code>POST</code> methods. * @param request servlet request * @param response servlet response * @throws ServletException if a servlet-specific error occurs * @throws IOException if an I/O error occurs */ protected void processRequest(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException { response.setContentType("text/html;charset=UTF-8"); PrintWriter out = response.getWriter(); try { /* TODO output your page here out.println("<html>"); out.println("<head>"); out.println("<title>Servlet myDungeonAccessorServlet</title>"); out.println("</head>"); out.println("<body>"); out.println("<h1>Servlet myDungeonAccessorServlet at " + request.getContextPath () + "</h1>"); out.println("</body>"); out.println("</html>"); */ } finally { out.close(); } } // <editor-fold defaultstate="collapsed" desc="HttpServlet methods. Click on the + sign on the left to edit the code."> /** * Handles the HTTP <code>GET</code> method. * @param request servlet request * @param response servlet response * @throws ServletException if a servlet-specific error occurs * @throws IOException if an I/O error occurs */ @Override protected void doGet(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException { processRequest(request, response); // PrintWriter out = response.getWriter(); System.out.println("yo mom"); } /** * Handles the HTTP <code>POST</code> method. * @param request servlet request * @param response servlet response * @throws ServletException if a servlet-specific error occurs * @throws IOException if an I/O error occurs */ @Override protected void doPost(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException { //System.out.println("heppo"); //dataAccessor = new myDungeonAccessor(); System.out.println("Hello"); try { System.out.println("HEADERS: " + request.getHeaderNames()); ObjectInputStream in = new ObjectInputStream(request.getInputStream()); ObjectOutputStream out = new ObjectOutputStream(response.getOutputStream()); } catch(Exception e) { e.printStackTrace(); } System.out.println("WAZZUP"); byte [] buffer = new byte[4096]; //in.read(buffer); System.out.println("TEST!"); String s = new String(buffer); System.out.println("Update S:" + s); } /** * Returns a short description of the servlet. * @return a String containing servlet description */ @Override public String getServletInfo() { return "Short description"; } }

    Read the article

  • Help with Corrupt version of IE8 on WinXPsp3

    - by Anon
    I've upgrade from IE6 to 7 to 8 and back down and back up, but still have critical issues in IE such as * cannot see any version info in "about internet explorer" * cannot run windows update * cannot load SharePoint pages (and other pages using ActiveX or IE-specific dhtml) I've also re-installed sp3, but still no luck. Also, also - I've changed security settings to be most permissive. Next step is blowing it all away and starting with windows7. Short of that, any suggestions are welcome. Thanks in advance.

    Read the article

  • Apache+FastCGI Timeout Error: "has failed to remain running for 30 seconds given 3 attempts, its restart interval has been backed off to 600 seconds"

    - by Sadjad Fouladi
    I've recently installed mod_fastcgi and Apache 2.2. I have a simple cgi script as below (test.fcgi): #!/bin/sh echo sadjad But when I invoke 'mysite.com/test.fcgi' I see "Internal Server Error" after a short period of time. The error.log file shows this error message: [Tue Jan 31 22:23:57 2006] [warn] FastCGI: (dynamic) server "~/public_html/oaduluth/dispatch.fcgi" has failed to remain running for 30 seconds given 3 attempts, its restart interval has been backed off to 600 seconds This is my .htaccess file: AddHandler fastcgi-script .fcgi RewriteEngine On RewriteCond %{REQUEST_FILENAME} !-f RewriteRule ^(.*)$ django.fcgi/$1 [QSA,L] What could the problem be? Is it my .htaccess file?

    Read the article

  • Download web server structure with empty files

    - by golimar
    I want to make a mirror of a Web server, but downloading the actual files will take too long. So I thought of having just the directory and file structure, and when I need the actual contents of the file, I can download just that file. I have tried wget --spider URL and in a short time it has created in my local disk the directory structure with no files. But I've checked all of wget's or curl's switches and there is nothing like what I need. Can this be done with wget, curl or any other tool?

    Read the article

  • Fixing Windows 7 explorer issues

    - by Cegorach
    OK, so here is the problem I'm hoping you guys can help me fix. On my Win7-Ult64 box, my explorer (among other things) has decided not to work. For example, if I try to use a program, say Chrome, to open a folder, I will get the message "Class not registered" (and its not program specific). In the same vein, when I go to Start-Rclick Computer-properties, nothing happens, but I can go to control panel-system properties and it will work. And other items in the control panel do nothing when I click them (and I have a feeling it is all tied together). I have already done multiple virus and spyware sweeps, so I know that isn't the problem. Any suggestions on what could be causing this/how to fix it (short of nuke and boot)?

    Read the article

  • virtual machines: optimal host os to run Windows XP guest os?

    - by user61132
    My department doesn't have the budget to upgrade my ailing Dell D620 laptop. However, I do have the option to buy my own personal computer, then use my company-issued ISO image to run Windows XP as my guest os using virtualbox or vmware. Therefore, last month, I bought an Acer AX3910-U3012 desktop that had Windows 7 as the host os (and 8G RAM). In short, I was disappointed with the performance while trying to run WinXP as the guest os. (It didn't perform much better than my laptop.) Just wondering what the optimal host os would be for running Windows XP as the guest os? (No, I can't use my company-issued ISO image to build the os for my personal computer.) FWIW, I'm willing to spend up to $2k if it's REALLY worth it, but would prefer to spend no more than $1k. Also, in an effort to cut costs, I'd prefer buy a desktop instead of a laptop. Thanks for any/all feedback.

    Read the article

  • Open application in background without losing current window focus. Fedora 17, Gnome 3

    - by Ishan
    I'm running a script in the background which loads an image with feh depending on which application is currently in focus. However, whenever the script opens the image, window focus is lost to feh. I was able to circumvent this by using xdotool to switch back to the application that was originally in focus, but this introduces a short annoying period of time where the focus is switched from feh to the application. My question is this: is there any way to launch feh in the background such that window focus is NOT lost? System: Fedora 17, Gnome 3, Bash Thanks a ton!

    Read the article

  • svnrepo + trac hosting

    - by Shikhar
    Does anyone know of a good and economic svn + trac hosting site. Specific requirements 1) trac hooks should be in place, which enables commmit messages to be updated in trac issues. 2) It should have emailTotracScript or MailToTracPlugin installed, with which an issue can be reported via email. If its located in Asia pacific it would be great, as time delay from the US is very high. I am already using sourcerepo.com and its very good. Only short coming is they dont have emailtotrac and the time delay is significant. any other inputs would be helpful. TIA

    Read the article

  • Why is the System process listening on Port 443?

    - by ClearsTheScreen
    I am having problems starting my apache server, because port 443 is already in use. It turns out, the system process (PID 4) uses the port 443. I don't have IIS installed, the services.msc shows (predicatbly) no Exchange server running, nor WWW-Services, nor IIS. I have no idea how to find out what service uses that port short of just disabling each service one after the other, and I am not even sure that would help. I would be grateful if someone could point me towards how I can get my SSL port back, thank you :) P.S.: Of course "just switch apache to another port for SSL" would solve the problem of not being able to start apache. But I'd still like to know what is so insistent about hogging port 443. :)

    Read the article

  • How to explain DRM cannot work?

    - by jerryjvl
    I am looking for the shortest comprehensive way to explain to people that are trying to use DRM as a technology to prevent users from using their data in some fashion deemed undesirable, why their solution cannot work by definition. Ideally I'd like something that: Covers why technically it is impossible to have people access local data, but only in such-and-such a way Imparts an understanding of why this is, to avoid follow-on "But what if" rebuttals Is intuitive enough and short enough that even a politician (j/k) could grasp it When faced with this situation I try to be clear and concise, but I usually end up failing at least on one of these points. I'd really like to have a 'stock' answer that I can use in the future.

    Read the article

  • Why can't email clients create rules for moving dates like "yesterday"?

    - by Morgan
    I've never seen an email client that I could easily create a rule to do something like "Move messages from yesterday to a folder?" Is there some esoteric reason why this would be difficult? I know I can easily create rules around specific dates, but that isn't the same thing by a long shot; am I missing something? In Outlook 2010 I can create search folders that do sort of this type of thing, but you can't create rules around a search folder... seems like either I am missing something major, or this is terribly short-sided.

    Read the article

  • Make the recycle bin of the SSD on a RAID0 drive?

    - by Rolnik
    I don't know about you folks, but I hate the idea of junk sitting on my tiny 30GB SSD. Any way to designate another drive to be the host of the Recycle Bin for items formerly on the SSD? Basically, I need to know how to make a lower-priority drive receive the recycled materials from the 'main' drive, which happens to be short on space. The best thing I can think of is a batch file that a) syncs 'recycle' to another drive; and b) empties the recycle bin. ... but that's too much work for me.

    Read the article

< Previous Page | 89 90 91 92 93 94 95 96 97 98 99 100  | Next Page >