Search Results

Search found 5908 results on 237 pages for 'cody short'.

Page 95/237 | < Previous Page | 91 92 93 94 95 96 97 98 99 100 101 102  | Next Page >

  • Right-aligning button in a grid with possibly no content - stretch grid to always fill the page

    - by Peter Perhác
    Hello people, I am losing my patience with this. I am working on a Windows Phone 7 application and I can't figure out what layout manager to use to achieve the following: Basically, when I use a Grid as the layout root, I can't make the grid to stretch to the size of the phone application page. When the main content area is full, all is well and the button sits where I want it to sit. However, in case the page content is very short, the grid is only as wide as to accommodate its content and then the button (which I am desperate to keep near the right edge of the screen) moves away from the right edge. If I replace the grid and use a vertically oriented stack panel for the layout root, the button sits where I want it but then the content area is capable of growing beyond the bottom edge. So, when I place a listbox full of items into the main content area, it doesn't adjust its height to be completely in view, but the majority of items in that listbox are just rendered below the bottom edge of the display area. I have tried using a third-party DockPanel layout manager and then docked the button in it's top section and set the button's HorizontalAlignment="Right" but the result was the same as with the grid, it also shrinks in size when there isn't enough content in the content area (or when title is short). How do I do this then? ==EDIT== I tried WPCoder's XAML, only I replaced the dummy text box with what I would have in a real page (stackpanel) and placed a listbox into the ContentPanel grid. I noticed that what I had before and what WPCoder is suggesting is very similar. Here's my current XAML and the page still doesn't grow to fit the width of the page and I get identical results to what I had before: <phone:PhoneApplicationPage x:Name="categoriesPage" x:Class="CatalogueBrowser.CategoriesPage" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" xmlns:phone="clr-namespace:Microsoft.Phone.Controls;assembly=Microsoft.Phone" xmlns:shell="clr-namespace:Microsoft.Phone.Shell;assembly=Microsoft.Phone" xmlns:d="http://schemas.microsoft.com/expression/blend/2008" xmlns:mc="http://schemas.openxmlformats.org/markup-compatibility/2006" FontFamily="{StaticResource PhoneFontFamilyNormal}" FontSize="{StaticResource PhoneFontSizeNormal}" Foreground="{StaticResource PhoneForegroundBrush}" SupportedOrientations="PortraitOrLandscape" Orientation="Portrait" mc:Ignorable="d" d:DesignWidth="480" d:DesignHeight="768" xmlns:ctrls="clr-namespace:Microsoft.Phone.Controls;assembly=Microsoft.Phone.Controls.Toolkit" shell:SystemTray.IsVisible="True"> <Grid x:Name="LayoutRoot" Background="Transparent"> <Grid.RowDefinitions> <RowDefinition Height="Auto"/> <RowDefinition Height="*"/> </Grid.RowDefinitions> <Grid> <Grid.ColumnDefinitions> <ColumnDefinition Width="*" /> <ColumnDefinition Width="Auto" /> </Grid.ColumnDefinitions> <StackPanel Orientation="Horizontal" VerticalAlignment="Center" > <TextBlock Text="Browsing:" Margin="10,10" Style="{StaticResource PhoneTextTitle3Style}" /> <TextBlock x:Name="ListTitle" Text="{Binding DisplayName}" Margin="0,10" Style="{StaticResource PhoneTextTitle3Style}" /> </StackPanel> <Button Grid.Column="1" x:Name="btnRefineSearch" Content="Refine Search" Style="{StaticResource buttonBarStyle}" FontSize="14" /> </Grid> <Grid x:Name="ContentPanel" Grid.Row="1"> <ListBox x:Name="CategoryList" ItemsSource="{Binding Categories}" Style="{StaticResource CatalogueList}" SelectionChanged="CategoryList_SelectionChanged"/> </Grid> </Grid> </phone:PhoneApplicationPage> This is what the page with the above XAML markup looks like in the emulator:

    Read the article

  • preloading RSS contents in thunderbird, before actually reading them

    - by Berry Tsakala
    i have thunderbird 3.x, and i'm subscribed to several RSS feeds. How can I tell thunderbird to load/download any new RSS items in the background? The usual behavior with RSS feeds is that it download the headrs, or few introductory lines from the contents, but only when i'm clicking a feed item it starts loading "for real". I really want to receive the feeds and not to wait for them to load, the same way i receive emails in any email client - all messages are fully downloaded at once. there could be several reasons, BTW. - e.g. if i have short connection time, i'd rather connect, sync everything at once, and read it later. - or if i have a slow wifi connection, it's annoying to wait for each and every message, but the computer is idle while reading.. thanks

    Read the article

  • Lots of artifacts while streaming HD content with VLC 0.9.9 on CentOS

    - by Zsub
    I'm trying to stream (multicast) a x264 encoded file using VLC. This in itself succeeds, but the stream has a huge lot of artifacts. This seems to suggest that the data cannot be transported fast enough. If I check network usage, though, it's only using about 15 mbit. I have a similar SD stream which functions perfectly. I think I could improve stream performance by not streaming the raw data, but I cannot seem to get this working. It seems that on keyframes all artifacts are removed for a short while (less than a second). This is the command I use: vlc -vv hdtest.mkv --sout '#duplicate{dst=rtp{dst=ff02::1%eth1,mux=ts,port=5678,sap,group="Testgroup",name="TeststreamHD"}}' --loop Which is all one long line.

    Read the article

  • Link two or more text boxes in Visio

    - by Dan
    I am working on creating a template in Visio 2007 (Professional). Each page should reflect a document number and a revision number (two text boxes). I would like to make the template such that entering or changing text in one of these boxes on one page will automatically update the equivalent text boxes on all other pages. Is there an easy way to link two (or more) text boxes to show the same data (mirror each other)? I've looked into creating a ShapeData set and then using the ShapeData field in place of each box, but this will require training others to access and adjust the ShapeData field. In short - I want the issue that was attempting to be solved in Changing Text in Visio Org Chart Shape Changes Multiple Shapes' Text .

    Read the article

  • Optimize Windows file access over network

    - by Djizeus
    At my company I frequently need to access shared files over a Windows network. These files are located on the other side of the planet, so I guess the file share goes through some kind of VPN over Internet, but I don't control this and it is supposed to be "transparent" for me. However it is extremely slow. Displaying the content of a directory in the file explorer takes about 10s. Even if over the Internet, I did not expect that retrieving a list of file names would be that long. Are there any settings to optimize this from my Windows XP workstation, or is it mostly related to the way the network is configured? The only thing I have found so far is to cache all file names, while by default only short file names are cached (http://support.microsoft.com/kb/843418).

    Read the article

  • Computer freezes, wireless network icon disappears

    - by Heidi
    As you can see I have two problems. I have a Toshiba Tecra A3 computer. It is 5-6 years old and it is connected to a D-link router. For a period now it has not been working correctly. The computer freezes either when i try turning it on or when I have been using the computer for a short period of time. The times the computer works normally I have a problem with a disappearing wireless network icon, and so I have no internet. Can this be fixed or do I have to buy a new computer? I only use the computer for internet surfing and easy tasks like word etc, so I would like to keep it as long as possible.

    Read the article

  • not able to make entry of ubuntu 10.04 grub.cfg into redhat 5.1 menu.lst file to run 2 linux os and

    - by Deepak Narwal
    Hello friend... In my computer there are three operating systems.. First i installed Windows 7 then i installed ubuntu 10.04 and in last i installed redhat 5.1 NOw i know one thing as i installed redhat then grub installed by ubuntu will be overwritten by redhat grub..and i know that to see all three operating syetm at the startup i have to make entry of /boot/grub/cfg into /boot/grub/menu.lst file.. Now the problem is like this In te previous version it was very easy to play with ubuntu grub file but now this file is modified..NOw i dont know what is to be picked up from ubuntu /grub/grub.cfg file so that i can make entry in redhat /boot/grub/menu.lst file.. In short i am not able to put entry of grub.cfg file into redhat menu.lst file.. will u help me plz i want to work on these thre eOS..

    Read the article

  • Upgrade Subversion 1.6 to 1.7 on CentOS? (can't find yum repository)

    - by user743919
    I want to upgrade my SVN Server from 1.6 to 1.7. Unfortunately I can't find anything on the internet how to do this with yum. I have checked rpmforge-extras but it has only svn 1.6 and not 1.7 I wanted to update with yum because this is the most secure way for me. I'm not an experienced Linux user. Is there a yum repository that contains 1.7 (subversion.x86_64 0:1.7.xxxxx.el5.rfx) I hope somebody can help me out? If there is non, perhaps a short explenation how to update with just step by step.

    Read the article

  • WD Elements Desktop External - Not recognised on a single computer

    - by Aelexe
    My WD Elements Desktop External is no longer recognised on my main computer. It has worked fine in the past, but now all of a sudden is not detected. It does not prompt when plugged in, nor does it show up in the disc management interface or the device manager. It appears to be aware that it is plugged in however as the light on the external blinks rapidly for a short while after being plugged in. The strangest thing however is that it works fine on other computers, including my family computers and my laptop. I have attempted to troubleshoot the issue by trying various USB devices in multiple ports on each system to see if there is any correlation with the issue, but have come up with nothing that gives me an idea of what is going on. I have also attempted to format the external using my laptop, but that has not helped either. If anyone has had a similar issue, or knows of any potential solutions, please post your advice. Thanks for your time.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Bringing my Dell XPS 13 ultrabook back to factory state

    - by TysHTTP
    I have a brand new Dell XPS 13 ultra book. After i picked it up at the store, i wiped the exising partitions which also contained the restore/rescue data, which you need to reinstall the factory version of Windows 8 that comes with this machine. I did this because we have a different MS partner edition of Windows which i prefer to run. After doing all this, i noticed that there was something wrong with machine. No real damage, but the specs are not completely as they should be. Turned out that a simple mistake while ordering. Now, long story short, the shop says that it has no problem with taking the product back, as long as it is in it's original state. And this is the problem i'm having, because i formatted the original partitions that contain that rescue option / windows 8 setup, i don't have a clue whether it's possible to get back to that original. Does anyone have an idea on how to get this fixed?

    Read the article

  • Boost Up My Old Laptop Using a SSD

    - by Sina Bizbone
    I have an old laptop Lenovo SL400 (Core2Due T9550 2.66GHz / 4GB DDR2 Ram). Since I can't afford to buy a new laptop, I thought maybe I could throw an ADATA SP600 64GB SSD as primary drive and move my current HDD to DVD-ROM space by using HDDCADDY. I know that 64gb will come short after installing Visual Studio, SQL Server, etc. So is there anyway to just install the kernel part of windows on SSD and the rest on HDD. Doesn't windows have built-in support to do this? (ReadyBoost is out of picture since it's just simple caching)

    Read the article

  • ALT+TAB doesn't work properly in Windows 8.1

    - by Marco1
    Holding ALT+TAB will activate the flip 2D to switch from a window to another. The problem is that this function remains active for a very short time and I'm not able to select the window I want in the foreground. I also noticed that when I put the cursor on an icon on the taskbar, the live preview thumbnail disappears quickly. With a safe mode restart the problem is no longer there, all is fine! With a clean install of Windows 8.1(no driver and applications installed) the problem is here again; obviously disappears with a safe mode restart also in this situation. What's the problem? A Windows process or service?

    Read the article

  • Migrating users and IIS settings from a workgroup win2k3 machine to a new win2k8r2

    - by amber
    I am retiring my old Windows Server 2003 Standard 32bit machine to a new machine with Windows Server 2008 R2 Standard. The two sticking points are migrating user accounts (and there are a lot of them) and IIS settings/websites (again, there are a lot). The new machine has not been provisioned yet. I'm at that point where I'm about install the OS on it. The old machibe is configured with a mirrored set for its OS and data partitions. I have broken the mirror set, replicated all of the data to an external drive, and then rebuilt the mirror set. In short, I have an image of the old machine to play with while safely leaving it up and running. Thanks!

    Read the article

  • How to force Windows XP to rename a file with a special character?

    - by codeLes
    I have a song that Windows can't play because there is a question mark in the name of the file. "Where Have All the Cowboys Gone?.ogg" // as an example So I try to rename it and Windows complains whether I try it in Explorer or from command prompt. Error I get when trying to copy, rename, or move is: The Filename, directory name, or volume label syntax is incorrect Is there a Windows way to force a rename in this case? Update I'll keep an eye on this question, but after 13 answers and many attempts (aside form 3rd party solutions) it seems that Windows can't do this (or at least my windows can't, no short names). So I'm accepting the answer which was my original solution anyway of using Linux. It would be nice to see Windows handle this somehow, so don't stop just because I've accepted this answer, the question still stands!

    Read the article

  • VPN PPTPD with MPPE Support for Debian or Ubuntu

    - by user78395
    Having an unencrypted vpn connection from a windows client to linux is pretty easy by using pptpd. When I was looking for an solution for encrypted (per MPPE) connection, I found a lot of information about patching the kernel etc. - so it definitly works after some work. But all these information is pretty old (2005-2006). Is it the same solution nowadays? I am not asking for a complete instruction (only if it's short) - I am more asking for a link to the right solution.

    Read the article

  • Sending XML to Servlet from Action Script

    - by John Doe
    I am only getting empty arrays on output. Anyone know what Exactly I'm doing wrong? package myDungeonAccessor; /* * To change this template, choose Tools | Templates * and open the template in the editor. */ import java.io.IOException; import java.io.ObjectInputStream; import java.io.ObjectOutputStream; import java.io.PrintWriter; import javax.servlet.ServletException; import javax.servlet.http.HttpServlet; import javax.servlet.http.HttpServletRequest; import javax.servlet.http.HttpServletResponse; public class myDungeonAccessorServlet extends HttpServlet { private myDungeonAccessor dataAccessor; /** * Processes requests for both HTTP <code>GET</code> and <code>POST</code> methods. * @param request servlet request * @param response servlet response * @throws ServletException if a servlet-specific error occurs * @throws IOException if an I/O error occurs */ protected void processRequest(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException { response.setContentType("text/html;charset=UTF-8"); PrintWriter out = response.getWriter(); try { /* TODO output your page here out.println("<html>"); out.println("<head>"); out.println("<title>Servlet myDungeonAccessorServlet</title>"); out.println("</head>"); out.println("<body>"); out.println("<h1>Servlet myDungeonAccessorServlet at " + request.getContextPath () + "</h1>"); out.println("</body>"); out.println("</html>"); */ } finally { out.close(); } } // <editor-fold defaultstate="collapsed" desc="HttpServlet methods. Click on the + sign on the left to edit the code."> /** * Handles the HTTP <code>GET</code> method. * @param request servlet request * @param response servlet response * @throws ServletException if a servlet-specific error occurs * @throws IOException if an I/O error occurs */ @Override protected void doGet(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException { processRequest(request, response); // PrintWriter out = response.getWriter(); System.out.println("yo mom"); } /** * Handles the HTTP <code>POST</code> method. * @param request servlet request * @param response servlet response * @throws ServletException if a servlet-specific error occurs * @throws IOException if an I/O error occurs */ @Override protected void doPost(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException { //System.out.println("heppo"); //dataAccessor = new myDungeonAccessor(); System.out.println("Hello"); try { System.out.println("HEADERS: " + request.getHeaderNames()); ObjectInputStream in = new ObjectInputStream(request.getInputStream()); ObjectOutputStream out = new ObjectOutputStream(response.getOutputStream()); } catch(Exception e) { e.printStackTrace(); } System.out.println("WAZZUP"); byte [] buffer = new byte[4096]; //in.read(buffer); System.out.println("TEST!"); String s = new String(buffer); System.out.println("Update S:" + s); } /** * Returns a short description of the servlet. * @return a String containing servlet description */ @Override public String getServletInfo() { return "Short description"; } }

    Read the article

  • How to force Windows XP to rename a file with a special character?

    - by codeLes
    I have a song that Windows can't play because there is a question mark in the name of the file. "Where Have All the Cowboys Gone?.ogg" // as an example So I try to rename it and Windows complains whether I try it in Explorer or from command prompt. Error I get when trying to copy, rename, or move is: The Filename, directory name, or volume label syntax is incorrect Is there a Windows way to force a rename in this case? Update I'll keep an eye on this question, but after 13 answers and many attempts (aside form 3rd party solutions) it seems that Windows can't do this (or at least my windows can't, no short names). So I'm accepting the answer which was my original solution anyway of using Linux. It would be nice to see Windows handle this somehow, so don't stop just because I've accepted this answer, the question still stands!

    Read the article

  • Is Exchange protected from/allow back dated emails?

    - by David
    Does Exchange Server adequately protect against backdating items in a mailbox folder? I want to determine from an auditing perspective what level of risk exists/what trust can be put into Exchange database records. Is there a (mis)feature that allows end point users to modify the sent/recieved date fields on their own messages? Is there a reasonable way short of hand editing the files for an Exchange Server admin to make such a change? And most importantly: Is there any kind of "sequence number" that we could use to audit Exchange records for evidence of date manipulation (ex. msg100 = Dec 15, msg101 = Dec 10, msg102 = Dec 16)

    Read the article

  • Download web server structure with empty files

    - by golimar
    I want to make a mirror of a Web server, but downloading the actual files will take too long. So I thought of having just the directory and file structure, and when I need the actual contents of the file, I can download just that file. I have tried wget --spider URL and in a short time it has created in my local disk the directory structure with no files. But I've checked all of wget's or curl's switches and there is nothing like what I need. Can this be done with wget, curl or any other tool?

    Read the article

  • Fixing Windows 7 explorer issues

    - by Cegorach
    OK, so here is the problem I'm hoping you guys can help me fix. On my Win7-Ult64 box, my explorer (among other things) has decided not to work. For example, if I try to use a program, say Chrome, to open a folder, I will get the message "Class not registered" (and its not program specific). In the same vein, when I go to Start-Rclick Computer-properties, nothing happens, but I can go to control panel-system properties and it will work. And other items in the control panel do nothing when I click them (and I have a feeling it is all tied together). I have already done multiple virus and spyware sweeps, so I know that isn't the problem. Any suggestions on what could be causing this/how to fix it (short of nuke and boot)?

    Read the article

  • Apache+FastCGI Timeout Error: "has failed to remain running for 30 seconds given 3 attempts, its restart interval has been backed off to 600 seconds"

    - by Sadjad Fouladi
    I've recently installed mod_fastcgi and Apache 2.2. I have a simple cgi script as below (test.fcgi): #!/bin/sh echo sadjad But when I invoke 'mysite.com/test.fcgi' I see "Internal Server Error" after a short period of time. The error.log file shows this error message: [Tue Jan 31 22:23:57 2006] [warn] FastCGI: (dynamic) server "~/public_html/oaduluth/dispatch.fcgi" has failed to remain running for 30 seconds given 3 attempts, its restart interval has been backed off to 600 seconds This is my .htaccess file: AddHandler fastcgi-script .fcgi RewriteEngine On RewriteCond %{REQUEST_FILENAME} !-f RewriteRule ^(.*)$ django.fcgi/$1 [QSA,L] What could the problem be? Is it my .htaccess file?

    Read the article

  • Help with Corrupt version of IE8 on WinXPsp3

    - by Anon
    I've upgrade from IE6 to 7 to 8 and back down and back up, but still have critical issues in IE such as * cannot see any version info in "about internet explorer" * cannot run windows update * cannot load SharePoint pages (and other pages using ActiveX or IE-specific dhtml) I've also re-installed sp3, but still no luck. Also, also - I've changed security settings to be most permissive. Next step is blowing it all away and starting with windows7. Short of that, any suggestions are welcome. Thanks in advance.

    Read the article

  • Open application in background without losing current window focus. Fedora 17, Gnome 3

    - by Ishan
    I'm running a script in the background which loads an image with feh depending on which application is currently in focus. However, whenever the script opens the image, window focus is lost to feh. I was able to circumvent this by using xdotool to switch back to the application that was originally in focus, but this introduces a short annoying period of time where the focus is switched from feh to the application. My question is this: is there any way to launch feh in the background such that window focus is NOT lost? System: Fedora 17, Gnome 3, Bash Thanks a ton!

    Read the article

  • Use test to check for condition with find and execdir option

    - by slosd
    I think I can keep my question short. Why does the following command produce no output? find /usr/share/themes -mindepth 1 -maxdepth 1 -type d -execdir test -d {}/gnome-shell \; I expected it to print all folders in /usr/share/themes that contain a folder gnome-shell. Several websites suggest that this usage of test as a command in exec/execdir is possible. From man find: -exec command ; Execute command; true if 0 status is returned. [...]

    Read the article

< Previous Page | 91 92 93 94 95 96 97 98 99 100 101 102  | Next Page >