Search Results

Search found 89673 results on 3587 pages for 'code conversion'.

Page 96/3587 | < Previous Page | 92 93 94 95 96 97 98 99 100 101 102 103  | Next Page >

  • How to convert a power point pdf to a pdf that is easy to read on kindle?

    - by SpaceTrucker
    I have several power point presentations as pdfs. I would like to read them on the original kindle in landscape format. When I read the original on the kindle then a single slide won't fit on the kindles display. I thought the easiest way to convert the pdf was to repring it with a pdf printer. However I don't know the paper size to use. I already tried using Calibre as suggested by this question. However the output is not usable because of formatting issues. So what paper size should I use for the pdf printer to reprint them in landscape format or are there any other tools I could use for that task?

    Read the article

  • creating video from set of images on windows with java language [on hold]

    - by Atif
    I am stuck in making video from set of images, i am using ffmpeg tool on windows platform with java language, for single image it is converting into mp4 but for the set of images it gets failed, i have converted single % to double % with doube quotes but unsuccessful ffmpeg -r 1/5 -i "D:\novoworkspace\MGram\src\biz\novosol\mgram\main\img%%04d.jpg" -c:v libx264 -r 30 -pix_fmt yuv420p D:\novoworkspace\MGram\src\biz\novosol\mgram\main\video.mp4 Above is the exact command i tried from the command line as well from the java language with getRuntime() method. Environment is widows please suggest is it possibe under windows or I have to use some alternative Thanks Atif

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • How to run a command from anywhere in Mac OS X

    - by pabloruiz55
    I need to use a command for converting my images to pvrtc. It is located in /Developer/Platforms/iPhoneOS.platform/Developer/usr/bin/texturetool. Right now I have to be inside that folder to be able to use the command. How can I set it up so I can run this command from anywhere? Thanks

    Read the article

  • convert video to images

    - by Liam
    How can I convert a video file to a sequence of images, for example one frame every N seconds. Can mplayer or ffmpeg do this? I have used MPlayer to grab screenshots manually but I would like to automate this for a long video.

    Read the article

  • How to convert a 1 page PDF to a 2 page per sheet PDF?

    - by mokasin
    I would like to print a PDF so that on the front of the first page are the first two pages, on the back the 3rd and 4th and so on. ----------------- ----------------- | | | | | | | | | | | | | 1 | 2 | | 3 | 4 | . . . | | | | | | |_______|_______| |_______|_______| page 1 - front page 1 - front Because my printer using Linux fails to support manual duplex printing I'd thought, maybe I could edit the pdf in a according way. But how?

    Read the article

  • How can I reorder parts of a video file

    - by sandeep
    I have download a mkv movie file which gave me 3 files suffixed .001, .002, and .003. When i join them together with different tools like winrar, 7zip, hjsplit, concatenated file shows only last 40 min/1.22 hrs of the total length of the movie. If I play all the (.001, .002, .003) parts with vlc player, I can see that .003 is the first part of the video and .001 is the last part. Can anyone tell me how can join this parts of movie with correct position or how I can convert .003 file into .001 file.

    Read the article

  • Convert video from .mp4 to .ogg

    - by Unknown
    I am using ffmpeg version 0.11.1 Copyright (c) 2000-2012 the FFmpeg developers . I need to convert a file .mp4, to .ogg format. I am on Mac OS X, and I have tried this so far: ffmpeg -i sample_mpeg4.mp4 -acodec vorbis -vcodec libtheora -f ogg output.ogv I am getting: Unknown encoder 'libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec --enable-libtheora output.ogv I am getting: Unknown encoder '--enable-libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec libtheora -f ogv output.ogv I am getting: [NULL @ 0x7f81bb00f800] Requested output format 'ogv' is not a suitable output format output.ogv: Invalid argument ffmpegtheora is not an option as it can not be install on the server.

    Read the article

  • How to train users converting from PC to Mac/Apple at a small non profit?

    - by Everette Mills
    Background: I am part of a team that provides volunteer tech support to a local non profit. We are in the position to obtain a grant to update almost all of our computers (many of them 5 to 7 year old machines running XP), provide laptops for users that need them, etc. We are considering switching our users from PC (WinXP) to Macs. The technical aspects of switching will not be an issue for the team. We are in the process of planning data conversions, machine setup, server changes, etc regardless of whether we switch to Macs or much newer PCs. About 1/4 of the staff uses or has access to a Mac at home, these users already understand the basics of using the equipment. We have another set of (generally younger) users that are technically savvy and while slightly inconvenienced and slowed for a few days should be able to switch over quickly. Finally, several members of the staff are older and have many issues using there computers today. We think in the long run switching to Macs may provide a better user experience, fewer IT headaches, and more effective use of computers. The questions we have is what resources and training (webpages, Books, online training materials or online courses) do you recommend that we provide to users to enable the switchover to happen smoothly. Especially, with a focus on providing different levels of training and support to users with different skill levels. If you have done this in your own organization, what steps were successful, what areas were less successful?

    Read the article

  • Connecting Samsung Note 3 to Hitachi CPX3030WN via Samsung MHL 2.0 HD kit , Will there be video output? [on hold]

    - by Monolord's Knight
    I need the video output to projector. but nobody can assure me this may work or not. some says yes some says no.But they have no real experience. Some says an special android app is required for this. Depending on this answer, I will purchase Samsung MHL 2.0 cable . If it wont work it will be no use for me. I don't have a way to change my phone or projector. Just want to know will it work or not. Thanks

    Read the article

  • how can i edit my admission form which i filled wrong . their is no other form is avilable now ...what i do ??? [closed]

    - by user60065
    Hi, I am a 2nd year student in graduation. Recently I filled an admission form for final year admission but it came back to me after 2 days because I had entered wrong information. I want to edit the wrong information and I have scanned the form. I am looking for a good online site where I can upload the scanned document and convert same into an editable format. I don’t mind paying. If any can point to a good site will be great & thanks in advance

    Read the article

  • CodeIt.Right Code File Header Template For StyleCop Rules

    - by Paulo Morgado
    I like to use both StyleCop and CodeIt.Right to validate my code – StyleCop because it’s free and CodeIt.Right because it’s really good. While StyleCop provides only validation, CodeIt.Righ provides both validation and correction of violations. Unfortunately, CodeIt.Right’s supplied template for code file headers does not conform to StyleCop rules. Fortunately, CodeIt.Right allows us to define our own template. Here’s the one I use: <#@ template language="C#" #> //----------------------------------------------------------------------- // <copyright file="<#= System.IO.Path.GetFileName(Context.DestinationFile) #>" // project="<#= Context.ProjectName #>" // assembly="<#= Context.AssemblyName #>" // solution="<#= Context.SolutionName #>" // company="<#= Context.GetGlobalProperty("CompanyName") #>"> // Copyright (c) <#= Context.GetGlobalProperty("CompanyName") #>. All rights reserved. // </copyright> // <author id="<#= Context.GetGlobalProperty("UserID") #>"><#= Context.GetGlobalProperty("UserName") #></author> // <summary></summary> //-----------------------------------------------------------------------

    Read the article

  • AutoScroll panel working intermittently.

    - by Edward Boyle
    I spent hours last week trying to get AutoScroll to function properly on a derived/inherited panel control I have been writing. I found no answers on my own so I posted to several forums and move onto other code while I wait for a reply. Then out of nowhere, it started working properly. Now, Today (about a week later) I notice it is no longer working again!  I go back to those old posts with hopes I will find an answer – No such luck. I Google for about two hours reading everything I come across. I was just about to write a new custom control from the ground up, perhaps use a little unmanaged code to force things to function properly. All I knew was “options in front of me = dealys”.  Just before I gave up, my head in my hands,  Jordan Sirwin’s appropriately titled blog post: “C#: Windows Panel AutoScroll Bug / Intended Suckyness” saves the day! In order for scroll bars to display, there must be at least one control in the Panel with AutoSize set to true. This is absurd… I’m not sure if this is a bug or intended, but it’s stupid. –I feel your pain. How many others have spent hours on this, or worse,  just plain given up? I want those hours back Damnit!

    Read the article

  • Twin Cities Code Camp 8 Retrospective

    - by Lee Brandt
    I just got back (a few hours ago) from Minneapolis, where I was speaking at the Twin Cities Code Camp 8. I’d never been to a Twin Cities Code Camp, and I have always heard such great things, so I submitted and got accepted to speak. The conference (what I got to see) was great. My talk was pretty short on people, but there are many reasons for that. First, I spoke opposite Donn Felker (speaking about developing for Android) and Keith Dahlby (speaking about Dynamic .NET). So of course, my talk is going to be empty. How could I compete with that? Plus, my talk was about software process improvement, specifically about how our process has evolved. Maybe not the smartest idea to submit to talk about software process at a developer’s conference. The people who DID attend however, seemed to really enjoy the talk. There was good interaction and good, thoughtful questions. So the attendees seemed engaged. I actually did get a chance to go to one session. I went and saw Javier Lozano talk about Open source tools for ASP.NET MVC. I am hip-deep in MVC stuff right now and getting up to speed on MVC 2 as well. I learned about MVC Turbine, Javier’s Open Source project. I will definitely be adding it to my MVC arsenal. Thanks Javier! I did forget my AC adapter for my laptop and got a little lost in Minneapolis on my way to get one from MicroCenter Saturday morning, but other than that, it was a great trip. It’s a long drive, but seeing all the guys and getting two Nut & Honey rolls from Roly Poly in Eden Prarie for lunch on Saturday made the trip totally worth it. I look forward to seeing what Jason & Chris come up with for next year! Thanks for having me guys!

    Read the article

  • Java Road Trip: Code to Coast

    - by Tori Wieldt
    tweetmeme_url = 'http://blogs.oracle.com/javaone/2010/06/java_road_trip_code_to_coast.html'; Share .FBConnectButton_Small{background-position:-5px -232px !important;border-left:1px solid #1A356E;} .FBConnectButton_Text{margin-left:12px !important ;padding:2px 3px 3px !important;} The Java Road Trip: Code to CoastJava developers, architects, programmers, and enthusiasts: get ready for a real adrenaline rush! Follow the Java Road Trip: Code to Coast as this high-tech block party on wheels travels to 20 cities across the United States showcasing Oracle's commitment to everything Java. It's a chance to talk to Java leaders and engineers and get your hands on the latest Java technology. The Java Road Trip kicks off June 14 in New York City with Octavian Tanase, Vice President, Java Platform Group at Oracle, headlining the event. Don't miss    EJBs in Boston!    Governance in Washington, DC!    Swing(ing) in Memphis!    Mile-high UIs in Denver!    Java in Seattle! (too easy)     and more!Join or follow the tour here: http://java.com/roadtrip/Read the Oracle Magazine articleUse or follow the hash tag #javaroadtrip

    Read the article

  • Clean URLs issue using .htaccess in PHP project

    - by x4ph4r
    I am working on a PHP laravel project. I am currently facing issues with .htaccess file. I have following .htaccess: <IfModule mod_rewrite.c> Options -MultiViews RewriteEngine On RewriteBase / RewriteCond %{REQUEST_FILENAME} !-f RewriteRule ^ index.php [L] </IfModule> When I reload my page the it gave me following error: 404 Not Found The requested URL /contacts was not found on this server. Then I opened /etc/apache2/users/username.conf file which had following line of code: <Directory "/Users/username/Sites/"> Options Indexes MultiViews AllowOverride None Order allow,deny Allow from all </Directory> In above code I changed AllowOverride None to AllowOverride All. Then I reload page and got following error: 403 Forbidden You don't have permission to access /contacts on this server. When I add FollowSymLinks to .htaccess file Options such as like this Options -MultiViews FollowSymLinks. Then sometimes I get this 500 Internal Server Error error and sometime this *Error 324 (net::ERR_EMPTY_RESPONSE): The server closed the connection without sending any data*. Each time I reload my page one of these errors with FollowSymLinks option. I also uncomment following lines in /etc/apache2/httpd.conf: LoadModule rewrite_module libexec/apache2/mod_rewrite.so LoadModule php5_module libexec/apache2/libphp5.so and still I am getting same permission denied error. Please help me I am trying to solve this problem for past 3 days but it is till unresolved.

    Read the article

  • Printing problem in Silverlight 4.0 RC - loading images in code behind

    - by Jacek Ciereszko
    Few days ago I faced a problem with printing in new Silverlight 4 RC. When you try to dynamically load image (in code behind) and print it, it doesn't work. Paper sheet is blank. Problem XAML file: <Image x:Name="image" Stretch="None" /> XAML.cs: image.Source = new BitmapImage(new Uri(imageUri, UriKind.RelativeOrAbsolute));  Print: var pd = new PrintDocument();   pd.PrintPage += (s, args) =>     {       args.PageVisual = image;     };   pd.Print(); Result: Blank paper.   Solution What you need to do, is forced Silverlight engine to load that image before printing start. To accomplish that I proposed simply checking PixelWith value. Your code will ask about PixelWidth of image so it will have to be loaded. XAML.cs: BitmapImage bImage = new BitmapImage(new Uri(imageUri, UriKind.RelativeOrAbsolute)); image.Source = bImage; InitControl(imageUri, movieUri, isLeft); int w = bImage.PixelWidth; int h = bImage.PixelHeight;   DONE!   Jacek Ciereszko

    Read the article

  • Execute code every hour

    - by Linger
    I need to create a web service that executes every hour. It will be used to review data in a database and add alerts to a table in the same database if certain conditions are met/not met. What we currently have is: We have end devices that use Python to report to an Amazon Web Services (AWS) virtual server. The AWS server takes that information and stores it in a MySQL database. The AWS server is Linux running Django and Apache. I need to be able to have some python code run every hour that verifies the data that has been stored by the end devices. If certain conditions are not met then a record will be added to the alerts table in the database. We originally contracted to have the above setup created. I am new to Python, Django, and Apache. However, I have already made several changes to the Python code that sends and also receives the data from the end devices. I am a coder that is breaking into web programming. Does anyone have any recommendations on how I can do this?

    Read the article

  • How best to handle ID3D11InputLayout in rendering code?

    - by JohnB
    I'm looking for an elegant way to handle input layouts in my directx11 code. The problem I have that I have an Effect class and a Element class. The effect class encapsulates shaders and similar settings, and the Element class contains something that can be drawn (3d model, lanscape etc) My drawing code sets the device shaders etc using the effect specified and then calls the draw function of the Element to draw the actual geometry contained in it. The problem is this - I need to create an D3D11InputLayout somewhere. This really belongs in the Element class as it's no business of the rest of the system how that element chooses to represent it's vertex layout. But in order to create the object the API requires the vertex shader bytecode for the vertex shader that will be used to draw the object. In directx9 it was easy, there was no dependency so my element could contain it's own input layout structures and set them without the effect being involved. But the Element shouldn't really have to know anything about the effect that it's being drawn with, that's just render settings, and the Element is there to provide geometry. So I don't really know where to store and how to select the InputLayout for each draw call. I mean, I've made something work but it seems very ugly. This makes me thing I've either missed something obvious, or else my design of having all the render settings in an Effect, the Geometry in an Element, and a 3rd party that draws it all is just flawed. Just wondering how anyone else handles their input layouts in directx11 in a elegant way?

    Read the article

  • Is this kind of design - a class for Operations On Object - correct?

    - by Mithir
    In our system we have many complex operations which involve many validations and DB activities. One of the main Business functionality could have been designed better. In short, there were no separation of layers, and the code would only work from the scenario in which it was first designed at, and now there were more scenarios (like requests from an API or from other devices) So I had to redesign. I found myself moving all the DB code to objects which acts like Business to DB objects, and I've put all the business logic in an Operator kind of a class, which I've implemented like this: First, I created an object which will hold all the information needed for the operation let's call it InformationObject. Then I created an OperatorObject which will take the InformationObject as a parameter and act on it. The OperatorObject should activate different objects and validate or check for existence or any scenario in which the business logic is compromised and then make the operation according to the information on the InformationObject. So my question is - Is this kind of implementation correct? PS, this Operator only works on a single Business-wise Operation.

    Read the article

< Previous Page | 92 93 94 95 96 97 98 99 100 101 102 103  | Next Page >