Search Results

Search found 33720 results on 1349 pages for 'zend db table'.

Page 96/1349 | < Previous Page | 92 93 94 95 96 97 98 99 100 101 102 103  | Next Page >

  • Create a named cell dynamically

    - by CaptMorgan
    I have a workbook with 3 worksheets. 1 worksheet will have input values (not created at the moment and not needed for this question), 1 worksheet with several "template" or "source" tables, and the last worksheet has 4 formatted "target" tables (empty or not doesn't matter). Each template table has 3 columns, 1 column identifying what the values are for in the second 2 columns. The value columns have formulas in them and each cell is Named. The formulas use the cell Names rather than cell address (e.g. MyData1 instead of C2). I am trying to copy the templates into the target tables while also either copying the cell Names from the source into the targets or create the Names in the target tables based on the source cell Names. My code below I am creating the target names by using a "base" in the Name that will be changed depending on which target table it gets copied to. my sample tables have "Num0_" for a base in all the cell names (e.g. Num0_MyData1, Num0_SomeOtherData2, etc). Once the copy has completed the code will then name the cells by looking at the target Names (and address), replacing the base of the name with a new base, just adding a number of which target table it goes to, and replacing the sheet name in the address. Here's where I need help. The way I am changing that address will only work if my template and target are using the same cell addresses of their perspective sheets. Which they are not. (e.g. Template1 table has value cells, each named, of B2 thru C10, and my target table for the copy may be F52 thur G60). Bottom line I need to figure out how to copy those names over with the templates or name the cells dynamically by doing something like a replace where I am incrementing the address value based on my target table #...remember I have 4 target tables which are static, I will only copy to those areas. I am a newbie to vba so any suggestions or help is appreciated. NOTE: The copying of the table works as I want. It even names the cells (if the Template and Target Table have the same local worksheet cell address (e.g. C2) 'Declare Module level variables 'Variables for target tables are defined in sub's for each target table. Dim cellName As Name Dim newName As String Dim newAddress As String Dim newSheetVar Dim oldSheetVar Dim oldNameVar Dim srcTable1 Sub copyTables() newSheetVar = "TestSheet" oldSheetVar = "Templates" oldNameVar = "Num0_" srcTable1 = "TestTableTemplate" 'Call sub functions to copy tables, name cells and update functions. copySrc1Table copySrc2Table End Sub '****there is another sub identical to this one below for copySrc2Table. Sub copySrc1Table() newNameVar = "Num1_" trgTable1 = "SourceEnvTable1" Sheets(oldSheetVar).Select Range(srcTable1).Select Selection.Copy For Each cellName In ActiveWorkbook.Names 'Find all names with common value If cellName.Name Like oldNameVar & "*" Then 'Replace the common value with the update value you need newName = Replace(cellName.Name, oldNameVar, newNameVar) newAddress = Replace(cellName.RefersTo, oldSheetVar, newSheetVar) 'Edit the name of the name. This will change any formulas using this name as well ActiveWorkbook.Names.Add Name:=newName, RefersTo:=newAddress End If Next cellName Sheets(newSheetVar).Select Range(trgTable1).Select Selection.PasteSpecial Paste:=xlPasteAll, Operation:=xlNone, SkipBlanks:= _ False, Transpose:=False End Sub PING

    Read the article

  • How to get an hierarchical php structure from a db table, in php array, or JSON

    - by daniel
    Hi guys, can you please help me. How to get an hierarchical php structure from a db table, in php array, or JSON, but with the following format: [{ "attributes" : {"id" : "111"}, "data" : "Some node title", "children" : [ { "attributes" : { "id" : "555"}, "data" : "A sub node title here" } ], "state" : "open" }, { "attributes" : {"id" : "222"}, "data" : "Other main node", "children" : [ { "attributes" : { "id" : "666"}, "data" : "Another sub node" } ], "state" : "open" }] My SQL table contains the fields: ID, PARENT, ORDER, TITLE Can you please help me with this? I'm going crazy trying to get this. Many thanks in advance. Daniel

    Read the article

  • Codeigniter: Using URIs with forms

    - by Kevin Brown
    I'm using URIs to direct a function in a library: $id = $this->CI->session->userdata('id'); $URI = $this->CI->uri->uri_string(); $new = "new"; if(strpos($URI, $new) === FALSE){ $method = "update"; } elseif(strpos($URI, $new) !== FALSE){ $method = "create"; } So I have two if statements directing what information to if ($method === 'update') { // Modify form, first load $this->CI->db->from('be_survey'); $this->CI->db->where('user_id' , $id); $survey = $this->CI->db->get(); $user = array_merge($user->row_array(),$survey->row_array()); $this->CI->validation->set_default_value($user); // Display page $data['user'] = $user; } $this->CI->validation->set_rules($rules); if ( $this->CI->validation->run() === FALSE ) { // Output any errors $this->CI->validation->output_errors(); } else { // Submit form $this->_submit($method); } Submit function: function _submit($method) { //Submit and Update for current User $id = $this->CI->session->userdata('id'); $this->CI->db->select('users.id, users.username, users.email, profiles.firstname, profiles.manager_id'); $this->CI->db->from('be_users' . " users"); $this->CI->db->join('be_user_profiles' . " profiles",'users.id=profiles.user_id'); $this->CI->db->having('id', $id); $email_data['user'] = $this->CI->db->get(); $email_data['user'] = $email_data['user']->row(); $manager_id = $email_data['user']->manager_id; $this->CI->db->select('firstname','email')->from('be_user_profiles')->where('user_id', $manager_id); $email_data['manager'] = $this->CI->db->get(); $email_data['manager'] = $email_data['manager']->row(); // Fetch what they entered in the form for($i=1;$i<18;$i++){ $survey["a_".$i]= $this->CI->input->post('a_'.$i); } for($i=1;$i<15;$i++){ $survey["b_".$i]= $this->CI->input->post('b_'.$i); } for($i=1;$i<12;$i++){ $survey["c_".$i]= $this->CI->input->post('c_'.$i); } $profile['firstname'] = $this->CI->input->post('firstname'); $profile['lastname'] = $this->CI->input->post('lastname'); $profile['test_date'] = date ("Y-m-d H:i:s"); $profile['company_name'] = $this->CI->input->post('company_name'); $profile['company_address'] = $this->CI->input->post('company_address'); $profile['company_city'] = $this->CI->input->post('company_city'); $profile['company_phone'] = $this->CI->input->post('company_phone'); $profile['company_state'] = $this->CI->input->post('company_state'); $profile['company_zip'] = $this->CI->input->post('company_zip'); $profile['job_title'] = $this->CI->input->post('job_title'); $profile['job_type'] = $this->CI->input->post('job_type'); $profile['job_time'] = $this->CI->input->post('job_time'); $profile['department'] = $this->CI->input->post('department'); $profile['vision'] = $this->CI->input->post('vision'); $profile['height'] = $this->CI->input->post('height'); $profile['weight'] = $this->CI->input->post('weight'); $profile['hand_dominance'] = $this->CI->input->post('hand_dominance'); $profile['areas_of_fatigue'] = $this->CI->input->post('areas_of_fatigue'); $profile['job_description'] = $this->CI->input->post('job_description'); $profile['injury_review'] = $this->CI->input->post('injury_review'); $profile['job_positive'] = $this->CI->input->post('job_positive'); $profile['risk_factors'] = $this->CI->input->post('risk_factors'); $profile['job_improvement_short'] = $this->CI->input->post('job_improvement_short'); $profile['job_improvement_long'] = $this->CI->input->post('job_improvement_long'); if ($method == "update") { //Begin db transmission $this->CI->db->trans_begin(); $this->CI->home_model->update('Survey',$survey, array('user_id' => $id)); $this->CI->db->update('be_user_profiles',$profile, array('user_id' => $id)); if ($this->CI->db->trans_status() === FALSE) { flashMsg('error','There was a problem entering your test! Please contact an administrator.'); redirect('survey','location'); } else { //Get credits of user and subtract 1 $this->CI->db->set('credits', 'credits -1', FALSE); $this->CI->db->update('be_user_profiles',$profile, array('user_id' => $manager_id)); //Mark the form completed. $this->CI->db->set('test_complete', '1'); $this->CI->db->where('user_id', $id)->update('be_user_profiles'); // Stuff worked... $this->CI->db->trans_commit(); //Get Manager Information $this->CI->db->select('users.id, users.username, users.email, profiles.firstname'); $this->CI->db->from('be_users' . " users"); $this->CI->db->join('be_user_profiles' . " profiles",'users.id=profiles.user_id'); $this->CI->db->having('id', $email_data['user']->manager_id); $email_data['manager'] = $this->CI->db->get(); $email_data['manager'] = $email_data['manager']->row(); //Email User $this->CI->load->library('User_email'); $data_user = array( 'firstname'=>$email_data['user']->firstname, 'email'=> $email_data['user']->email, 'user_completed'=>$email_data['user']->firstname, 'site_name'=>$this->CI->preference->item('site_name'), 'site_url'=>base_url() ); //Email Manager $data_manager = array( 'firstname'=>$email_data['manager']->firstname, 'email'=> $email_data['manager']->email, 'user_completed'=>$email_data['user']->firstname, 'site_name'=>$this->CI->preference->item('site_name'), 'site_url'=>base_url() ); $this->CI->user_email->send($email_data['manager']->email,'Completed the Assessment Tool','public/email_manager_complete',$data_manager); $this->CI->user_email->send($email_data['user']->email,'Completed the Assessment Tool','public/email_user_complete',$data_user); flashMsg('success','You finished the assessment successfully!'); redirect('home','location'); } } //Create New User elseif ($method == "create") { // Build $profile['user_id'] = $id; $profile['manager_id'] = $manager_id; $profile['test_complete'] = '1'; $survey['user_id'] = $id; $this->CI->db->trans_begin(); // Add user_profile details to DB $this->CI->db->insert('be_user_profiles',$profile); $this->CI->db->insert('be_survey',$survey); if ($this->CI->db->trans_status() === FALSE) { // Registration failed $this->CI->db->trans_rollback(); flashMsg('error',$this->CI->lang->line('userlib_registration_failed')); redirect('auth/register','location'); } else { // User registered $this->CI->db->trans_commit(); flashMsg('success',$this->CI->lang->line('userlib_registration_success')); redirect($this->CI->config->item('userlib_action_register'),'location'); } } } The submit function is similar, updating the db if $method == "update", and inserting if the method == "create". The problem is, when the form is submitted, it doesn't take into account the url b/c the form submits to the function "survey", which passes data to the lib function, so things are always updated, never created. *How can I pass $method to the _submit() function correctly?!*

    Read the article

  • Keeping DB Table sorted using multi-field formula (Microsoft SQL Server)

    - by user298167
    I have a JOB table, with two interesting columns: Creation Date Importance (high - 3, medium 2, low - 1). A JOB record's priority calculated like this: Priority = Importance * (time passed since creation) The problem is, every time I would like to pick 200 jobs with highest priority, and I don't want to resort the table. Is there a way to keep rows sorted? I was also thinking about having three tables one for High, Medium and Low and then sort those by Creation Date.

    Read the article

  • How to create multiple tables with the same schema using SQLite jdbc

    - by Space_C0wb0y
    I want to split a large table horizontally, and I would like to make sure that all three of them have the same schema. Currently I am using this piece of code to create the tables: statement .executeUpdate("CREATE TABLE AnnotationsMolecularFunction (Id INTEGER PRIMARY KEY ASC AUTOINCREMENT, " + "ProteinId NOT NULL, " + "GOId NOT NULL, " + "UNIQUE (ProteinId, GOId)" + "FOREIGN KEY(ProteinId) REFERENCES Protein(Id))"); There is one such statement for each table. This is bad, because if I decide to change the schema later (which will most certainly happen), I will have to change it three times, which begs for errors, so I would like a way to make sure that the other tables have the same schema without explicitly writing it again. I can use: statement .executeUpdate("CREATE TABLE AnnotationsBiologicalProcess AS SELECT * FROM AnnotationsMolecularFunction"); to create the other tables with the same columns, but the constraints are not aplied. I could of course just generate the same query-string three times with different table-names in Java, but I would like to know if there is an SQL-way of achieving this.

    Read the article

  • SQLite Modify Column

    - by Nathan
    I need to modify a column in a SQLite database but I have to do it programatically due to the database already being in production. From my research I have found that in order to do this I must do the following. Create a new table with new schema Copy data from old table to new table Drop old table Rename new table to old tables name That seems like a ridiculous amount of work for something that should be relatively easy. Is there not an easier way? All I need to do is change a constraint on a existing column and give it a default value.

    Read the article

  • Help Auditing in Oracle

    - by enrique
    Hello everybody I need some help in auditing in Oracle. We have a database with many tables and we want to be able to audit every change made to any table in any field. So the things we want to have in this audit are: user who modified time of change occurred old value and new value so we started creating the trigger which was supposed to perform the audit for any table but then had issues... As I mentioned before we have so many tables and we cannot go creating a trigger per each table. So the idea is creating a master trigger that can behaves dynamically for any table that fires the trigger. I was trying to do it but no lucky at all....it seems that Oracle restricts the trigger environment just for a table which is declared by code and not dynamically like we want to do. Do you have any idea on how to do this or any other advice for solving this issue? thanks in advance.

    Read the article

  • Small gaps in section headers with custom headers - iPhone / Objective-C

    - by zhar
    Hi there! Since I wanted to use the standard section header with a different font size, I just made custom section headers by using an UIImageView with the standard section header as an image. It looks fine at first, but when I scroll the table, there are small gaps below and above the section headers: Since I am not allowed to post images or more than one hyperlink yet, I will have to provide you with one link to those images: Click me! Picture: How it looks like without touching anything Picture: Dragging the table down Picture: Dragging/Scrolling the table up So as you can hopefully see, there is a small empty gap under (2nd pic) and above (3rd pic) the section header. Another thing to mention is, that the standard behaviour of non-custom section headers is, that they don't become transparent when I drag the table down (making the table offset < 0.0). Is there a way to make custom section headers mimic the same behaviour without those annoying gaps? Greetings, Zhar

    Read the article

  • How to find rows between other rows w/ID then add class

    - by Ravex
    Hi guys. i'm stuck with my table. need create toggle rows function. but i no idea how to find sub rows in table. Some one can help me? I have table with many rows 500 All Rows have class="row-1,row-2.....row-600 etc" And all main rows also have class="parent" between each "parent" rows i have 6 rows So i need for toggle/collapse purposes find all (sub)rows betwen parent rows. and add class with id like in prevous parent row. For example: parent have class="row-1 parent" all sub must have - class="child-row-1" default table <table id="table"> <tr class="row-1 odd parent"> <th class="column-1">st. 3 - 5</th> <th class="column-2">Profile</th> <th class="column-3">Purpose</th> </tr> <tr class="row-2 even"> <td class="column-1">Metal Stamp</td> <td class="column-2">Width</td> <td class="column-3">Price</td> </tr> <tr class="row-3 odd"> <td class="column-1">Circle 3 - 5</td> <td class="column-2">28-110</td> <td class="column-3">21500</td> </tr> <tr class="row-4 even"> <td class="column-1">Circle 3 - 5</td> <td class="column-2">115-180</td> <td class="column-3">20700</td> </tr> <tr class="row-5 odd"> <td class="column-1">Cube 3 - 5</td> <td class="column-2">63-80</td> <td class="column-3">21500</td> </tr> <tr class="row-6 even"> <td class="column-1">Cube 3 - 5</td> <td class="column-2">100-220</td> <td class="column-3">20700</td> </tr> <tr class="row-7 odd"> <td class="column-1">Line 3 - 5</td> <td class="column-2">10-50 ? 40-200</td> <td class="column-3">27000</td> </tr> </table> in the end it should look like this: <table id="table"> <tr class="row-1 odd parent"> <th class="column-1">st. 3 - 5</th> <th class="column-2">Profile</th> <th class="column-3">Purpose</th> </tr> <tr class="row-2 even child-row-1"> <td class="column-1">Metal Stamp</td> <td class="column-2">Width</td> <td class="column-3">Price</td> </tr> <tr class="row-3 odd child-row-1"> <td class="column-1">Circle 3 - 5</td> <td class="column-2">28-110</td> <td class="column-3">21500</td> </tr> <tr class="row-4 even child-row-1"> <td class="column-1">Circle 3 - 5</td> <td class="column-2">115-180</td> <td class="column-3">20700</td> </tr> <tr class="row-5 odd child-row-1"> <td class="column-1">Cube 3 - 5</td> <td class="column-2">63-80</td> <td class="column-3">21500</td> </tr> <tr class="row-6 even child-row-1"> <td class="column-1">Cube 3 - 5</td> <td class="column-2">100-220</td> <td class="column-3">20700</td> </tr> <tr class="row-7 odd child-row-1"> <td class="column-1">Line 3 - 5</td> <td class="column-2">10-50 ? 40-200</td> <td class="column-3">27000</td> </tr> </table>

    Read the article

  • MySQL whats wrong with my foreign keys?

    - by Skiy
    Hello, what is wrong with the two foreign keys which I have marked with comments? create database db; use db; create table Flug( Flugbez varchar(20), FDatum Date, Ziel varchar(20), Flugzeit int, Entfernung int, Primary Key (Flugbez, FDatum)); create table Flugzeugtyp( Typ varchar(20), Hersteller varchar(20), SitzAnzahl int, Reisegeschw int, primary key (Typ) ); create table flugzeug( Typ varchar(20), SerienNr int, AnschDatum Date, FlugStd int, primary key(Typ,SerienNr), foreign key(Typ) references Flugzeugtyp(Typ)); create table Abflug( Flugbez varchar(20), FDatum Date, Typ varchar(20), Seriennr int, Kaptaen varchar(20), Primary key(Flugbez,FDatum,Typ,SerienNr), Foreign key(Flugbez) references Flug(Flugbez), -- Foreign key(FDatum) references Flug(FDatum), Foreign key(Typ) references Flugzeugtyp(Typ) -- ,Foreign key(SerienNr) references Flugzeug(SerienNr) ); When I uncomment these, I get: ERROR 1005 (HY000): Can't create table 'db.abflug' (errno: 150)

    Read the article

  • TSQL - compare tables

    - by Rya
    I want to create a stored procedure that compares the results of two queries. If the results of the 2nd table can be found in the first, print 'YES', otherwise, print 'No'. Table 1: SELECT dbo.Roles.RoleName, dbo.UserRoles.RoleID FROM dbo.Roles LEFT OUTER JOIN dbo.UserRoles ON dbo.Roles.RoleID = dbo.UserRoles.RoleID WHERE (dbo.Roles.PortalID = 0) AND (dbo.UserRoles.UserID = 2) Table 2: Declare @RowData as nvarchar(2000) Set @RowData = ( SELECT EditPermissions FROM vw_XMP_DMS_Documents where DocumentID = 2) Select Data from dbo.split(@RowData, ',') For example. Table 1: John Jack James Table 2: John Sally Jane Print 'YES' Is this possible??? Thank you all very much. -R

    Read the article

  • Why is selecting specified columns, and all, wrong in Oracle SQL?

    - by TomatoSandwich
    Say I have a select statement that goes.. select * from animals That gives a a query result of all the columns in the table. Now, if the 42nd column of the table animals is is_parent, and I want to return that in my results, just after gender, so I can see it more easily. But I also want all the other columns. select is_parent, * from animals This returns ORA-00936: missing expression. The same statement will work fine in Sybase, and I know that you need to add a table alias to the animals table to get it to work ( select is_parent, a.* from animals ani), but why must Oracle need a table alias to be able to work out the select?

    Read the article

  • Apache displays error page half way through PHP page execution

    - by Shep
    I've just installed Zend Server Community Edition on a Windows Server 2003 box, however there's a bit of a problem with the display of a lot of our PHP pages. The code has previously running under the same version of PHP (5.3) on IIS without any issues. By the looks of things, Apache (installed as part of Zend Server) is erroring out during the rendering of the page when it comes across something it doesn't like in the PHP. Going through the code, I've been able to get past some of the problems by removing the error suppression operator (@) from function calls and by changing the format of some includes. However, I can't do this for the whole site! Weirdly, the error code is reported as "200 OK". The code snippet below shows how the Apache error HTML interrupts the regular HTML of the page. <p>Ma quande lingues coalesce, li grammatica del resultant lingue es plu simplic e regulari quam ti del coalescent lingues.</<!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>200 OK</title> </head><body> <h1>OK</h1> <p>The server encountered an internal error or misconfiguration and was unable to complete your request.</p> <p>Please contact the server administrator, [email protected] and inform them of the time the error occurred, and anything you might have done that may have caused the error.</p> <p>More information about this error may be available in the server error log The Apache error log doesn't offer any explanation for this, and I've exhausted my Googling skills, so any help would be greatly appreciated. Thanks.

    Read the article

  • “Disk /dev/xvda1 doesn't contain a valid partition table”

    - by Simpanoz
    Iam newbie to EC2 and Ubuntu 11 (EC2 Free tier Ubuntu). I have made following commands. sudo mkfs -t ext4 /dev/xvdf6 sudo mkdir /db sudo vim /etc/fstab /dev/xvdf6 /db ext4 noatime,noexec,nodiratime 0 0 sudo mount /dev/xvdf6 /db fdisk -l I got following output. Can some one guide me what I am doing wrong and how it can be rectified. Disk /dev/xvda1: 8589 MB, 8589934592 bytes 255 heads, 63 sectors/track, 1044 cylinders, total 16777216 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x00000000 Disk /dev/xvda1 doesn't contain a valid partition table Disk /dev/xvdf6: 6442 MB, 6442450944 bytes 255 heads, 63 sectors/track, 783 cylinders, total 12582912 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x00000000 Disk /dev/xvdf6 doesn't contain a valid partition table.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Copying values of one table to another (how to convert this js function to jQuery)

    - by Sullan
    Hi All, I am stuck with a small problem here.. What i am trying to do is copy description of id's from one table to another. I have writter half of the javascript and can anybody tell me how to convert this function in jquery. I want the description copied from the first table based on the id to the second table. Have done this in jquery using 'contains', (http://stackoverflow.com/questions/2449845/comparing-2-tables-column-values-and-copying-the-next-column-content-to-the-secon) since there are 1000 table rows, the explorer crashes. Is there a way to simplify it ??... the code is as follows... the current javascript works when i click on test in the second table, but i want the value to be appended in the second table on page load... pls help <table class="reportTabe"> <tr><td>psx-pdu120v1</td><td class="itemname" id="psx-pdu120v1">some description1</td></tr> <tr><td>psx-pdu120v1</td><td class="itemname" id="psx-pdu120v1">some description1</td></tr> <tr><td>psx-pdu120v3</td><td class="itemname" id="psx-pdu120v3">some description3</td></tr> <tr><td>psx-pdu120v4</td><td class="itemname" id="psx-pdu120v4">some description4</td></tr> <tr><td>psx-pdu120v5</td><td class="itemname" id="psx-pdu120v5">some description5</td></tr> <tr><td>psx-pdu120v6</td><td class="itemname" id="psx-pdu120v6">some description6</td></tr> <tr><td>psx-pdu120v7</td><td class="itemname" id="psx-pdu120v7">some description7</td></tr> <tr><td>psx-pdu120v8</td><td class="itemname" id="psx-pdu120v8">some description8</td></tr> <tr><td>psx-pdu120v9</td><td class="itemname" id="psx-pdu120v9">some description9</td></tr> </table> <table class="data"> <tr><td class="whipItem">psx-pdu120v1</td><td onClick="Javascript:alert(document.getElementById('psx-pdu120v1').innerText)";>test</td></tr> <tr><td class="whipItem">psx-pdu120v3</td><td onClick="Javascript:alert(document.getElementById('psx-pdu120v1').innerText)";>test</td></tr> <tr><td class="whipItem">psx-pdu120v4</td><td onClick="Javascript:alert(document.getElementById('psx-pdu120v5').innerText)";>test</td></tr> <tr><td class="whipItem">psx-pdu120v5</td><td Javascript:this.innerText=document.getElementById('psx-pdu120v4').innerText;></td></tr> <tr><td class="whipItem">psx-pdu120v6</td><td Javascript:this.innerText=document.getElementById('psx-pdu120v5').innerText;></td></tr> <tr><td class="whipItem">psx-pdu120v7</td><td Javascript:this.innerText=document.getElementById('psx-pdu120v6').innerText;></td></tr> <tr><td class="whipItem">psx-pdu120v8</td><td Javascript:this.innerText=document.getElementById('psx-pdu120v7').innerText;></td></tr> <tr><td class="whipItem">psx-pdu120v9</td><td Javascript:this.innerText=document.getElementById('psx-pdu120v8').innerText;></td></tr> </table>

    Read the article

  • Implementing Audit Trail- Spring AOP vs.Hibernate Interceptor vs DB Trigger

    - by RN
    I found couple of discussion threads on this- but nothing which brought a comparison of all three mechanism under one thread. So here is my question... I need to audit DB changes- insert\updates\deletes to business objects. I can think of three ways to do this 1) DB Triggers 2) Hibernate interceptors 3) Spring AOP (This question is specific to a Spring\Hibernate\RDBMS- I guess this is neutral to java\c# or hibernate\nhibernate- but if your answer is dependent upon C++ or Java or specific implementation of hibernate- please specify) What are the pros and cons of selecting one of these strategies ? I am not asking for implementation details.-This is a design discussion. I am hoping we can make this as a part of community wiki

    Read the article

  • ADO.NET Entity Framework with OLE DB Access Data Source

    - by Tim Long
    Has anyone found a way to make the ADO.NET Entity Framework work with OLE DB or ODBC data sources? Specifically, I need to work with an Access database that for various reasons can't be upsized to SQL. This MSDN page says: The .NET Framework includes ADO.NET providers for direct access to Microsoft SQL Server (including Entity Framework support), and for indirect access to other databases with ODBC and OLE DB drivers (see .NET Framework Data Providers). For direct access to other databases, many third-party providers are available as shown below. The reference to "indirect access to other databases" is tantalising but I confess that I am hopelessly confused by all the different names for data access technology.

    Read the article

  • Fatal Error in uploading to google DOcs using Zend_GData

    - by Ali
    Hi guys I'm trying the code samples from zend frameworks site on how to upload a document to google docs but I keep getting this error. PHP Fatal error: Uncaught exception 'Zend_Gdata_App_HttpException' with message 'Expected response code 200, got 415 Content-Type application/x-www-form-urlencoded is not a valid input type.' in C:\...\Zend\Gdata\App.php:700 It can't be an unlisted type as I tried to upload even a .txt file - whats happening here - I've googled everywhere for an answer and landed nowhere - please help :(

    Read the article

  • mysql compatability error - rake aborted error on rake db:create

    - by user1904563
    I'm a starter in ROR I' m using ruby 1.9.3 and rails 3.2.1 This is what appears on using rake db:create command **>rake db:create rake aborted! Please install the mysql adapter: 'gem install activerecord-mysql-adapter' <can't activate mysql <~> 2.8.1>, already activated mysql-2.9.0-x86-mingw32. Make sur all dependancies are added to Gemfile.>** Have installed mysql gem and copied libmysql.dll file to Ruby193/bin (Phpmyadmin and xampp also works good). Please help me to solve this issue.

    Read the article

  • Speed Difference between native OLE DB and ADO.NET

    - by weijiajun
    I'm looking for suggestions as well as any benchmarks or observations people have. We are looking to rewrite our data access layer and are trying to decide between native C++ OLEDB or ADO.NET for connecting with databases. Currently we are specifically targeting Oracle which would mean we would use the Oracle OLE DB provider and the ODP.NET. Requirements: 1. All applications will be in managed code so using native C++ OLEDB would require C++/CLI to work (no PInvoke way to slow). 2. Application must work with multiple databases in the future, currently just targeting Oracle specifically. Question: 1. Would it be more performant to use ADO.NET to accomplish this or use native C++ OLE DB wrapped in a Managed C++ interface for managed code to access? Any ideas, or help or places to look on the web would be greatly appreciated.

    Read the article

  • How to use JQUERY to filter table rows dynamically using multiple form inputs

    - by tresstylez
    I'm displaying a table with multiple rows and columns. I'm using a JQUERY plugin called uiTableFilter which uses a text field input and filters (shows/hides) the table rows based on the input you provide. All you do is specify a column you want to filter on, and it will display only rows that have the text field input in that column. Simple and works fine. I want to add a SECOND text input field that will help me narrow the results down even further. So, for instance if I had a PETS table and one column was petType and one was petColor -- I could type in CAT into the first text field, to show ALL cats, and then in the 2nd text field, I could type black, and the resulting table would display only rows where BLACK CATS were found. Basically, a subset. Here is the JQUERY I'm using: $("#typeFilter").live('keyup', function() { if ($(this).val().length > 2 || $(this).val().length == 0) { var newTable = $('#pets'); $.uiTableFilter( theTable, this.value, "petType" ); } }) // end typefilter $("#colorFilter").live('keyup', function() { if ($(this).val().length > 2 || $(this).val().length == 0) { var newTable = $('#pets'); $.uiTableFilter( newTable, this.value, "petColor" ); } }) // end colorfilter Problem is, I can use one filter, and it will display the correct subset of table rows, but when I provide input for the other filter, it doesn't seem to recognize the visible table rows that are remaining from the previous column, but instead it appears that it does an entirely new filtering of the original table. If 10 rows are returned after applying one filter, the 2nd filter should only apply to THOSE 10 rows. I've tried LIVE and BIND, but not working. Can anyone shed some light on where I'm going wrong? Thanks!

    Read the article

  • Store in DB or not to store ?

    - by eugeneK
    There are few string lists in my web application that i don't know where to store in DB or just class. ie. I have 7 major browsers with which users enter the site. I want to save these stats thus i need to create browser column in UserLogin database. I don't want to waste space and resources so i can save full browser name in each login row. So i either need to save browserID field and hook it up with Browsers table which will store names following db normalization rules or to have sort of Dataholder abstract class which has a list of browsers from which i can retrieve browser name by it's ID... The question what should i do ? These few data lists i have contain no more than 200 items each so i think it makes sense to have them as abstract class but again i don't know whether MS-SQL will handle multiple joins so well. Think of idea when i have user with country,ip,language,browser and few more stats .. thanks

    Read the article

  • Decrease DB requests number from Django templates

    - by Andrew
    I publish discount offers for my city. Offer models are passed to template ( ~15 offers per page). Every offer has lot of items(every item has FK to it's offer), thus i have to make huge number of DB request from template. {% for item in offer.1 %} {{item.descr}} {{item.start_date}} {{item.price|floatformat}} {%if not item.tax_included %}{%trans "Without taxes"%}{%endif%} <a href="{{item.offer.wwwlink}}" >{%trans "Buy now!"%}</a> </div> <div class="clear"></div> {% endfor %} So there are ~200-400 DB requests per page, that's abnormal i expect. In django code it is possible to use select_related to prepopulate needed values, how can i decrease number of requests in template?

    Read the article

< Previous Page | 92 93 94 95 96 97 98 99 100 101 102 103  | Next Page >