Search Results

Search found 3953 results on 159 pages for 'overlapped io'.

Page 103/159 | < Previous Page | 99 100 101 102 103 104 105 106 107 108 109 110  | Next Page >

  • Java resource as file

    - by Martin Riedel
    Is there a way in Java to construct a File instance on a resource retrieved from a jar through the classloader? My application uses some files from the jar (default) or from a filesystem directory specified at runtime (user input). I'm looking for a consistent way of a) loading these files as a stream b) listing the files in the user-defined directory or the directory in the jar respectively Edit: Apparently, the ideal approach would be to stay away from java.io.File altogether. Is there a way to load a directory from the classpath and list its contents (files/entities contained in it)?

    Read the article

  • Java: how to initialize int without assigning a value?

    - by HH
    $ javac InitInt.java InitInt.java:9: '[' expected right = new int; ^ InitInt.java:9: ']' expected right = new int; ^ InitInt.java:13: ';' expected } ^ InitInt.java:14: ';' expected public int getRight(){return right;} ^ InitInt.java:15: reached end of file while parsing } ^ 5 errors $ cat InitInt.java import java.util.*; import java.io.*; public class InitInt { private final int right; public static void main(String[] args) { // I don't want to assign any value. // just initialize it, how? right = new int; // later assiging a value } public int getRight(){return right;} }

    Read the article

  • Integrate openid4java to GWT Project

    - by Slyker
    Hi, I created an GWT project in eclipse. Now I tried to implement openId with using the openid4java library. I imported the .jar files via properties--java build path: openid4java-0.9.5.jar lib/*.jar In addition I copied the .jar files into the war/WEB-INF/lib directory. The problem at hand comes up when I call the authenticate() method. Then I get a: HTTP ERROR 500 Problem accessing /openid/openid. Reason: access denied (java.lang.RuntimePermission modifyThreadGroup)Caused by:java.security.AccessControlException: access denied (java.lang.RuntimePermission modifyThreadGroup) at java.security.AccessControlContext.checkPermission(Unknown Source) at java.security.AccessController.checkPermission(Unknown Source) at java.lang.SecurityManager.checkPermission(Unknown Source) at com.google.appengine.tools.development.DevAppServerFactory$CustomSecurityManager.checkPermission(DevAppServerFactory.java:166) at com.google.appengine.tools.development.DevAppServerFactory$CustomSecurityManager.checkAccess(DevAppServerFactory.java:191) at java.lang.ThreadGroup.checkAccess(Unknown Source) at java.lang.Thread.init(Unknown Source) at java.lang.Thread.<init>(Unknown Source) at org.apache.commons.httpclient.MultiThreadedHttpConnectionManager$ReferenceQueueThread.<init>(MultiThreadedHttpConnectionManager.java:1039) at org.apache.commons.httpclient.MultiThreadedHttpConnectionManager.storeReferenceToConnection(MultiThreadedHttpConnectionManager.java:164) at org.apache.commons.httpclient.MultiThreadedHttpConnectionManager.access$900(MultiThreadedHttpConnectionManager.java:64) at org.apache.commons.httpclient.MultiThreadedHttpConnectionManager$ConnectionPool.createConnection(MultiThreadedHttpConnectionManager.java:750) at org.apache.commons.httpclient.MultiThreadedHttpConnectionManager.doGetConnection(MultiThreadedHttpConnectionManager.java:469) at org.apache.commons.httpclient.MultiThreadedHttpConnectionManager.getConnectionWithTimeout(MultiThreadedHttpConnectionManager.java:394) at org.apache.commons.httpclient.HttpMethodDirector.executeMethod(HttpMethodDirector.java:152) at org.apache.commons.httpclient.HttpClient.executeMethod(HttpClient.java:396) at org.apache.commons.httpclient.HttpClient.executeMethod(HttpClient.java:324) at org.openid4java.util.HttpCache.head(HttpCache.java:296) at org.openid4java.discovery.yadis.YadisResolver.retrieveXrdsLocation(YadisResolver.java:360) at org.openid4java.discovery.yadis.YadisResolver.discover(YadisResolver.java:229) at org.openid4java.discovery.yadis.YadisResolver.discover(YadisResolver.java:221) at org.openid4java.discovery.yadis.YadisResolver.discover(YadisResolver.java:179) at org.openid4java.discovery.Discovery.discover(Discovery.java:134) at org.openid4java.discovery.Discovery.discover(Discovery.java:114) at org.openid4java.consumer.ConsumerManager.discover(ConsumerManager.java:527) at auth.openid.server.OpenIDServlet.authenticate(OpenIDServlet.java:138) at auth.openid.server.OpenIDServlet.doGet(OpenIDServlet.java:101) at javax.servlet.http.HttpServlet.service(HttpServlet.java:693) at javax.servlet.http.HttpServlet.service(HttpServlet.java:806) at org.mortbay.jetty.servlet.ServletHolder.handle(ServletHolder.java:511) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1166) at com.google.appengine.api.blobstore.dev.ServeBlobFilter.doFilter(ServeBlobFilter.java:51) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.apphosting.utils.servlet.TransactionCleanupFilter.doFilter(TransactionCleanupFilter.java:43) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.appengine.tools.development.StaticFileFilter.doFilter(StaticFileFilter.java:122) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at org.mortbay.jetty.servlet.ServletHandler.handle(ServletHandler.java:388) at org.mortbay.jetty.security.SecurityHandler.handle(SecurityHandler.java:216) at org.mortbay.jetty.servlet.SessionHandler.handle(SessionHandler.java:182) at org.mortbay.jetty.handler.ContextHandler.handle(ContextHandler.java:765) at org.mortbay.jetty.webapp.WebAppContext.handle(WebAppContext.java:418) at com.google.apphosting.utils.jetty.DevAppEngineWebAppContext.handle(DevAppEngineWebAppContext.java:70) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at com.google.appengine.tools.development.JettyContainerService$ApiProxyHandler.handle(JettyContainerService.java:349) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at org.mortbay.jetty.Server.handle(Server.java:326) at org.mortbay.jetty.HttpConnection.handleRequest(HttpConnection.java:542) at org.mortbay.jetty.HttpConnection$RequestHandler.headerComplete(HttpConnection.java:923) at org.mortbay.jetty.HttpParser.parseNext(HttpParser.java:547) at org.mortbay.jetty.HttpParser.parseAvailable(HttpParser.java:212) at org.mortbay.jetty.HttpConnection.handle(HttpConnection.java:404) at org.mortbay.io.nio.SelectChannelEndPoint.run(SelectChannelEndPoint.java:409) at org.mortbay.thread.QueuedThreadPool$PoolThread.run(QueuedThreadPool.java:582) Here my servlet source: import com.google.gwt.user.client.rpc.RemoteService; import org.openid4java.OpenIDException; import org.openid4java.consumer.ConsumerException; import org.openid4java.consumer.ConsumerManager; import org.openid4java.consumer.VerificationResult; import org.openid4java.discovery.DiscoveryInformation; import org.openid4java.discovery.Identifier; import org.openid4java.message.AuthRequest; import org.openid4java.message.ParameterList; import javax.servlet.ServletException; import javax.servlet.http.HttpServlet; import javax.servlet.http.HttpServletRequest; import javax.servlet.http.HttpServletResponse; import java.io.IOException; import java.text.MessageFormat; import java.util.List; public final class OpenIDServlet extends HttpServlet implements RemoteService { private final ConsumerManager manager; public OpenIDServlet() { try { manager = new ConsumerManager(); } catch (ConsumerException e) { throw new RuntimeException("Error creating consumer manager", e); } } ... private void authenticate(HttpServletRequest request, HttpServletResponse response) throws IOException, ServletException { final String loginString = request.getParameter(nameParameter); try { // perform discovery on the user-supplied identifier List discoveries = manager.discover(loginString); // attempt to associate with the OpenID provider // and retrieve one service endpoint for authentication DiscoveryInformation discovered = manager.associate(discoveries); // obtain a AuthRequest message to be sent to the OpenID provider AuthRequest authReq = manager.authenticate(discovered, "openid", null); // redirect to OpenID for authentication response.sendRedirect(authReq.getDestinationUrl(true)); } catch (OpenIDException e) { throw new ServletException("Login string probably caused an error. loginString = " + loginString, e); } } My question now is: What could be my fault? Did I make any mistakes in importing the openid4java library? (which?) All other methods in the servlet which do not use the openid4java implementation work fine. Thanks, Andreas

    Read the article

  • How do I get the size of a response from a Spring 2.5 HTTP remoting call?

    - by aarestad
    I've been poking around the org.springframework.remoting.httpinvoker package in Spring 2.5 trying to find a way to get visibility into the size of the response, but I keep going around in circles. Via another question I saw here, I think what I want to do is get a handle on the InputStream that represents the response from the server, and then wrap it with an Apache commons-io CountingInputStream. What's the best way to go about doing this? For the moment, I'd be happy with just printing the size of the response to stdout, but eventually I want to store it in a well-known location in my app for optional display.

    Read the article

  • How to create a server control on another ASPX file

    - by salvationishere
    I am developing a C#/SQL ASP.NET web application in VS 2008. Currently, I am transferring control from one ASPX file to another: if (uploadFile.PostedFile.ContentLength > 0) { inputfile = System.IO.File.ReadAllText(path); Context.Items["Message"] = inputfile; //Page1 Server.Transfer("DataMatch.aspx"); //Page1 } However, it fails on this Server.Transfer line after inserting runat="server" in the DataMatch.aspx file to the Table element like so: <table width="50%" id="tMain" runat="server"> But after making this a server control, I rebuilt it and now when I run this app it gives me exception: Error executing child request for DataMatch.aspx But I need this table to be a server control so I can make it invisible programmatically if a certain condition occurs. How else can I programmatically make this table invisible?

    Read the article

  • Error while importing SSL into jboss 4.2 ?

    - by worldpython
    I've tried to setup .keystore on Jboss 4.2. due to this documentation from jboss community http://community.jboss.org/wiki/sslsetup but Jboss console generate this error LifecycleException: service.getName(): "jboss.web"; Protocol handler start failed: java.io.FileNotFoundException: C:\Documents and Settings\mebada\.keystore (The system cannot find the file specified) even I specify location of keystore in server.xml <Connector className = "org.apache.coyote.tomcat4.CoyoteConnector" address="${jboss.bind.address}" port = "8443" protocol="HTTP/1.1" SSLEnabled="true" scheme = "https" secure = "true"> <Factory className = "org.apache.coyote.tomcat4.CoyoteServerSocketFactory" keystoreFile="D:/Projects/Demo/jboss-4.2.3.GA/jboss-4.2.3.GA/server/default/conf/server.keystore" keystorePass="tc-ssl" protocol = "TLS"></Factory> Any Help ? Thanks in advance

    Read the article

  • extract digg data by digg api

    - by vamsivanka
    I am trying to extract digg data for a user using this url "http://services.digg.com/user/vamsivanka/diggs?count=25&appkey=34asd56asdf789as87df65s4fas6" and the web response is throwing an error "The remote server returned an error: (403) Forbidden." Please let me know. public static XmlTextReader CreateWebRequest(string url) { HttpWebRequest webRequest = (HttpWebRequest)WebRequest.Create(url); webRequest.UserAgent = ".NET Framework digg Test Client"; webRequest.Credentials = System.Net.CredentialCache.DefaultCredentials; webRequest.Accept = "text/xml"; HttpWebResponse webResponse = (HttpWebResponse)webRequest.GetResponse(); System.IO.Stream responseStream = webResponse.GetResponseStream(); XmlTextReader reader = new XmlTextReader(responseStream); return reader; }

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • Bitbanging a PIO on Coldfire/ucLinux

    - by G Forty
    Here's the problem: I need to program some hardware via 2 pins of the PIO (1 clock, 1 data). Timing constraints are tight - 10ms clock cycle time. All this, of course, whilst I maintain very high level services (CAN bus, TCP/IP). The downstream unit also ACKS by asserting a PIO pin, configured as an input, high. So this loop has to both read and write. I need to send 16 bits in the serial stream. Is there an established way to do this sort of thing or should I simply get the hardware guys to add a PIC or somesuch. I'd much prefer to avoid exotics like RTAI extensions at this stage. I did once see a reference to user-mode IO which implied a possible interrupt driven driver but lost track of it. Any pointers welcomed.

    Read the article

  • Is there any explorer.exe problem in windows 7 ?

    - by sml
    s += "<p style=\"text-align: left;\"><a href=\"javascript:window.print()\">PRINT</a></p>"; System.IO.File.WriteAllText(@"CheckForm.html", s); System.Diagnostics.ProcessStartInfo startInfo = new System.Diagnostics.ProcessStartInfo(); startInfo.FileName = "explorer.exe"; startInfo.Arguments = "CheckForm.html"; System.Diagnostics.Process.Start(startInfo); I'm having a trouble when I tried to open my c# windows application in windows 7 otherwise there is no problem. I couldn't open explorer.exe in Windows 7 with above code. Any suggestions?

    Read the article

  • StackExchange API key

    - by user21289
    I am working on a project with the StackExchange API, the problem is at a moment I have this Exception on eclipse console: java.io.IOException: Server returned HTTP response code: 400 for URL: https://api.stackexchange.com/2.1/questions?order=desc&sort=votes&tagged=OSM&site=stackoverflow at sun.net.www.protocol.http.HttpURLConnection.getInputStream(Unknown Source) at sun.net.www.protocol.https.HttpsURLConnectionImpl.getInputStream(Unknown Source) atbr.inf.pucrio.sog.StackOverflowAcessor.getQuestionsIds(StackOverflowAcessor.java:41) After verifying on the browser with the same link, I have this error message: {"error_id":502,"error_name":"throttle_violation","error_message":"too many requests from this IP, more requests available in 74089 seconds"} I am wondering if this is dur to the limited numbers of the queries per day, if it is the case, how can I do to have the key? if it is not, how can I do to resolve the problem?

    Read the article

  • Parse filename from full path using regular expressions in C#

    - by WindyCityEagle
    How do I pull out the filename from a full path using regular expressions in C#? Say I have the full path C:\CoolDirectory\CoolSubdirectory\CoolFile.txt. How do I get out CoolFile.txt using the .NET flavor of regular expressions? I'm not really good with regular expressions, and my RegEx buddy and me couldn't figure this one out. Also, in the course of trying to solve this problem, I realized that I can just use System.IO.Path.GetFileName, but the fact that I couldn't figure out the regular expression is just making me unhappy and it's going to bother me until I know what the answer is.

    Read the article

  • Reworking my singly linked list

    - by Stradigos
    Hello everyone, thanks for taking the time to stop by my question. Below you will find my working SLL, but I want to make more use of C# and, instead of having two classes, SLL and Node, I want to use Node's constructors to do all the work (To where if you pass a string through the node, the constructor will chop it up into char nodes). The problem is, after an a few hours of tinkering, I'm not really getting anywhere... using System; using System.Collections.Generic; using System.Text; using System.IO; namespace PalindromeTester { class Program { static void Main(string[] args) { SLL mySLL = new SLL(); mySLL.add('a'); mySLL.add('b'); mySLL.add('c'); mySLL.add('d'); mySLL.add('e'); mySLL.add('f'); Console.Out.WriteLine("Node count = " + mySLL.count); mySLL.reverse(); mySLL.traverse(); Console.Out.WriteLine("\n The header is: " + mySLL.gethead); Console.In.ReadLine(); } class Node { private char letter; private Node next; public Node() { next = null; } public Node(char c) { this.data = c; } public Node(string s) { } public char data { get { return letter; } set { letter = value; } } public Node nextNode { get { return next; } set { next = value; } } } class SLL { private Node head; private int totalNode; public SLL() { head = null; totalNode = 0; } public void add(char s) { if (head == null) { head = new Node(); head.data = s; } else { Node temp; temp = new Node(); temp.data = s; temp.nextNode = head; head = temp; } totalNode++; } public int count { get { return totalNode; } } public char gethead { get { return head.data; } } public void traverse() { Node temp = head; while(temp != null) { Console.Write(temp.data + " "); temp = temp.nextNode; } } public void reverse() { Node q = null; Node p = this.head; while(p!=null) { Node r=p; p=p.nextNode; r.nextNode=q; q=r; } this.head = q; } } } } Here's what I have so far in trying to work it into Node's constructors: using System; using System.Collections.Generic; using System.Text; using System.IO; namespace PalindromeTester { class Program { static void Main(string[] args) { //Node myList = new Node(); //TextReader tr = new StreamReader("data.txt"); //string line; //while ((line = tr.ReadLine()) != null) //{ // Console.WriteLine(line); //} //tr.Close(); Node myNode = new Node("hello"); Console.Out.WriteLine(myNode.count); myNode.reverse(); myNode.traverse(); // Console.Out.WriteLine(myNode.gethead); Console.In.ReadLine(); } class Node { private char letter; private Node next; private Node head; private int totalNode; public Node() { head = null; totalNode = 0; } public Node(char c) { if (head == null) { head = new Node(); head.data = c; } else { Node temp; temp = new Node(); temp.data = c; temp.nextNode = head; head = temp; } totalNode++; } public Node(string s) { foreach (char x in s) { new Node(x); } } public char data { get { return letter; } set { letter = value; } } public Node nextNode { get { return next; } set { next = value; } } public void reverse() { Node q = null; Node p = this.head; while (p != null) { Node r = p; p = p.nextNode; r.nextNode = q; q = r; } this.head = q; } public void traverse() { Node temp = head; while (temp != null) { Console.Write(temp.data + " "); temp = temp.nextNode; } } public int count { get { return totalNode; } } } } } Ideally, the only constructors and methods I would be left with are Node(), Node(char c), Node(string s), Node reserve() and I'll be reworking traverse into a ToString overload. Any suggestions?

    Read the article

  • Can obfuscation (proguard) lead to MIDlet malfunction?

    - by eMgz
    Hi, Im trying to obfuscate a Java MIDlet with proguard. It runs ok on the PC, however, when I run it on the phone, the program opens, connects to the server, and then freezes. If I disable obfuscation, it runs ok again on the phone. Ive tryed all the obfuscation levels for apps (7, 8 and 9 at NetBeans), and none of them seems to work properly, and I cant release this app for comercial use without obfuscation. Also, the compiler throws some warnings: Note: duplicate definition of library class [java.io.ByteArrayOutputStream] Note: there were 14 duplicate class definitions. But I dont know if this is realy the problem. Does anyone knows what is wrong? The obfuscator arguments are listed below: Obfuscator Arguments (7): -dontusemixedcaseclassnames -default package '' -keep public class ** { public *; } Obfuscator Arguments (8): same as (7) plus -overloadaggressively. Obfuscator Arguments (9): same as (8) but -keep public class ** extends javax.microedition.midlet.MIDlet { public *; } instead. Thanks.

    Read the article

  • Spring Roo unable to generate Selenium tests because of Xerces error

    - by Wraith
    After watching Roo Google IO, I decided to try it out using this tutorial, but I'm getting stuck when trying to create Selenium tests. ~.web roo> selenium test --controller ~.web.PizzaOrderController Created SRC_MAIN_WEBAPP/selenium Created SRC_MAIN_WEBAPP/selenium/test-pizzaorder.xhtml Created SRC_MAIN_WEBAPP/selenium/test-suite.xhtml Undo create SRC_MAIN_WEBAPP/selenium/test-suite.xhtml Undo create SRC_MAIN_WEBAPP/selenium/test-pizzaorder.xhtml Undo create SRC_MAIN_WEBAPP/selenium com.sun.org.apache.xerces.internal.dom.DeferredCommentImpl cannot be cast to org.w3c.dom.Element A person at this forum suggested removing Xerces from the classpath because Java 6 has its own XML parser based on Xerces. However, I haven't come across a clear way to remove something from the classpath, only setting it (which I think would be tedious each time). Does anyone know of a clear way to remove jars from the classpath? Has anyone encountered this Roo problem before and solved it another way?

    Read the article

  • 503 (Server Unavailable) WebException when loading local XHTML file

    - by kcoppock
    Hello! So I'm currently working on an ePub reader application, and I've been reading through a bunch of regular XML files just fine with System.Xml and XmlDocument: XmlDocument xmldoc = new XmlDocument(); xmldoc.Load(Path.Combine(Directory.GetCurrentDirectory(), "META-INF/container.xml")); XmlNodeList xnl = xmldoc.GetElementsByTagName("rootfile"); However, now I'm trying to open the XHTML files that contain the actual book text, and they're XHTML files. Now I don't really know the difference between the two, but I'm getting the following error with this code (in the same document, using the same XmlDocument and XmlNodeList variable) xmldoc.Load(Path.Combine(Directory.GetCurrentDirectory(), "OEBPS/part1.xhtml")); "WebException was unhandled: The remote server returned an error: (503) Server Unavailable" It's a local document, so I'm not understanding why it's giving this error? Any help would be greatly appreciated. :) I've got the full source code here if it helps: http://drop.io/epubtest (I know the ePubConstructor.ParseDocument() method is horribly messy, I'm just trying to get it working at the moment before I split it into classes)

    Read the article

  • How to force javax xslt transformer to encode entities in utf-8?

    - by calavera.info
    I'm working on filter that should transform an output with some stylesheet. Important sections of code looks like this: PrintWriter out = response.getWriter(); ... StringReader sr = new StringReader(content); Source xmlSource = new StreamSource(sr, requestSystemId); transformer.setOutputProperty(OutputKeys.ENCODING, "UTF-8"); transformer.setParameter("encoding", "UTF-8"); //same result when using ByteArrayOutputStream xo = new java.io.ByteArrayOutputStream(); StringWriter xo = new StringWriter(); StreamResult result = new StreamResult(xo); transformer.transform(xmlSource, result); out.write(xo.toString()); The problem is that national characters are encoded as html entities and not by using UTF. Is there any way to force transformer to use UTF-8 instead of entities?

    Read the article

  • DataContractJsonSerializer set value extension point

    - by svinto
    using System.IO; using System.Runtime.Serialization; using System.Runtime.Serialization.Json; using System.Text; namespace ConsoleApplication1 { internal class Program { private static void Main(string[] args) { var pony = new Pony(); var serializer = new DataContractJsonSerializer(pony.GetType()); var example = @"{""Foo"":null}"; var stream = new MemoryStream(Encoding.UTF8.GetBytes(example.ToCharArray())); stream.Position = 0; pony = (Pony) serializer.ReadObject(stream); // The previous line throws an exception. } } [DataContract] public class Pony { [DataMember] private int Foo { get; set; } } } Sometimes the serialization throws a casting error on Int32s being set to null. Is there any way to hook into the Json-serializer?

    Read the article

  • Naming convention for utility classes in Java

    - by Zarjay
    When writing utility classes in Java, what are some good guidelines to follow? Should packges be "util" or "utils"? Is it ClassUtil or ClassUtils? When is a class a "Helper" or a "Utility"? Utility or Utilities? Or do you use a mixture of them? The standard Java library uses both Utils and Utilities: javax.swing.Utilities javax.print.attribute.AttributeSetUtilities javax.swing.plaf.basic.BasicGraphicsUtils Apache uses a variety of Util and Utils, although mostly Utils: org.apache.commons.modeler.util.DomUtil org.apache.commons.modeler.util.IntrospectionUtils org.apache.commons.io.FileSystemUtils org.apache.lucene.wordnet.AnalyzerUtil org.apache.lucene.util.ArrayUtil org.apache.lucene.xmlparser.DOMUtils Spring uses a lot of Helper and Utils classes: org.springframework.web.util.UrlPathHelper org.springframework.core.ReflectiveVisitorHelper org.springframework.core.NestedExceptionUtils org.springframework.util.NumberUtils So, how do you name your utility classes?

    Read the article

  • Problem using System.Xml in unit test in MonoDevelop (MonoTouch)

    - by hambonious
    I'm new to the MonoDevelop and MonoTouch environment so hopefully I'm just missing something easy here. When I have a unit test that requires the System.Xml or System.Xml.Linq namespaces, I get the following error when I run the test: System.IO.FileNotFoundException : Could not load file or assembly 'System.Xml.Linq, Version=2.0.5.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35' or one of its dependencies. Things I've verified: I have the proper usings in the test. The project builds with no problems. Using these namespaces work fine when I run the app in the emulator. I've written a very simple unit test to prove that unit testing works at all (and it does). I'm a test driven kinda guy so I can't wait to get this working so I can progress with my app. Thanks in advance.

    Read the article

  • Seam cache provider with ehcache null

    - by Cateno Viglio
    Hi every one, I'm trying to configure seam/ehcache following the tutorial from jboss page: http://docs.jboss.org/seam/2.1.2/reference/en-US/html/cache.html I put the ehcache.1.2.3.jar in project.ear/lib and injected CacheProvider as especified, but the CacheProvider always return null. The documentation doesn't show any aditional configuration for ehcache, just for jboss cache. I am probably doing something wrong, it's impossible be so easy :). besides put the jar in /lib, i created the following seam component to test: @Scope(ScopeType.SESSION) @Name("cacheBean") public class CacheSeamBean implements java.io.Serializable { @In(required=false, create=true) private EntityManager em; @Logger private Log log; @In private Events events; @In CacheProvider cacheProvider; Boolean blLoaded = Boolean.FALSE; @Create public void buscar() { if (!blLoaded){ List<Parametro> lstParametro = em.createQuery("select p from Parametro p").getResultList(); for (Parametro parametro : lstParametro){ cacheProvider.put(parametro.getCodigo(), parametro.getValor()); } blLoaded= Boolean.TRUE; } } } Thanks

    Read the article

  • Android RandomAccessFile usage from resource

    - by lacas
    my code is String fileIn = resources.getResourceName(resourceID); Log.e("fileIn", fileIn); //BufferedReader buffer = new BufferedReader(new InputStreamReader(fileIn)); RandomAccessFile buffer = null; try { buffer = new RandomAccessFile(fileIn, "r"); } catch (FileNotFoundException e) { Log.e("err", ""+e); } /fileIn(6062): ls3d.gold.paper:raw/wwe_obj i get 11-26 15:06:35.027: ERROR/err(6062): java.io.FileNotFoundException: /ls3d.gold.paper:raw/wwe_obj (No such file or directory) How can I access a file using randomaccessfile in java? How can I load from a resource? (R.raw.wwe_obj)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Can't get my head around background workers in .NET

    - by Connel
    I have wrote an application that syncs two folders together. The problem with the program is that it stops responding whilst copying files. A quick search of stack-overflow told me I need to use something called a background worker. I have read a few pages on the net about this but find it really hard to understand as I'm pretty new to programming. Below is the code for my application - how can I simply put all of the File.Copy(....) commands into their own background worker (if that's even how it works)? Below is the code for the button click event that runs the sub procedure and the sub procedure I wish to use a background worker on all the File.Copy lines. Button event: protected virtual void OnBtnSyncClicked (object sender, System.EventArgs e) { //sets running boolean to true booRunning=true; //sets progress bar to 0 prgProgressBar.Fraction = 0; //resets values used by progressbar dblCurrentStatus = 0; dblFolderSize = 0; //tests if user has entered the same folder for both target and destination if (fchDestination.CurrentFolder == fchTarget.CurrentFolder) { //creates message box MessageDialog msdSame = new MessageDialog(this, DialogFlags.Modal, MessageType.Error, ButtonsType.Close, "You cannot sync two folders that are the same"); //sets message box title msdSame.Title="Error"; //sets respone type ResponseType response = (ResponseType) msdSame.Run(); //if user clicks on close button or closes window then close message box if (response == ResponseType.Close || response == ResponseType.DeleteEvent) { msdSame.Destroy(); } return; } //tests if user has entered a target folder that is an extension of the destination folder // or if user has entered a desatination folder that is an extension of the target folder if (fchTarget.CurrentFolder.StartsWith(fchDestination.CurrentFolder) || fchDestination.CurrentFolder.StartsWith(fchTarget.CurrentFolder)) { //creates message box MessageDialog msdContains = new MessageDialog(this, DialogFlags.Modal, MessageType.Error, ButtonsType.Close, "You cannot sync a folder with one of its parent folders"); //sets message box title msdContains.Title="Error"; //sets respone type and runs message box ResponseType response = (ResponseType) msdContains.Run(); //if user clicks on close button or closes window then close message box if (response == ResponseType.Close || response == ResponseType.DeleteEvent) { msdContains.Destroy(); } return; } //gets folder size of target folder FileSizeOfTarget(fchTarget.CurrentFolder); //gets folder size of destination folder FileSizeOfDestination(fchDestination.CurrentFolder); //runs SyncTarget procedure SyncTarget(fchTarget.CurrentFolder); //runs SyncDestination procedure SyncDestination(fchDestination.CurrentFolder); //informs user process is complete prgProgressBar.Text = "Finished"; //sets running bool to false booRunning = false; } Sync sub-procedure: protected void SyncTarget (string strCurrentDirectory) { //string array of all the directories in directory string[] staAllDirectories = Directory.GetDirectories(strCurrentDirectory); //string array of all the files in directory string[] staAllFiles = Directory.GetFiles(strCurrentDirectory); //loop over each file in directory foreach (string strFile in staAllFiles) { //string of just the file's name and not its path string strFileName = System.IO.Path.GetFileName(strFile); //string containing directory in target folder string strDirectoryInsideTarget = System.IO.Path.GetDirectoryName(strFile).Substring(fchTarget.CurrentFolder.Length); //inform user as to what file is being copied prgProgressBar.Text="Syncing " + strFile; //tests if file does not exist in destination folder if (!File.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName)) { //if file does not exist copy it to destination folder, the true below means overwrite if file already exists File.Copy (strFile, fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName, true); } //tests if file does exist in destination folder if (File.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName)) { //long (number) that contains date of last write time of target file long lngTargetFileDate = File.GetLastWriteTime(strFile).ToFileTime(); //long (number) that contains date of last write time of destination file long lngDestinationFileDate = File.GetLastWriteTime(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName).ToFileTime(); //tests if target file is newer than destination file if (lngTargetFileDate > lngDestinationFileDate) { //if it is newer then copy file from target folder to destination folder File.Copy (strFile, fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName, true); } } //gets current file size FileInfo FileSize = new FileInfo(strFile); //sets file's filesize to dblCurrentStatus and adds it to current total of files dblCurrentStatus = dblCurrentStatus + FileSize.Length; double dblPercentage = dblCurrentStatus/dblFolderSize; prgProgressBar.Fraction = dblPercentage; } //loop over each folder in target folder foreach (string strDirectory in staAllDirectories) { //string containing directories inside target folder but not any higher directories string strDirectoryInsideTarget = strDirectory.Substring(fchTarget.CurrentFolder.Length); //tests if directory does not exist inside destination folder if (!Directory.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget)) { //it directory does not exisit create it Directory.CreateDirectory(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget); } //run sync on all files in directory SyncTarget(strDirectory); } } Any help will be greatly appreciated as after this the program will pretty much be finished :D

    Read the article

  • Why is there a seemingly identical copy of the JDK 1.5 core runtime in org.osgi.foundation-1.0.0.jar?

    - by Jonathan Neufeld
    I am maintaining a web application that depends on OSGi and Maven pulls-in a jar called org.osgi-foundation-1.0.0.jar that seems to contain the same classes as part of the JDK core runtime such as: java.util.*; java.io.*; etc. and so on. This seems very strange and I have to ask why this is necessary. More-over, my web-application fails to deploy on JBoss 6 because these are "illegal package names" for a third-party library. What is the purpose of org.osgi-foundation-1.0.0.jar ? is it necessary?

    Read the article

< Previous Page | 99 100 101 102 103 104 105 106 107 108 109 110  | Next Page >