Search Results

Search found 3953 results on 159 pages for 'overlapped io'.

Page 104/159 | < Previous Page | 100 101 102 103 104 105 106 107 108 109 110 111  | Next Page >

  • Android serialization: ImageView

    - by embo
    I have a simple class: public class Ball2 extends ImageView implements Serializable { public Ball2(Context context) { super(context); } } Serialization ok: private void saveState() throws IOException { ObjectOutputStream oos = new ObjectOutputStream(openFileOutput("data", MODE_PRIVATE)); try { Ball2 data = new Ball2(Game2.this); oos.writeObject(data); oos.flush(); } catch (Exception e) { Log.e("write error", e.getMessage(), e); } finally { oos.close(); } } But deserealization private void loadState() throws IOException { ObjectInputStream ois = new ObjectInputStream(openFileInput("data")); try { Ball2 data = (Ball2) ois.readObject(); } catch (Exception e) { Log.e("read error", e.getMessage(), e); } finally { ois.close(); } } fail with error: 03-24 21:52:43.305: ERROR/read error(1948): java.io.InvalidClassException: android.widget.ImageView; IllegalAccessException How deserialize object correctly?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Why is there a seemingly identical copy of the JDK 1.5 core runtime in org.osgi.foundation-1.0.0.jar?

    - by Jonathan Neufeld
    I am maintaining a web application that depends on OSGi and Maven pulls-in a jar called org.osgi-foundation-1.0.0.jar that seems to contain the same classes as part of the JDK core runtime such as: java.util.*; java.io.*; etc. and so on. This seems very strange and I have to ask why this is necessary. More-over, my web-application fails to deploy on JBoss 6 because these are "illegal package names" for a third-party library. What is the purpose of org.osgi-foundation-1.0.0.jar ? is it necessary?

    Read the article

  • Java: conditional initialization?

    - by HH
    Ruby has conditional initialization. Apparently, Java does not or does it? I try to write more succintly, to limit the range as small as possible. import java.io.*; import java.util.*; public class InitFor{ public static void main(String[] args){ for(int i=7,k=999;i+((String h="hello").size())<10;i++){} System.out.println("It should be: hello = "+h); } } Errors Press ENTER or type command to continue InitFor.java:8: ')' expected for(int i=7,k=999;i+((String h="hello").size())<10;i++){} ^

    Read the article

  • Java based Atom/RSS Library that works in Google App Engine

    - by Littlejon
    I am trying to publish an Atom/RSS feed in my Java based Google App Engine code. I have tried using Rome and keep getting the following error (tried googling without success), also the code I am running that generates the error is the demo code (so I get the feeling Rome won't work with GAE) java.lang.NoClassDefFoundError: org/jdom/JDOMException at com.sun.syndication.io.SyndFeedOutput.<init>(SyndFeedOutput.java:44) What I am looking for is recommendations for a simple Java library to create and publish an Atom feed from within Google App Engine. Thanks.

    Read the article

  • Problem with building with csc task in Ant

    - by Wing C. Chen
    I have an ant build target using csc: <target name="compile"> <echo>Starting compiling ServiceLauncher</echo> <csc optimize="true" debug="true" warnLevel="1" unsafe="false" targetType="exe" failonerror="true" incremental="false" mainClass = "ServiceLauncher.Launcher" srcdir="ServiceLauncher/Launcher/" outputfile="ServiceLauncher.exe" > <reference file="libs/log4net.dll"/> <define name="RELEASE"/> </csc> </target> When I run it, the following exception comes up: csc failed: java.io.IOException: Cannot run program "csc": CreateProcess error=2, The system cannot find the file specified However, it runs without the exception but never correctly builds the .exe file, when I manually add in an empty ServiceLauncher.exe. How can I correctly build this .Net project "ServiceLauncher"?

    Read the article

  • /clr option in c++

    - by muhammad-aslam
    hello friendzz plz give me a solution for this error "fatal error C1190: managed targeted code requires a '/clr' option" HOw can i resolve this problem?? My configuration is .. Visual studio 2008 windows 7 Here is the code (i got by using net resources) using using namespace System; using namespace System::IO; int main() { // Create a reference to the current directory. DirectoryInfo* di = new DirectoryInfo(Environment::CurrentDirectory); // Create an array representing the files in the current directory. FileInfo* fi[] = di-GetFiles(); Console::WriteLine(S"The following files exist in the current directory:"); // Print out the names of the files in the current directory. Collections::IEnumerator* myEnum = fi-GetEnumerator(); while (myEnum-MoveNext()) { FileInfo* fiTemp = __try_cast(myEnum-Current); Console::WriteLine(fiTemp-Name); } } PLZZZZZZZZ

    Read the article

  • how to feed a file to telnet

    - by knittl
    hello community, understanding http and headers i played around with telnet to send requests. to not type everything again and again and again i thought i'd write a small textfile with all the commands i need. my file is as simple as follows: GET /somefile.php HTTP/1.1 Host: localhost i then try to feed it to telnet with io-redirection: $ telnet localhost 80 < telnet.txt but all output i get is Trying ::1... Connected to localhost. Escape character is '^]'. Connection closed by foreign host. what am i doing wrong?

    Read the article

  • Linking IronPython to WPF

    - by DonnyD
    I just installed VS2010 and the great new IronPython Tools extension. Currently this extension doesn't yet generate event handlers in code upon double-clicking wpf visual controls. Is there anyone that can provide or point me to an example as to how to code wpf event handlers manually in python. I've had no luck finding any and I am new to visual studio. Upon generating a new ipython wpf project the auto-generated code is: import clr clr.AddReference('PresentationFramework') from System.Windows.Markup import XamlReader from System.Windows import Application from System.IO import FileStream, FileMode app = Application() app.Run(XamlReader.Load(FileStream('WpfApplication7.xaml', FileMode.Open))) and the XAML is: <Window xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" Title="WpfApplication7" Height="300" Width="300"> <Button>Click Me</Button> </Window> Any help would be appreciated.

    Read the article

  • Can't Use Path in ASP MVC Action

    - by user1477388
    I am trying to use Path() but it has a blue line under it and says, "local variable (path) cannot be referred to until it is declared." How can I use Path()? Imports System.Globalization Imports System.IO Public Class MessageController Inherits System.Web.Mvc.Controller <EmployeeAuthorize()> <HttpPost()> Function SendReply(ByVal id As Integer, ByVal message As String, ByVal files As IEnumerable(Of HttpPostedFileBase)) As JsonResult ' upload files For Each i In files If (i.ContentLength > 0) Then Dim fileName = path.GetFileName(i.FileName) Dim path = path.Combine(Server.MapPath("~/App_Data/uploads"), fileName) i.SaveAs(path) End If Next End Function End Class

    Read the article

  • Newbie Question: Read and Process a List of Text Files

    - by johnv
    I'm completely new to .NET and am trying as a first step to write a text processing program. The task is simple: I have a list of 10,000 text files stored in one folder, and I'm trying to read each one, store it as a string variable, then run it through a series of functions, then save the final output to another folder. So far I can only manage to manually input the file path like this (in VB.NET): Dim tRead As System.IO.StreamReader Public Function ReadFile() As String Dim EntireFile As String tRead = File.OpenText("c:\textexample\00001.txt") EntireFile = tRead.ReadToEnd Return EntireFile End Function Public Function Step1() ..... End Function Public Function Step2() ..... End Function .............. I'm wondering, therefore, if there's a way to automate this process. Perhaps for example store all input file path into a text file then read each entry at a time, then save the final output into the save path, again listed in a text file. Any help is greatly appreciated. ReplyQuote

    Read the article

  • Spring: Inject static member (System.in) via constructor

    - by Julian Lettner
    I wrote some sort of console client for a simple application. To be more flexible, I thought it would be nice to only depend on java.io.Input-/OutputStream, instead of accessing System.in/out directly. I renamed the class ConsoleClient to StreamClient, added setters and made sure that the instance fields are used instead of System.in/out. At the moment my client code looks like this: ApplicationContext appCtx = new ClassPathXmlApplicationContext("..."); StreamClient cc = (StreamClient) appCtx.getBean("streamClient"); cc.setInputStream(System.in); cc.setOutputStream(System.out); cc.run(); // start client Question: Is there a way to move lines 3 and 4 into the Spring configuration (preferably constructor injection)? Thanks for your time.

    Read the article

  • Why doesn't this code using the ruby-mbox gem parse mbox files?

    - by cartoonfox
    I installed ruby-mbox by doing gem install ruby-mbox Running this: #!/usr/bin/ruby require 'rubygems' require 'mbox' m = IO.read('test.eml') puts m.size m = Mbox.new(m) puts m produces this: 71309505 /Library/Ruby/Gems/1.8/gems/ruby-mbox-0.0.2/lib/mbox/mbox.rb:45:in `initialize': uninitialized constant Mbox::StringIO (NameError) from r.rb:7:in `new' from r.rb:7 I have proved that "m" is assigned a string containing the contents of the file, just before Mbox.new(m) is called. It looks as though the Mbox::StringIO should have been defined by hasn't been. What's going wrong here? Ruby version: ruby 1.8.7 (2009-06-12 patchlevel 174) [universal-darwin10.0] (That's the default ruby installed on OS X 10.6.6)

    Read the article

  • Map the physical file path in asp.net mvc

    - by rmassart
    Hi, I am trying to read an XSLT file from disk in my ASP.Net MVC controller. What I am doing is the following: string filepath = HttpContext.Request.PhysicalApplicationPath; filepath += "/Content/Xsl/pubmed.xslt"; string xsl = System.IO.File.ReadAllText(filepath); However, half way down this thread on forums.asp.net there is the following quote HttpContext.Current is evil and if you use it anywhere in your mvc app you are doing something wrong because you do not need it. Whilst I am not using "Current", I am wondering what is the best way to determine the absolute physical path of a file in MVC? For some reason (I don't know why!) HttpContext doesn't feel right for me. Is there a better (or recommended/best practice) way of reading files from disk in ASP.Net MVC? Thanks for your help, Robin

    Read the article

  • Use DLL and have it be as trusted as my own application is

    - by Binary255
    Hi, I am using a port of GNU GetOpts, to be specific I am using the one at: http://getopt.codeplex.com I have added the DLL as a reference. But when I run my application I receive an exception: System.IO.FileLoadException was unhandled Message="Could not load file or assembly 'Gnu.Getopt, Version=0.9.1.24287, Culture=neutral, PublicKeyToken=d014b4ccdc53511a' or one of its dependencies. Failed to grant permission to execute. (Exception from HRESULT: 0x80131418)" If it is possible I would like my application to say, "trust this DLL as much as you trust me". Is there a way to do that so I won't have to fiddle with security settings? And if there is not. What is the cleanest way to get the DLL working?

    Read the article

  • java checked exception in a catch clause compilation error

    - by srandpersonia
    Hi, I was expecting an compilation error in the following program because of the throw statement in the catch block as IOException is a checked exception and it is not caught by another try block within the catch block. But I am getting "Hurray!" printed. Any explanation would be much appreciated. According to JLS 11.2.3, http://java.sun.com/docs/books/jls/third_edition/html/exceptions.html It is a compile-time error if a method or constructor body can throw some exception type E when both of the following hold: * E is a checked exception type * E is not a subtype of some type declared in the throws clause of the method or constructor. import java.io.*; public class Test{ public static void main(String args[]) { System.out.println(method()); } public static int method() { try{ throw new Exception(); } catch(Exception e){ throw new IOException(); //No compile time error } finally{ System.out.println("Hurray!"); } } } Thanks in advance.

    Read the article

  • XML over HTTP with JMS and Spring

    - by Will Sumekar
    I have a legacy HTTP server where I need to send an XML file over HTTP request (POST) using Java (not browser) and the server will respond with another XML in its HTTP response. It is similar to Web Service but there's no WSDL and I have to follow the existing XML structure to construct my XML to be sent. I have done a research and found an example that matches my requirement here. The example uses HttpClient from Apache Commons. (There are also other examples I found but they use java.net networking package (like URLConnection) which is tedious so I don't want to use them). But it's also my requirement to use Spring and JMS. I know from Spring's reference that it's possible to combine HttpClient, JMS and Spring. My question is, how? Note that it's NOT in my requirement to use HttpClient. If you have a better suggestion, I'm welcome. Appreciate it. For your reference, here's the XML-over-HTTP example I've been talking about: /* * $Header: * $Revision$ * $Date$ * ==================================================================== * * Copyright 2002-2004 The Apache Software Foundation * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. * You may obtain a copy of the License at * * http://www.apache.org/licenses/LICENSE-2.0 * * Unless required by applicable law or agreed to in writing, software * distributed under the License is distributed on an "AS IS" BASIS, * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. * See the License for the specific language governing permissions and * limitations under the License. * ==================================================================== * * This software consists of voluntary contributions made by many * individuals on behalf of the Apache Software Foundation. For more * information on the Apache Software Foundation, please see * <http://www.apache.org/>. * * [Additional notices, if required by prior licensing conditions] * */ import java.io.File; import java.io.FileInputStream; import org.apache.commons.httpclient.HttpClient; import org.apache.commons.httpclient.methods.InputStreamRequestEntity; import org.apache.commons.httpclient.methods.PostMethod; /** * * This is a sample application that demonstrates * how to use the Jakarta HttpClient API. * * This application sends an XML document * to a remote web server using HTTP POST * * @author Sean C. Sullivan * @author Ortwin Glück * @author Oleg Kalnichevski */ public class PostXML { /** * * Usage: * java PostXML http://mywebserver:80/ c:\foo.xml * * @param args command line arguments * Argument 0 is a URL to a web server * Argument 1 is a local filename * */ public static void main(String[] args) throws Exception { if (args.length != 2) { System.out.println( "Usage: java -classpath <classpath> [-Dorg.apache.commons."+ "logging.simplelog.defaultlog=<loglevel>]" + " PostXML <url> <filename>]"); System.out.println("<classpath> - must contain the "+ "commons-httpclient.jar and commons-logging.jar"); System.out.println("<loglevel> - one of error, "+ "warn, info, debug, trace"); System.out.println("<url> - the URL to post the file to"); System.out.println("<filename> - file to post to the URL"); System.out.println(); System.exit(1); } // Get target URL String strURL = args[0]; // Get file to be posted String strXMLFilename = args[1]; File input = new File(strXMLFilename); // Prepare HTTP post PostMethod post = new PostMethod(strURL); // Request content will be retrieved directly // from the input stream // Per default, the request content needs to be buffered // in order to determine its length. // Request body buffering can be avoided when // content length is explicitly specified post.setRequestEntity(new InputStreamRequestEntity( new FileInputStream(input), input.length())); // Specify content type and encoding // If content encoding is not explicitly specified // ISO-8859-1 is assumed post.setRequestHeader( "Content-type", "text/xml; charset=ISO-8859-1"); // Get HTTP client HttpClient httpclient = new HttpClient(); // Execute request try { int result = httpclient.executeMethod(post); // Display status code System.out.println("Response status code: " + result); // Display response System.out.println("Response body: "); System.out.println(post.getResponseBodyAsString()); } finally { // Release current connection to the connection pool // once you are done post.releaseConnection(); } } }

    Read the article

  • how do I get the IP of incoming ICMP due to UDP-send to dead client in Ruby?

    - by banister
    so.. I'm doing a small multiplayer game with blocking UDP and IO.select. To my problem.. (In the server) reading from a UDP socket (packet, sender = @socket.recvfrom(1000)) which have just sent a packet to a dead client results in a ICMP unreachable (and exception Errno::ECONNRESET in ruby). The problem is that I can't find any way whatsoever to extract the IP of that ICMP.. so I can clean out that dead client. Anyone know how to achieve this? thanks

    Read the article

  • [ASP.NET] IIS7 downloading file length

    - by GTD
    I've following code for file download: FileInfo fileInfo = new FileInfo(filePath); context.Response.Clear(); context.Response.ContentType = "application/octet-stream"; context.Response.AddHeader("Content-Disposition", "attachment; filename=" + System.IO.Path.GetFileName(filePath)); context.Response.AddHeader("Content-Length", fileInfo.Length.ToString()); context.Response.WriteFile(filePath); context.Response.End(); When I run it on my local IIS6 it works fine. Web browser (tested on IE8, Firefox 3.5.2, Opera 10) shows file length before I start download the file. When I run this code on remote IIS7, web browser doesn't shows file length. File length is unknown. Why I don't get file length when this code runs under IIS7?

    Read the article

  • Redis version on Cloudbees is out of date?

    - by Alan Krueger
    I'm setting up an OSS build in Cloudbees with /usr/sbin/redis-server being started as one of the build tasks: + /usr/sbin/redis-server [204] 04 Nov 03:52:58 # Warning: no config file specified, using the default config. In order to specify a config file use 'redis-server /path/to/redis.conf' [204] 04 Nov 03:52:58 * Server started, Redis version 2.0.3 The (Redis site)[http://redis.io/download] shows 2.6.2 to be the current version and 2.4.17 as "legacy". On the extended downloads page, version 2.0.3 is deprecated. Am I launching it the wrong server executable, or are there plans to support a more recent version of Redis?

    Read the article

  • How to acces File over the Network

    - by Polo
    Hi! I am having a hard time on this one, I have à folder over the network wit public accès (no credential restriction). I am trying to do à File.Exist or Directory.Exist and I keep on having a exception. Can somewone tell me the good way to do IO over the network. EDIT 1 FOR DETAILS: if i do execture = \agoodip\Public\test.txt I get the file etc etc In my code it look like a basic Directory.Exist(@"\agoodip\Public") or File.exist(@"\agoodip\Public\test.txt") The exception I get is Path not found. Thanks!

    Read the article

  • Getting parameter sent via html form and saving in my db

    - by Wesley
    I have error in my code i don't know to solve it please help me: My Servlet: package br.com.cad.servlet; import java.io.IOException; import java.io.PrintWriter; import java.util.Date; import java.text.ParseException; import java.text.SimpleDateFormat; import java.util.Calendar; import javax.servlet.ServletException; import javax.servlet.http.HttpServlet; import javax.servlet.http.HttpServletRequest; import javax.servlet.http.HttpServletResponse; import br.com.cad.dao.Cadastro; import br.com.cad.basica.Contato; public class AddDados extends HttpServlet{ protected void service(HttpServletRequest request, HttpServletResponse response) throws IOException, ServletException { PrintWriter out = response.getWriter(); String nome = request.getParameter("nome"); String sobrenome = request.getParameter("sobrenome"); String rg = request.getParameter("rg"); String cpf = request.getParameter("cpf"); String sexo = request.getParameter("sexo"); StringBuilder finalDate = new StringBuilder("DataNascimento1") .append("/"+request.getParameter("DataNascimento??2")) .append("/"+request.getParameter("DataNascimento3")); try { SimpleDateFormat sdf = new SimpleDateFormat("dd/MM/yyyy"); finalDate.toString(); } catch(ParseException e) { out.println("Erro de conversão da data"); return; } Contato contato = new Contato(); contato.setNome(nome); contato.setSobrenome(sobrenome); contato.setRg(rg); contato.setCpf(cpf); contato.setSexo(sexo); if ("Masculino".equals(contato.getSexo())) { contato.setSexo("M"); } else { contato.setSexo("F"); } contato.setDataNascimento1(dataNascimento1); //error here ????? contato.setDataNascimento2(dataNascimento2); //error here ????? contato.setDataNascimento3(dataNascimento3); //error here ????? Cadastro dao = new Cadastro(); dao.adiciona(contato); out.println("<html>"); out.println("<body>"); out.println("Contato " + contato.getNome() + " adicionado com sucesso"); out.println("</body>"); out.println("</html>"); } } My object dao package br.com.cad.dao; import java.sql.Connection; import java.sql.PreparedStatement; import java.sql.SQLException; import java.sql.Date; import br.com.cad.dao.ConnectDb; import br.com.cad.basica.Contato; public class Cadastro { private Connection connection; public Cadastro() { this.connection = new ConnectDb().getConnection(); } public void adiciona(Contato contato) { String sql = "INSERT INTO dados_cadastro(pf_nome, pf_ultimonome, pf_rg, pf_cpf, pf_sexo,pf_dt_nasc) VALUES(?,?,?,?,?,?,?,?)"; try { PreparedStatement stmt = connection.prepareStatement(sql); stmt.setString(1, contato.getNome()); stmt.setString(2, contato.getSobrenome()); stmt.setString(3, contato.getRg()); stmt.setString(4, contato.getCpf()); stmt.setString(5, contato.getSexo()); stmt.setDate(6, new Date( contato.getDataNascimento1().getTimeInMillis()) ); // i think there are error here i don't know to solve it ????? stmt.execute(); stmt.close(); System.out.println("Cadastro realizado com sucesso!."); } catch(SQLException sqlException) { throw new RuntimeException(sqlException); } } } My class cadastro package br.com.cad.basica; import java.util.Calendar; public class Contato { private Long id; private String nome; private String sobrenome; private String email; private String endereco; private Calendar dataNascimento1; private Calendar dataNascimento2; private Calendar dataNascimento3; private String rg; private String cpf; private String sexo; public Long getId() { return id; } public void setId(Long id) { this.id = id; } public String getNome() { return nome; } public void setNome(String nome) { this.nome = nome; } ...getters and setters I need to saving data in my mysql db, but i have some doubt about this code main how to get parameter send form html combobox( 1 for day, 2 for month, 3 for year of birth) i concatened with StringBuilder finalDate ... so i have some problem in my code please help me!!!

    Read the article

  • "Ant all" not working for me

    - by bobjink
    I have got involved in a project. This project uses ant which is not something I am comfortable with. I have checked out the source code and tried running ant on the most outer directory. Running 'ant' in commando prompt takes 1 sec and I get a BUILD SUCCESFULL message. If I run 'ant all' I get a BUILD FAILED. Java.io.IOExceptio: Cannot run program "ant": CreateProcess=2, the system cannot find the file specified and then a long stacktrace. Most of the people on the project runs OS-X while I use Windows XP. Any help or information is appreciated :)

    Read the article

  • Find directory on different server C#

    - by rainhider
    I have a website on Server A and it needs to find a directory on Server B. On my aspx page, I have: <mb:FileSystemDataSource ID="fileSystemDataSource" runat="server" RootPath="\\servername\Folder\Subfolder" FoldersOnly="true" /> mb is assembly name alias. On my aspx.cs page, I have: protected void Page_Load(object sender, EventArgs e) { DataTable gridviewSource = DisplayFilesInGridView(); DataRow gridviewRow; //sets the server path so it does not default to current server string ServerPath = System.IO.Path.Combine( "//", this.fileSystemDataSource.RootPath); //Get All Folders Or Directories and add in table DirectoryInfo directory = new DirectoryInfo(Server.MapPath(ServerPath)); DirectoryInfo[] subDirectories = directory.GetDirectories(); } Well, it throws an error on the Server.MapPath because it cannot find the server. I am connected to the network. I looked at IIS, and I am pretty sure that is not the problem. If so, I would really need specifics. Any help would be appreciated.

    Read the article

  • MS Build Server 2010 - Buffer Overflow

    - by user329005
    Hey everybody, I try to build an solution in MS Build Server (MS Visual Studio 2010 ver 10.0.30319.1) about ServerTasks - Builds - Server Task Builder - Queue new Built and go, 47 seconds later I get an error output: CSC: Unexpected error creating debug information file 'c:\Builds\1\ServerTasks\Server-Tasks Builder\Sources\ThirdParty\Sources\samus-mongodb-csharp-2b8934f\MongoDB.Linq\obj\Debug\MongoDB.Linq.PDB' -- 'c:\Builds\1\ServerTasks\Server-Tasks Builder\Sources\ThirdParty\Sources\samus-mongodb-csharp-2b8934f\MongoDB.Linq\obj\Debug\MongoDB.Linq.pdb: Access denied I checked the permissions of directory and set it (for debug purposes only) to grant access for all users, but still having an issue. Running the Procmon and filter file access for directory: 'c:\Builds\1\ServerTasks\Server-Tasks Builder\Sources\ThirdParty\Sources\samus-mongodb-csharp-2b8934f\MongoDB.Linq\obj\Debug\' tells me: 16:41:00,5449813 TFSBuildServiceHost.exe 3528 QuerySecurityFile C:\Builds\1\ServerTasks\Server-Tasks Builder\Sources\ThirdParty\Sources\samus-mongodb-csharp-2b8934f\MongoDB.Linq\obj\Debug BUFFER OVERFLOW Information: DACL, 0x20000000 and 16:41:00,5462119 TFSBuildServiceHost.exe 3528 QueryOpen C:\Builds\1\ServerTasks\Server-Tasks Builder\Sources\ThirdParty\Sources\samus-mongodb-csharp-2b8934f\MongoDB.Linq\obj\Debug FAST IO DISALLOWED Any ideas?

    Read the article

< Previous Page | 100 101 102 103 104 105 106 107 108 109 110 111  | Next Page >