Search Results

Search found 7897 results on 316 pages for 'generate'.

Page 189/316 | < Previous Page | 185 186 187 188 189 190 191 192 193 194 195 196  | Next Page >

  • Definitive best practice for injecting, manipulating AJAX data

    - by Nic
    Ever since my foray into AJAX, I've always used the "whatever works" method of manipulating AJAX data returns. I'd like to know what the definitive and modern best practice is for handling data. Is it best practice to generate the HTML via the server script and introduce the returned data on the onComplete function? Should XML/JSON be looked at first before anything? How about manipulating the returned data? Using .live() doesn't seem like it is the most efficient way. I've never seen a definitive answer to this question. Your expertise is much appreciated.

    Read the article

  • Are hash values globally unqiue

    - by Wololo
    I want to generate a hash code for a file. Using C# I would do something like this then store the value in a database. byte[] b = File.ReadAllBytes(@"C:\image.jpg"); string hash = ComputeHash(b); Now, if i use say a Java program that implements the same hashing alogorithm (Md5), can i expect the hash values to be the equal to the value generated in C#? What if i execute the java program from different environments, Windows, Linux or Mac?

    Read the article

  • Create table from a business object with conditional layout

    - by Simon Martin
    I need to generate a table from a List(Of Students). My Student class has properties for AcademicYear, TeachingSet, Surname and Forenames, is sorted in that order and also properties for ID and start date. The table should nest TeachingSets within AcademicYears and then the students within the TeachingSets, as shown in the table I've mocked up at http://www.ifslearning.ac.uk/files/student-table.jpg Using a repeater I get 08-10 students B74394 Mzejb Bsppn 08-10 students B74395 Lbuifsjof Bvti 08-10 students C68924 Epoob Cmpblf 08-10 students D41468 Ipxbse Dbwfz But I need to have 08-10 students - B74394 Mzejb Bsppn - B74395 Lbuifsjof Bvti - C68924 Epoob Cmpblf - D41468 Ipxbse Dbwfz

    Read the article

  • What is the point in using a "real" database modeling tool?

    - by cdeszaq
    We currently have a 10 year old nasty, spaghetti-code-style SQL Server database that we are soon looking to pretty much re-write from scratch as part of a re-write to a large web application. (The existing application will serve as the functional requirements for the next incarnation of the app). Some have suggested we use Visio to do all the diagramming and to generate the DDL, but others have suggested we use a dedicated database design tool, rather than a diagramming tool that is able to export DDL. Is there any benefit to using "real" DB design tools, such as ModelRight, over general tools like Visio? If so, what are those specific benefits? Edit: In a nutshell, what can real/dedicated tools do that something like Visio can't, and how much do these capabilities matter (from a best-practices standpoint, for example)

    Read the article

  • Is there a way to automatically update the documentation in an R package?

    - by David
    I used 'package.skeleton()' to generate .Rd help files a few months ago. I have edited these files, and I have also changed the functions, removed some functions, added others. Is there a function that automates updating the Rd files? update A nice package was just released called Rd2roxygen, it is described by the author Yihui Xie on his blog. As the name implies, this package allows one to retroactively insert documentation currently contained in .Rd into .R files. Sounds like a promising approach for both learning roxygen and for converting packages currently in development to R packages. Woo hoo. Thanks Yihui!

    Read the article

  • GEM Version Requirements Deprecated

    - by Kevin Sylvestre
    When creating a new Rails project using: rails sample Then creating a model using: script/generate model person first_name:string last_name:string Everything is fine. However, if I add any gems to my environment.rb: config.gem "authlogic" And run the same generator, I get the following: /Library/Ruby/Gems/1.8/gems/rails-2.3.5/lib/rails/gem_dependency.rb:119:Warning: Gem::Dependency#version_requirements is deprecated and will be removed on or after August 2010. The warning just recently appeared (I think), but I would like to fix it if possible. Any hints or similar experiences? Thanks.

    Read the article

  • Cannot Debug Unmanaged Dll from C#

    - by JustSmith
    I have a DLL that was written in C++ and called from a C# application. The DLL is unmanaged code. If I copy the DLL and its .pdb files with a post build event to the C# app's debug execution dir I still can't hit any break points I put into the DLL code. The break point has a message attached to it saying that "no symbols have been loaded for this document". What else do I have to do to get the debugging in the dll source? I have "Tools-Options-Debugging-General-Enable only my code" Disabled. The DLL is being compiled with "Runtime tracking and disable optimizations (/ASSEMBLYDEBUG)" and Generate Debug Info to "Yes (/DEBUG)"

    Read the article

  • What is a TFS Agile Issue?

    - by Jaxidian
    With TFS2010 using the "MSF for Agile Software Development v5" process template, I'm having some difficulty in understanding exactly what an Issue is. The most specific documentation I've been able to find is this. Is an Issue a higher-level item for which we will probably generate a Bug for after some investigation in code/requirements? Or is an Issue something different than a Bug because it has not actually a mistake in code but is more of a critical oversight in design (for example, there was never an attempt to create a datepicker for all date fields and this is a UX issue but not really a bug) and therefore a change request of sorts? Or is it something different?

    Read the article

  • Flight paths linking placemarks using Java Api For Kml(JAK)

    - by Kayson
    Currently i'm having a project which requires to set placemarks and link them with polylines (i suppose), lines which have an arc to it, with properly segmented portions to the arc. I've been able to generate kml file with jak library. But i can't produce more den 1 placemark in the kml file. And i'm quite stuck at the link of paths. http://www.barnabu.co.uk/google-earth-complete-us-air-routes/ This website is something that is close to what i'm required to do. I'm very new towards kml and java so please help me out. Thanks in advance.

    Read the article

  • HLSL: Enforce Constant Register Limit at Compile Time

    - by Andrew Russell
    In HLSL, is there any way to limit the number of constant registers that the compiler uses? Specifically, if I have something like: float4 foobar[300]; In a vs_2_0 vertex shader, the compiler will merrily generate the effect with more than 256 constant registers. But a 2.0 vertex shader is only guaranteed to have access to 256 constant registers, so when I try to use the effect, it fails in an obscure and GPU-dependent way at runtime. I would much rather have it fail at compile time. This problem is especially annoying as the compiler itself allocates constant registers behind the scenes, on top of the ones I am asking for. I have to check the assembly to see if I'm over the limit. Ideally I'd like to do this in HLSL (I'm using the XNA content pipeline), but if there's a flag that can be passed to the compiler that would also be interesting.

    Read the article

  • .NET library for generating javascript?

    - by Rune
    Do you know of a .NET library for generating javascript code? I want to generate javascript code based on information in my .NET application. I would like to be able to create an AST-like datastructure (using C#) and have it turned into valid javascript. I need to be able to create functions, statements, expressions etc., so I need something more than a JSON serializer - but I guess you could think of this as a (very) generalized JSON serializer. Do such libraries exist and if so, could you recommend any? Thank you.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How do I Relate these 4 Tables

    - by Baddie
    Trying to setup a simple Thread/Poll table mapping. Here is what I have: Threads table ThreadID (Primary Key/Identity Column) Polls table PollID (Primary Key, FK for ThreadID for one-to-one relation) Question PollOptions table PollOptionID (Identity/Primary Key) Text PollID PollVotes table PollVoteID (Primary Key/Identity) PollOptionID I'm not sure if this is a proper relationship. It seems wrong but I'm not sure whats wrong with it. A Thread can have 0 or 1 Poll. A Poll can have 2 or more PollOptions. A PollOption can have 0 or many PollVotes. I'm going to be using Entity Framework and before I generate the code for it (VS 2010, .NET 4) I want to make sure I have the proper relationship mapping.

    Read the article

  • MVC Implementation PHP Zend PDF generation

    - by zod
    Am using Zend framework and PHP Am going to generate a PDF using Zend . So the View is PDF.There is no PHTML. But if i dont use PHTML in view , is it a perfect MVC? if i want to be a perfect MVC shall i do the db retrieval and variable declaration and assigning in controller and use view and use all pdf functions in view phtml file will it make a perfect MVC? What is the advantage of MVC in this case? :-) can i do the include of zend pdf in phtml file or controller php file? what is the difference ?

    Read the article

  • Techniques to avoid DeadlineExceededException in GAE/J?

    - by Tahir Akram
    I am developing an Twitter4J web application in Google App Engine/Java. I need to show two lists. One is Twitter friends and other is followers. With photo and screen name. It is working fine for people who have 20-30 followers and friends. But it gave me DeadlineExceededException when I try a user who has 150+ followers and friends. GAE throws this exception if web request take time more than 30 seconds. So what techniques I can adopt to avoid this exception. Should I generate two AJAX calls for each of my list. After page loads. So that every call will have its own 30 secs limit? Or what else you think? I am gone make it. Please help.

    Read the article

  • uniform generation of 3D points on cylinder/cone

    - by Myx
    Hello: I wish to randomly and uniformly generate points on a cylinder and a cone (separately). The cylinder is defined by its center, its radius and height. Same specifications for the cone. I am able to get the bounding box for each shape so I was thinking of generating points within the bounding box. However, I'm not sure how to project them onto the cylinder/cone or if this is the best idea. Any suggestions? Thanks.

    Read the article

  • Django, CSRF protection and js generated form

    - by Neewok
    I have to create a form dynamically via javascript (yeah, that sounds ugly, but read this for the reason) and wants to make its submission CSRF proof. Usually, I use the @csrf_protect decorator in my views, and the {% csrf_token %} tag in my templates, as recommanded in the doc. But what should I do with a client-side generated form ? If I add a '/get_token/' view to generate a token on the server and obtain its value (say, via JSONP), then that means that I'm creating a backdoor an attacker could use to bypass the protection. Kinda head-scratching. What would you recommand ?

    Read the article

  • How to achieve multiple grids like the SQL server Results pane

    - by Skun
    Hi guys ! I'm having problems with my project once again :( The front end is C# I need to support multiline querying like MS SQL server and when these queries are executed, naturally there are going to be multiple result sets. Getting the datatables respective to the results is not a problem, but how do i make it appear like its done in MS SQL server. One result set below the other and with a scroll bar? Should i bind it to a datagrid? If so how can i bind multiple tables to a datagrid ? and will it generate the scrollbars and the columns automatically? If i am not clear, please let me know and i'll try to be more clearer. ps: If anyone knows how this can be done with the XtraGridControl in devexpress that would be awesome ! :D

    Read the article

  • Is there a Java API for creating a XHTML document?

    - by Bedwyr Humphreys
    I want to provide a simple XHTML representation of each of the resources in a REST web service. At the moment i'm using a StringBuilder to generate these which is both tedious and error prone. I don't see these changing after I publish the service but the process of coding each is a bit painful. Is there a XHTML document writer api? Should I just use an XML writer? Which one? Should I just roll my own basic HTML document class - doctype is the same each time, i just need to set the title, metatags and body content, most of which (but not all content) is already in HTML for the GETs. Or should I just use StringBuilder and stop whining? ;) Thanks.

    Read the article

  • Using PIG with Hadoop, how do I regex match parts of text with an unknown number of groups?

    - by lmonson
    I'm using Amazon's elastic map reduce. I have log files that look something like this random text foo="1" more random text foo="2" more text noise foo="1" blah blah blah foo="1" blah blah foo="3" blah blah foo="4" ... How can I write a pig expression to pick out all the numbers in the 'foo' expressions? I prefer tuples that look something like this: (1,2) (1) (1,3,4) I've tried the following: TUPLES = foreach LINES generate FLATTEN(EXTRACT(line,'foo="([0-9]+)"')); But this yields only the first match in each line: (1) (1) (1)

    Read the article

  • Best Template Engine for ASP.NET MVC

    - by OnesimusUnbound
    I am exploring ASP.NET MVC and I wanted to add jQuery to make the site interactive. I used StringTemplate, ported to .Net, as my template engine to generate html and to send JSON. However, when I view the page, I could not see it. After debugging, I've realized that the $ is used by the StringTemplate to access property, etc and jQuery uses it too to manipulate the DOM. Gee, I've looked on other template engines and most of them uses the dollar sign :(. Any alternative template engine for ASP.Net MVC? I wanted to retain jQuery because MSFT announced that it will used in the Visual Studio (2008?) Thanks in Advance :)

    Read the article

  • Why doesn't GCC produce a warning when assigning a signed literal to an unsigned type?

    - by maerics
    Several questions on this website reveal pitfalls when mixing signed and unsigned types and most compilers seem to do a good job about generating warnings of this type. However, GCC doesn't seem to care when assigning a signed constant to an unsigned type! Consider the following program: /* foo.c */ #include <stdio.h> int main(void) { unsigned int x=20, y=-30; if (x > y) { printf("%d > %d\n", x, y); } else { printf("%d <= %d\n", x, y); } return 0; } Compilation with GCC 4.2.1 as below produces no output on the console: gcc -Werror -Wall -Wextra -pedantic foo.c -o foo The resulting executable generates the following output: $ ./foo 20 <= -30 Is there some reason that GCC doesn't generate any warning or error message when assigning the signed value -30 to the unsigned integer variable y?

    Read the article

  • Subprocess fails to catch the standard output

    - by user343934
    I am trying to generate tree with fasta file input and Alignment with MuscleCommandline import sys,os, subprocess from Bio import AlignIO from Bio.Align.Applications import MuscleCommandline cline = MuscleCommandline(input="c:\Python26\opuntia.fasta") child= subprocess.Popen(str(cline), stdout = subprocess.PIPE, stderr=subprocess.PIPE, shell=(sys.platform!="win32")) align=AlignIO.read(child.stdout,"fasta") outfile=open('c:\Python26\opuntia.phy','w') AlignIO.write([align],outfile,'phylip') outfile.close() I always encounter with these problems Traceback (most recent call last): File "<string>", line 244, in run_nodebug File "C:\Python26\muscleIO.py", line 11, in <module> align=AlignIO.read(child.stdout,"fasta") File "C:\Python26\Lib\site-packages\Bio\AlignIO\__init__.py", line 423, in read raise ValueError("No records found in handle") ValueError: No records found in handle

    Read the article

  • Convert xs:Enumerations in XSD to dropdown lists in Excel

    - by ashwnacharya
    I have an XSD file which contains the schema for my XML. The XSD file contains an xs:Enumeration definition, which allows me to choose between 5 options as a value for one of the nodes. Now, we want to be able to generate this data through Excel, so that non techie people can create it... When I import this XSD file into Excel, i want the xs:enumeration values to be listed as dropdowns. How do I get to do that? Edit: Starting a bounty. To win, I need a working sample code for this :)

    Read the article

  • Best tool to check and ensure PDF/A compatibility under Linux

    - by Sven Lilienthal
    I am working on an online portal, where researchers can upload their research papers. One requirement is, that all PDFs are stored in PDF/A-format. As I can't rely on the users to generate PDF/A conforming documents, I need a tool to check and convert standard PDFs into PDF/A format. What is the best tool you know of? Price Quality Speed Available APIs Open-source tools would be prefered, but a search revealed none. iText can create PDF/a, but converting isn't easy to do, as you have to read every page and copy it to a new document, losing all bookmarks and annotations in this process. (At least as far as I know, if you know of an easy solution, let me know). APIs should be available for either PHP, Java or a command-line-tool should be provided. Please do not list either GUI-only or Online-only solutions.

    Read the article

< Previous Page | 185 186 187 188 189 190 191 192 193 194 195 196  | Next Page >